The URL can be used to link to this page

Home My WebLink About43994-Z 1`g11FF01� �0 Cd�� Town of Southold 10/6/2020 �4�o G1 P.O.Box 1179 co 53095 Main Rd Southold,New York 11971 CERTIFICATE OF OCCUPANCY No: 41503 Date: 10/6/2020 THIS CERTIFIES that the building COMMERCIAL Location of Property: 62600 CR 48, Greenport SCTM#: 473889 See/Block/Lot: 40.-3-1 Subdivision: Filed Map No. Lot No. conforms substantially to the Application for Building Permit heretofore filed in this office dated 7/19/2019 pursuant to which Building Permit No. 43994 dated 7/19/2019 was issued, and conforms to all of the requirements of the applicable provisions of the law. The occupancy for which this certificate is issued is: apartment building#5 with first floor units 501, 502, 503 (with covered entry)and second floor units 504 and 505 (with decks)as applied for. The certificate is issued to Vineyard View Housing Dev Fund of the aforesaid building. SUFFOLK COUNTY DEPARTMENT OF HEALTH APPROVAL C10-18-0007 9/18/2020 ELECTRICAL CERTIFICATE NO. 43994 6/24/2020 PLUMBERS CERTIFICATION DATED A4 th rized i nature 1 TOWN OF SOUTHOLD 0, 411 4�0 1 BUILDING DEPARTMENT TOWN CLERK'S OFFICE }� SOUTHOLD, NY o f' BUILDING PERMIT (THIS PERMIT MUST BE KEPT ON THE PREMISES WITH ONE SET OF APPROVED PLANS AND SPECIFICATIONS UNTIL FULL COMPLETION OF THE WORK AUTHORIZED) Permit#: 43994 Date: 7/19/2019 Permission is hereby granted to: Vineyard View Housing Dev Fund 2100 Middle Country Rd Centereach, NY 11720 To: construct foundation as applied for per Planning, SCHD, Trustees and DEC Non-Jurisdiction letter. (Building #5) At premises located at: 62600 CR 48, Greenport SCTM # 473889 Sec/Block/Lot#40.-3-1 Pursuant to application dated 7/19/2019 and approved by the Building Inspector. To expire on 1/17/2021. Fees: NEW COMMERCIAL, ALTERATION OR ADDITIONS $250.00 CO -COMMERCIAL $50.00 Total: $300.00 4— BuilcMg Inspector Form No.6 TOWN OF SOUTHOLD BUILDING DEPARTMENT TOWN HALL 765-1802 APPLICATION FOR CERTIFICATE OF OCCUPANCY This application must be filled in by typewriter or ink and submitted to the Building Department with the following: A. For new building or new use: 1. Final survey of property with accurate location of all buildings, property lines, streets, and unusual natural or topographic features. 2. Final Approval from Health Dept. of water supply and sewerage-disposal (S-9 form). 3. Approval of electrical installation from Board of Fire Underwriters. 4. Sworn statement from plumber certifying that the solder used in system contains less than 2/10 of I% lead. 5. Commercial building, industrial building, multiple residences and similar buildings and installations, a certificate of Code Compliance from architect or engineer responsible for the building. 6. Submit Planning Board Approval of completed site plan requirements. B. For existing buildings (prior to April 9, 1957) non-conforming uses, or buildings and "pre-existing" land uses: 1. Accurate survey of property showing all property lines, streets, building and unusual natural or topographic features. 2. A properly completed application and consent to inspect signed by the applicant.If a Certificate of Occupancy is denied,the Building Inspector shall state the reasons therefor in writing to the applicant. C. Fees 1. Certificate of Occupancy -New dwelling$50.00,Additions to dwelling$50.00, Alterations to dwelling$50.00, Swimming pool $50.00, Accessory building$50.00,Additions to accessory building$50.00,Businesses $50.00. 2. Certificate of Occupancy on Pre-existing Building- $100.00 3. Copy of Certificate of Occupancy - $.25 4. Updated Certificate of Occupancy - $50.00 5. Temporary Certificate of Occupancy -Residential $15.00, Commercial $15.00 Date. June 18, 2019 New Construction: X Old or Pre-existing Building: (check one) Location of Property: 62600 County Road 48, Building 5, Greenport, NY 11944 House No. Street Hamlet Owner or Owners of Property: Vineyard View Housing Development Fund Company, Inc Suffolk County Tax Map No 1000, Section 40 Block 03 Lot 01 Subdivision N/A Filed Map. N/A Lot: N/A Permit No. "✓ lq Date of Permit. Applicant: Vineyard View Housing Development Fund Company, Inc Health Dept. Approval: Underwriters Approval: Planning Board Approval: Request for: Temporary Certificate Final Certificate: X (check one) Fee Submitted: $ —'---'A pp n ignature Town Hall Annex ® Telephone(631)765-1802 54375 Main Road Fax(631)765-9502 P.O.Box 1179 sean.devlin Southold,NY 11971-0959 t town.southold.ny.us a BUILDING DEPARTMENT TOWN OF SOUTHOLD CERTIFICATE OF ELECTRICAL COMPLIANCE SITE LOCATION Issued To Vineyard View Hsing Dev Fnd Address: 62600 CR 48 Bldg 5 City:Greenport st: NY zip: 11944 Building Permit* 43994 Section. 40 Block: 3 Lot: 1 WAS EXAMINED AND FOUND TO BE IN COMPLIANCE WITH THE NATIONAL ELECTRIC CODE Contractor: DBA: Three Brothers Electric License No: 3792ME SITE DETAILS Office Use Only Residential Indoor X Basement Service X Commerical X Outdoor X 1st Floor X Pool New X Renovation 2nd Floor X Hot Tub Addition Survey Attic X Garage INVENTORY Service 1 ph X Heaters 2 Duplec Recpt 17$ Ceiling Fixtures 87 Bath Exhaust Fan 6 Service 3 ph Hot Water Gas 5 GFCI Recpt 19 Wall Fixtures Smoke Detectors 15 Main Panel 6X100 A/C Condenser 5 Single Recpt Recessed Fixtures CO2 Detectors 8 Sub Panel A/C Blower 5 Range Recpt 5 Ceding Fan Combo Smoke/CO Transformer UC Lights Dryer Recpt Emergency Fixturesli Time Clocks Disconnect 400A Switches 76 4'LED Exit Fixtures Pump Other Equipment: Hood-5, Fridges-5, DW-5, Street Lights-3 Notes. 5 Apartments with a Common Area Mechanical Room Inspector Signature: Date: June 24, 2020 S. Devlin-Cert Electrical Compliance Form As sa�ryQl Town Hall Annex Telephone(631)765-1802 54375 Main Road Fax(631)765-9502 P.O.Box 1179 ® 0 Southold,NY 11971-0959 Q Y BUILDING DEPARTMENT TOWN OF SOUTHOLD CERTIFICATION Date: Building Permit No. y?q q q 1 C q 5" Owner: Vin (Aard Oig" a-) (Please print) Plumber: "A+h 0 Y) A 0 (Ple print) I certify that the solder used in the water supply system contains less than 2/10 of 1% lead. ( umbers Signature) Sworn to before me this day of 20��_ NINA A.GIORDANO { NOTARY PUBLIC,State of N^w York Suffolk County, No.01G16048679 Term Expires Jct. 2, 2d Notary Public, Stj County Building., - nr ent A pDIi do .:pli nt is not the Owner) q n y �at`5 �,��A<�. ,,j� *� 1`4.��i" �'�" ��' �ft+�•cd`—.d9,?b�+�� €wsb a �..� i �� d' �� f t . � Ny to Che Southold Building j b NIp (Prizm Or;; ",,Le) `' COUNTY OF SUFFOLK OCT 1 5 2020 q9 STEVEN BELLONE SUFFOLK COUNTY EXECUTIVE DEPARTMENT OF PUBLIC WORKS JOSEPH T.BROWN,P.E. COMMISSIONER ERIC M.HOFMEISTER DARNELL TYSON,P.E. PHILIP A.BERDOLT DEPUTY COMMISSIONER CHIEF DEPUTY COMMISSIONER DEPUTY COMMISSIONER October 5,2020 Conifer Realty,LLC 1000 University Avenue,Suite 500 Rochester,NY 14607 RE: Permit#48-2004,CR 48,Middle Road SCTM 1000-040.00-03.00-001.000 County Treasurer has been authorized to refund your security in the amount of$18,300.00 To Whom It May Concern: This is to advise you that work under the above-referenced permit has been inspected and found to be completed in a satisfactory manner to this Department. Very truly yours, A(,* ca dem pNe�rr Alexander J.Prego,P.E.,P.T.O.E. Director of Traffic Engineering AJP:RFH:KD:shd Cc: Town of Southold, Building Department f a SUFFOLK COUNTY IS AN EQUAL OPPORTUNITY/AFFIRMATIVE ACTION EMPLOYER 335 YAPHANK AVENUE YAPHANK,N.Y. 11980 (631)8524081 FAX(631)8524079 NATIONAL CERTIFIED TESTING LABORATORIES FIVE LEIGH DRIVE - YORK. PENNSYLVANIA 17406 - TELEPHONE(717)846-1200 FAX(717)767-4100 www.nctlinc.com AAMA 506-2006 AAMA 506-2008 STRUCTURAL, IMPACT&CYCLING PERFORMANCE TEST REPORT SUMMARY Rendered to: Ply-Gem Windows 433 N. Main Street Rocky Mount,VA 24151 PRODUCT TYPE: Vinyl Tilt Single Hung Window SERIES/MODEL: Ply Gem 1500 Title Summary of Results Primary Product Designator Class LC-PG50: Size tested 967 x 1957 mm* (-38 x 77 in*)-Type H AAMAIWDMA/CSA 101/I.S.2/A440-11 Class LC-PG50: Size tested 967 x 1957 mm*(38 x 77 in*)-Type H AAMANVDMA/CSA 101/I.S.2/A440-08 AAMA/WDMA/CSA 101/I.S.2/A440-05 H-LC50 967 x 1957*(38 x 77*) Positive Design Pressure, +2873 Pa(+60.0 psf) Negative Design Pressure, -2873 Pa (-60.0 psf) Operating Force(in motion)2 27 N (6 Ibf) Air Infiltration2 0.3 L/s/m2(0.1 cfm/ft) Canadian Air A2 I nfi Itration/Exfi Itration Water Penetration Resistance 360 Pa (7.50 psf) Test Pressure2 Uniform Load Structural Test ±4320 Pa (90.23 psf) Pressure, Forced Entry Resistance2 ASTM F588-07/Grade 10- Pass Impact Missile Level, D Wind Zone, 3 Maximum Cyclic Load Test +2394 Pa(+50.0 psf) Pressure, -2873 Pa +60.0 ps Reference the 967 x 1957 mm(38 x 77 in)product as described in this report 2 Reference test report NCTL-110-15653-1 dated 12/11/12 for 1221 x 2437 mm (48 x 96 in)gateway test results Test Completion Date: 11/21/12 Revision Date 12/17/12 Reference must be made to NCTLA 10-15653-2 dated 12/11/12 for complete test specimen description and data. ora National Certified Testing Laboratories 0"n"'&e le. 7161,/ P t. ° e DONALD R. KYLE, P.E. o DON �{fiyLE�5 Laboratory Representative o.012556 Professionals in The Science of Testing �� 1 of 25 'W.10NAL 16.1 0" v t � F SOU # # TOWN OF SOUTHOLD BUILDING DEPT. `ycouKtv,� 765-1802 INSPECTION [ .] FOUNDATION 1ST [ ] PdUGH PLBG. [ ] FOUNDATION 2ND [ INSULATION [ ] FRAMING /STRAPPING [ ] FINAL [ ] FIREPLACE & CHIMNEY [ ] FIRE SAFETY INSPECTION [ ] FIRE RESISTANT CONSTRUCTION [ ] FIRE RESISTANT PENETRATION [ ] ELECTRICAL (ROUGH) [ ] ELECTRICAL (FINAL) [ ] CODE VIOLATION [ ] CAULKING REMARKS: Ave, DATE INSPECTOR OF SOUIyo * # TOWN OF SOUTHOLD BUILDING [ EPT. co 765-1802 - . INSPECTION [ ] FOUNDATION 1ST [ ] ROUGH PLBG. [ ] FOUNDATION 2ND [ ] INSULATION/CAULKING _ [ ] FRAMING /STRAPPING [ ] FINAL [ ' ] -FIREPLACE & CHIMNEY- [' ] FIRE SAFETY'INSPECTION [ ] FIRE RESISTANT CONSTRUCTION [ ] FIRE RESISTANT PENETRATION ELECTRICAL (ROUGH) [ ] ELECTRICAL (FINAL) [ ] CODE VIOLATION [ ] PRE C/O REMARKS: T=IPYAld tkX::CMC_ DATE 2 INSPECTOR \, t SOF SOUIy -- # # TOWN OF SOUTHOLD BUILDING DEPT. 765-1802 . 'INSPECT- ION - [ ] FOUNDATION 1ST [ ROUGH PLBG. [ ] OUNDATION 2ND J ] INSULATIOWCAULKING [vl FRAMING /STRAPPING [ ] FINAL [ ] FIREPLACE & CHIMNEY- [• ] -FIRE SAFETY INSPECTION [ ] FIRE RESISTANT CONSTRUCTION [ ] -FIRE RESISTANT PENETRATION [ ] ELECTRICAL (ROUGH)' [ ] ELECTRICAL (FINAL) [ ] CODE VIOLATION [ ] PRE C/O REMARKS: , tm �r b V .6IM,r411 (' K✓w Ahs. ew DATE '� INSPECTOR �aOF SOUTy� V�l�►r'1 Xl # TOWN OF SOUTHOLD BUILDING DEPT. �o • �o �ycnurm��' 765-1802 INSPECTION- [ -] FOUNDATION 1ST [ ] ROUGH PLBG. [ ] FOUNDATION 2ND r [t INSULATION/CAULKING [ ] FRAMING /STRAPPING [ ] FINAL [ ] -FIREPLACE & CHIMNEY = [ ] FIRE SAFETY INSPECTION [ ] TIREAESISTANT CONSTRUCTION- [ ] FIRE RESISTANT PENETRATION [ ] ELECTRICAL (ROUGH) [ ] ELECTRICAL (FINAL) [ ] CODE VIOLATION [ ] PRE C/O REMARKS: ON .P�. OdDy" DVA R � F - DATE 1,OlA INSPECTOR _ pFS0//T43qdfq Vuqfitvvlolw TOWN O SOOBUI DING=DEPT. 765-1802 [ ] FOUNDATION 1ST [. ] ROUGH PLBG. [ ] FOUNDATION 2ND- [ ] -INSULATION/CAULKING [ ] FRAMING /STRAPPING [ ] FINAL [ ] -FIREPLACE & CHIMNEY ° [ ] FIRE SAFETY INSPECTION [ ] FIRE RESISTANT CONSTRUCTION [ ] FIRE RESISTANT PENETRATION [ ] ELECTRICAL (ROUGH) ELECTRICAL (FINAL) [ ] -CODE VIOLATION ] PRE C/O REMARKS: DATE INSPECTOR -%X -' TO11MOF SOUTHOLD B UILDING DEPT. �S 765-1802 �391Z -I NSPE T 4�37U Y 37 qq [ ] FOUNDATION 1ST [ ] ROUGH PLBG. 4359 S [ ] FOUNDATION 2ND [ ] INSULATION/CAULKING�� [ ] FRAMING/-STRAPPING [ FINAL g3,K3 j ] FIREPLACE & CHIMNEY FIRE SAFETY INSPECTION [ ] FIRE RESISTANT CONSTRUCTION [ ] FIRE RESISTANT PENETRATION j ] ELECTRICAL (ROUGH) [ ] ELECTRICAL (FINAL) [ ] CODE VIOLATION [ ] PRE-C/O REMARKS: g6elZ- /G f LrC c azz -� X7 -� DATE ' 71 � INSPECTOR �l 3 `q �o��Of SOGTyo6 # # TOWN OF SOUTHOL-D BUILDING DEPT., 765-1802 INSPECTION [ ] FOUNDATION 1ST [ ] R UGH PLBG. [ ] FOUNDATION 2ND = [ ] SULATIOWCAUL,rKIN [ ] FRAMING /STRAPPING [ ] FINALPIA0 U [ ]" FIREPLACE & CHIMNEY [ ] FIRE SAFETY INSPECTION [ ] FIRE RESISTANT CONSTRUCTION [ ] FIRE RESISTANT PENETRATION [ ] ELECTRICAL (ROUGH) [ ] ELECTRICAL (FINAL) [ ] CODE VlObATION [ ] PRE C/O P REMARKS: 1 � � h� 0 Swu l:i -r fil e Co n rC 7K-cz4 DATE INSPECTOR XG July 20, 2020 c� Est 1838 Suffolk County Dept. of Health ,Services NPO Office of Wastewater Management 360 Yaphank Avenue, Suite 2C Yaphank, NY, 11980 236 THIRD STREET GREENPORT NY 11944 Tel: (631) 477-0248 Re: Vineyard View, LLC — "Vineyard View" Community Fax: (631) 4774877 project#: 17106.000 (SCTM#: 1000-040-03-01) SCDHIS Ref #- C10-18-0007 MAYOR GEORGE W.HUBBARD,JR. Ext.215 Please be advised that the above referenced property is TRUSTEES located within an area served by the Village of JACKMARTILOTTA Greenport. Connection to the Village of Greenpor-t's DEPUTY MAYOR PETER CLARKE sewer system • has been completed "in accordance with MARY BESS PHILLIPS the requirements of the Village of Greenport. JULIA ROBINS VILLAGE ADMINISTRATOR Should you have any questions or require any additional PAUL J. PALLAS,P.E. Ext.219 information, please feel free to contact me at (631) 477- 0248, x219. CLERK SYLVIA PIRIL_LO,RMC Ext.206 incerely - TREASURER OII ROBERT BRANDT ' Ext.217 Paul A Pallas, P.E. Village Administrator Village of Greenport L11AIA Lo K. McLean Associates Po C. 437 South Country Road o Brookhaven a New York - 11719 (631)286-8668 e FAX(631)286-6314 ❖ 25 Newbridge Road • Suite 304 o Hicksville o New York o 11801 https://www.lkma.com RAYMOND G.DiBIASE,P E,PTOE,PTP,PRESIDENT and CEO Associates ROBERT A STEELE,P.E.,EXECUTIVE VICE PRESIDENT CHRISTOPHER F DWYER JAMES L DeKONING,RE,VICE PRESIDENT STEVEN W.EISENBERG,P.E ANDREW B.SPEISER MATTHEW C.JEDLICKA,LEED AP KEITH J MASSERIA,P.E VINCENT A.CORRADO,P E July 17, 2020 TAMARA L.STILLMAN,P L S Town of Southold Planning Department- Town Hall Annex Building 54375 Route 25 P.O. Box 1179 Southold,NY 11971 Attn: Mr. John Jarski, Planner Re: Vineyard View,LLC—"Vineyard View" Community Letter Certifying Construction of Final Drainage Plan Project#: 17106.000 (SCTM#: 1000-040-03-01) Dear Mr. Jarski: Pursuant to the Town Planning Department's request, we hereby certify that the revised drainage plan associated with the construction of the above referenced affordable (work-force) housing complex in Greenport was constructed in strict accordance with the plans submitted (via email) to the Southold Town Engineer and New York State Department of Environmental Conservation on January 21, 2020. Neither office objected to the revised plan which incorporated additional corrector piping, enhanced sand collar material, shallow diffusion wells and an overflow structure with indirect discharge to the fieshwater wetland buffer area. Water quality objectives were achieved by providing overflow storage within natural retention areas populated with native grasses/plantings and having multiple leaching pools before entering the overflow discharge chamber (bubbler) along the south side of Building#2. This important component of the project has been completed to our office's satisfaction. If your office should have any questions relative to this site plan approval sub lease do not hesitate to contact this office directly. Very fir ,y yours, �� 'I A 077970 Robert A. Steele P.E.,Ex sident RAS:cfd L.K. McLean Associates PC CC: Joanna Cuevas, Village View, LLC Michael Collins P.E., Southold Town Engineer TODAY'S CHALLENGES I TomoRROw'S SOLUTIONS Since 1950 SUSTAINABLE COMFORT Code Testing Summary: Air Infiltration +Duct Leakage NYS ECCC Report Vineyard View Apartments Greenport, NY Testing Entity Sustainable Comfort, Inc. 1y6 Main Street, Suite 301 Worcester, MA 01608 Project Information: Vineyard View County Road LIS Greenport, NY 119L1y Testing Summary Inspector: Greg Downing RESNET Rater ID Number: Oy2O937 Inspection Dates: Multiple Inspection Dates Air Infiltration Testing Methodology Air infiltration testing has been conducted in accordance with Section RLIO2.y.1.3 of the 2016 New York Energy Code Supplement.The testing target is 0.3 CFM50/sf of enclosure surface area when testing two or more adjoined units. Enclosure area calculations follow code definitions which include the sum of all of the exterior wall area, interior wall area, ceiling area, and floor area of each apartment unit. Air Infiltration Testing Results Testing was conducted in accordance with ASTM E779 at 50 Pascals which resulted in a final CFM5O for each apartment.The CFM5O is then converted into CFM5O/sf of enclosure area to demonstrate each unit falls below the 0.3 CFM5O/sf target.Table 1 shows all of the ' individual testing results. Sample of our Envelope Leakage Test Reports are attached. Reports for all units available upon request. Duct Testing Testing was conducted in accordance with Section RyO3.3.3 of the 2015 IECC.Testing targets match requirements in Section RLI03.3.y, total leakage shall be less than or equal to LI cubic feet per minute per 100 square feet of conditioned floor area. All units with ductwork outside conditioned space have been tested, and meet the criteria listed above. Results can be found in Table 1 below. INSPECTION REPORT 1 SUSTAINABLE COMFORT RESNET HERS Rater Certification Official HERS Rater Certification shown from the RESNET Registry linked below: https://wwwl.resnet.us/registry/raters.aspx Greg Downing Certifying Provider(s) Sustainable Comfort, Inc. Sustainable Comfort 146 Main St 413.262.7390 Worcester, MA 01608 jmoriarty@greenrater.com Current Status: Active CLOSE r• Submitted By: - Greg Downing, Sustainable Comfort, Inc. INSPECTION REPORT 2 SUSTAINABLE COMFORT Table 1: Testing Results Building 1: TARGETS TESTING RESULTS DUCT TOTAL DUCT DUCT UNIT TOTAL DUCT UNIT LEAKAGE TO MODELSET UNIT LEAKAGE LEAKAGETO INFILTRATION LEAKAGE OUTSIDE INFILTRATION OUTSIDE [CFMSOI (OFM2S)E, E E-7 H E E E 38R C3 IstEnd 101 lea 54 1237 7 18R AS lstint 102 80 qo 836,-, 776 q1L 2BR 133.1stEnd 103 80 Ao 1008 , 7 18R AS lstint 104 80 qo 836 " 1BR AS lstInt 105 Be 40 838 38R C3 1stEnd 106 108 54 1237 1BR A2 2ndint 107 38 38 looq = 32 , 28R B2 2ndEnd 108 45 45 1101 1BR A2 2ndint 109 38 38 1004 `37 1BRA2 2ndint 110 1 381 38, Building 2: TARGETS 'TESTING RESULTS DUCT TOTALOUCT DUCT UNIT 14 DOLL SET UNIT TOTAL DUCT LEAKAGE TO UNIT LEAKAGE LEAKAGETO INFILTRATION LEAKAGE OUTSIDE INFILTRATION (OFM261 OUTSIDE (cFm5O] Pyl H F E, (CFM253E, H 3BR 03 lstEnd. 201 108 54 1237 183 28R B3 lstInt 202 80 40 940 6,80 lBR_A3_lstInt 203 80 40 836 791; 1BR AS lstint 204 80 40 836 2BR_B1istEnd 205 80 40 1008 629 33R C3 lstEnd 206 lea 54 1237 2BR 92 2ndEnd 207 45 45 1101 1BR A2 2ndint 208 38 38 1004 67 J.BR A2 2ndint 209 gal 38 0 2BR_32_2ndEnd 210 451 45 11011 INSPECTION REPORT 3 SUSTAINABLE COMFORT Building 3: TARGETS TESTING'RESULTS TOTALDUCT DUCTTOTAL7DTALDUCI" DUCT LEAKAGETO UNIT MODELSET UNIT LEAKAGETD LEAKAGE INFILTRATION LEAKAGE OUTSIDE INFILTRATION (CFM25] OUTSIDE (CFM50] C -1 C E C C (cFM25]C C 38R C3 lstEnd 301 108 54 1237 1.065 2BR Bl 1stEnd 302 80 110 1008 1BRA331stlnt 303 80 40 836 671 113R A3 lstlnt 30L1 80 40 836 2BR B1 1stEnd 305 80 40 1008 680, 3BR C3 1stEnd 306 108 54 1237 1028, 213R 82 2ndEnd 307 45 4S 1101, 32, 11 . - 798' IBR A2 2ndlnt 308 38 38 1004 • 30' ., 10 659' 113R A2 2ndlnt 309 38 381 1004 35 11 727 2BR B2 2ndEnd 310 qS j 45 1101 '37, , ;13 .620 � � Building 4: TARGETS TESTING RESULTS DUCT TOTAL DUCT DUCT UNIT TOTAL DUCT UNIT LFAKA13E 70 MODEL SET UNIT LEAKAGE TO LEAKAGE - INFILTRATION LEAKAGE OUTSIDE INFILTRATION (CFM25] OUTSIDE(CFM 5) � (CFMSO) 4 C C C C C 2BR Bl istEnd 401 80 40 1008 S5 38R 01 lstlnt X102 ill 55 1055 q2 : 21 939, 26R 81 1stEnd 903 80 40 1008 q9 10, 538 2BR 82 2ndEnd �l0y 45 45 1101' " 40, °�` '°�„22 "' '828; 28R_B2_2ndEnd 1105 45 45 110 311 Building 5: TARGETS - TESTING RESULTS TOTAL DUCT bUC'1' UNIT TOTAL DUCT DUCT LEAKAGE70 UNIT MODELSE7 UNIT LEAKAGE TO LEAKAGE INFILTRATION LEAKAGE OUTSIDE INFILTRATION (CFM25] OUTSIDE (CFM50] .Y E E [ (CFM25]E E 2BR Bl lstEnd 501 80 40 1008 5685 3BR C1_1stint 502 56 56 1056 � � 17.� 906 2BR 81 istEnd 503 80 40 1008 672.• 2BR B2 2ndEnd 504 45 45 1101 2BR B2 2ndEnd 505 45 45 1101 32; 5 O INSPECTION REPORT 4 SUSTAINABLE COMFORT Building 6: -TARGETS TESTING RESULTS DUCT TOTALDUCT DUCT UNIT TOTAL DUCT UNIT LEAKAG E TO MODEL SET UNIT LEAKAGE IU LEAKAGE INFILTRATION LEAKAGE INFILTRATION OUTSIDE OUTSIDE [CFh925] [CFM50] (CFM25) �T F F' F 28R B1 1stEnd 601 80 40 1008 38R 01 602 56 56 1055 ql , 16 SBR_C3 1stEnd 603 108 51 1237 1 ,26 920 �3BRC31stEnd 60y 108 54 1237 :'796 1288 B2 2ndEnd 605 415 45 11011, 36 =12 Building 7: TARGETS TESTING RESULTS DUCT TOTALDUCT DUCT UNIT TOTAL DUCT UNIT LEAKAG E TO MODEL SET UNIT LEAKAGE TO LEAKAGE INFILTRATION LEAKAGE OUTSIDE INFILTRATION [CFM25] OUTSIDE [CFM50] C F [ [CFM253F C 13BR C3 1stEnd 701 108 54 1237 a95 3BR C1 lstint 702 56 56 1055 q8 '21 1013' 3BR Cl lstint 703 56 56 1055 �x• 51' 'P6` 1029' 2BR811stEnd 70y 80 40 1008 52� 281 B2 2ndEnd 705 q5I 45 11011-_" 37 ' 15 INSPECTION REPORT 5 ® SUSTNNABLE COMFORT Photos ib • ;i Un, 1g9 is Ys Building 1 - Typical Building Exterior Building 2 - Typical Building Exterior =' T y Af 1W N Typical Duct Leakage Test Setup Typical Leakage to Outside Test Ir K - fir,• r•,..�.�h r'...a��+'ikc�,aM^�;�""' r �� dam., ej•*r_-x. ;aw.'.r.•r. ,` i�i•. Typical Mechanical Ventilation Test Typical Plantings Sao �r-- 7/uterUic y,-,_x,w.�s=�'., �'iu,:. '1,.+„-•- ;sem 1,;;�''i '.,",;. SVS, `yh Site Entry Typical Blower Door Setup INSPECTION REPORT 6 BUILDING LEAFAGE TEST i Date of Test:4/7/2020 Test File: Vineyard View- Unit 102 Technician: Greg Downing Project Number: 17-1421 Customer: Conifer-Lechase Construction Building Address: Vineyard Views 205 Indigo Creek Drive Unit 102 Rochester, NY 14626 County Road 48 Phone: Greenport, NY 11944 Fax: Website:www.conifer-lechase.com Test Results at 50 Pascals: _ n_n (cc- Airflo i M6L`(+/-;4:1 ACH50 6.28 cfm/ft2(Floor Area) 1.0106 jcfm/ft2(Sdrface Area} �0.8 Leakage Areas: 71.2 int (+/- 13.4 %) Canadian EgLA @ 10 Pa or 0.0255 in2/ft2 Surface Area 35.5 int(+/-22.1 %) LBL ELA @ 4 Pa or 0.0127 in2/ft2 Surface Area Building Leakage Curve: Flow Coefficient (C)= 45.9 (+/-35.5%) Exponent (n)= 0.722 (+/-0.097) Correlation Coefficient = 0.99735 Test Standard: E779 Test Mode: Depressurization 1000 900 ----�---�--1--1--1--L------------- -------- ----- -----�---� - 800 - O Depressurize ----------i--------L-----L---- -i--- 70u-----7---i--7--i--r-r--------------,--------i --i-- 600 LL-------------- -------- ------------- ------ �� ---------�---------i------�J� ----- - i i i i i ---------L 500 Building 400 ---+-- -------------- +------+----�--- a--- i i i i i Leakage (Cfm) 300-----i------- ------- --------f--------------+-------�--- 200 i i 1004 5 6 7 8 9 10 20 30 40 50 60 70 Building Pressure (Pa) BUILDING LEAKAGE TEST Page 2 of 4 Date of Test: 4/7/2020 Test File: Vineyard View- Unit 102 Building Information Volume(ft3) 7409 Surface Area: (ft2) 2790 Floor Area: (ft2) 767 Height(ft) 10 Year of Construction 2020 Equipment Information Type Manufacturer Model Serial Number Custom Calibration Date Fan Energy Conservatory Model 3 (110V) MBD- 14741 4/28/2019 Micromanometer Energy Conservatory DG700 35904- 1 -700 4/28/2019 BUILDING LEAKAGE TEST Page 3 of 4 Date of Test:4/7/2020 Test File:Vineyard View- Unit 102 Depressurization Test: Environmental Data Indoor Temperature(°F) Outdoor Temperature(°F) Altitude(ft) Pre-Test 54.0 63.0 Post-Test 54.0 63.0 Average 54.0 63.0 10.0 Data Points- Data Entered Manually(TTE 5.0.8.4) Baseline Nominal adjusted Building Building Fan Nominal Adjusted Pressure Pressure Pressure Flow Flow Fan (Pa) (Pa) (Pa) (cfm) (cfm) %Error Configuration -5.7 n/a n/a -62.9 -57.3 211.1 861 863 0.9 Ring B -55.1 -49.5 157.7 745 747 -2.9 Ring B -46.7 -41.1 133.9 687 689 2.4 Ring B -37.2 -31.6 87.0 555 557 0.0 Ring B -28.1 -22.5 52.6 432 434 -0.4 Ring B Deviations from Standard ASTM E779-Test Parameters BUILDING LEAKAGE TEST Page 4 of 4 Date of Test: 4/7/2020 Test File:Vineyard View- Unit 102 Comments None BUILDING LEAKAGE TEST Date of Test: 6/7/2020 Test File: Vineyard View- Unit 208 Technician: Greg Downing Project Number: 17-1421 Customer: Conifer-Lechase Construction Building Address: Vineyard Views 205 Indigo Creek Drive Unit 208 Rochester, NY 14626 County Road 48 Phone: Greenport, NY 11944 Fax: Website:www.conifer-lechase.com Test Results at 50 Pascals: fm— Airflow [9 7� +/-7.0 ..�___� _ _ c __ � ACH50 7.68 cfm/ft2(Floor Area) 1.0402 Ic m Wt Sdrface Area) -2930' Leakage Areas: 58.8 int(+/-35.3 %)Canadian EgLA @ 10 Pa or 0.0176 in2/ft2 Surface Area 23.0 int(+/-56.6 %) LBL ELA @ 4 Pa or 0.0069 int/ft2 Surface Area Building Leakage Curve: Flow Coefficient (C)= 20.6 (+/-88.9%) Exponent(n)= 0.988 (+/-0.234) Correlation Coefficient =0.99176 Test Standard: E779 Test Mode: Depressurization 2000 I I I I I I p Depressurize I I I I I I I I I I I I I I I I I p I I I I I I I I I I I 900 --�---G---I-- --�-� -------------L-------1-----I-- ---� --� -- I I I I I I I I I I 800 ---t---r--r----,--r-------------rI -------r-I -- ---T---r--r- -- --- --L-J--L-L-------------L-------L- 1----1---L--L-- 700 I I I I I I I I I I I I 600 ---�--- ---- --+--� -------------+-------- -----I----�---�--I I I I I I I I I I I I I Building 500 ---i---L--L-�--L-i-------------L--- --i-----L---i---i--i-- Leakage I I I I I I I I I I I I ---+---I---I-- --+--� ------------- -------a------�---+---+--+-- MM) 400 I I I I I I I I I I I I I I I I I I I I I I I I 300 ------T1IIIIIIIII------IIIILIIIIIr�--rIIILII}III - 1�IIIIIIIIII----LIIIrIIIII -IrIIIIIIIII ------- ------------- - ----r-------- -------------L-------L r1IIIIIIIIIII------ -IrLIIIIIIIIIIr-------200 000 -- -- ------------- ------- - 80 ---- - - 4 5 6 7 8 9 10 20 30 40 50 60 70 80 Building Pressure (Pa) BUILDING LEAKAGE TEST Page 2 of 4 Date of Test: 6/7/2020 Test File:Vineyard View- Unit 208 Building Information Volume (ft') '7660 Surface Area: (fta) 3348 Floor Area: (ft2) 943 Height(ft) 20 Year of Construction 2020 Equipment Information Type Manufacturer Model Serial Number Custom Calibration Date Fan Energy Conservatory Model 3 (110V) MBD- 14741 4/28/2019 Micromanometer Energy Conservatory DG700 35904- 1 -700 4/28/2019 BUILDING LEAKAGE TEST Page 3 of 4 Date of Test: 6/7/2020 Test File:Vineyard View-Unit 208 Depressurization Test: Environmental Data Indoor Temperature(°F) Outdoor Temperature(°F) Altitude (ft) Pre-Test 72.0 84.0 Post-Test 72.0 84.0 Average 72.0 84.0 10.0 Data Points- Data Entered Manually(TTE 5.0.8.4) Baseline Nominal adjusted Building Building Fan Nominal Adjusted Pressure Pressure Pressure Flow Flow Fan (Pa) (Pa) (Pa) (cfm) = (cfm) %Error Configuration -60.3 -60.6 36.8 1103 1157 -2.5 Ring A =54.1 -54.5 29.7 993 1043 -2.3 Ring A -46.1 -46.5 237.2 912 957 4.9 Ring B -37.7 -38.1 155.5 740 776 3.6 Ring B -27.9 -28.3 74.4 513 539 -3.5 Ring B Deviations from Standard ASTM E779-Test Parameters BUILDING LEAKAGE TEST Page 4 of 4 Date of Test: 6/7/2020 Test File:Vineyard View- Unit 208 Comments None q399� OFFICE 3 (- OFFICE LOCATION: MAILING ADDRESS: Town Hall Annex P.O.Box 1179 54375 State Route 25 ��' Southold,NY 11971 (cor.Main Rd. &Youngs Ave.) ' Southold,NY f1 [ - R Telephone: 631765-1938 4 www.southoldtownny.gov . i PLANNING BOARD OFFICE TOWN OF SOUTHOLD DDJuly�3, 2020 J U L 2 4 2020 Christopher F. Dwyer L.K. McLean Associates PC BUELPITGDEFT. 437 South County Road Brookhaven, NY 11719 Re: Approved Residential Site Plan for Vineyard View Located at 62600 CR 48, ±1,600' n/e/o Chapel Lane & CR 48, Greenport SCTM#1000-40.-3-1 Zoning District: Hamlet Density- HD Dear Mr. Dwyer: The Planning Board-has found that the requirements of the above-referenced Site Plan have been completed based on the site inspections made on July 13, 2020 and July 15, 2020. The site is now in conformance with the Approved Residential Site Plan entitled Vineyard View" prepared,by L.K. McLean Associates, P.C., dated March 5, 2018, and last revised December 18, 2018. This letter does not condone any other changes from the approved Residential Site Plan and approvals from other,agencies; Planning Board approval is required prior to any significant changes to the site. Respectfully,, Donald J. Wilcenski Chairman cc: MichaelVerity, Chief Building Inspector Michael Collins, Town Engineer ,FIELD INSPECTION REPORT ' • j �- - FOUNDATION(IST) U,Lila ZWNIL ------------ FOUNDATION 1 ROUGH FRAMING& PLUMBING - _ INSULATION . . STATE ENERGY • 1 FOA ✓ c � a ADDITIONAL COMMENTS ISM,# -FAIp' wilt s TOWN OF SOUTHOLD BUILDING PERMIT APPLICATION.CHECKLIST BUILDING DEPARTMENT Do you have or need the following,before applying? TOWN HALL � �' ' ' Board of Health SOUTHOLD, NY 11971 4 sets of Building Plans TEL: (631) 765-1802 Planning Board approval FAX: (631) 765-9502 Survey Southoldtownny.gov PERMIT NO. Check Septic Form N.Y.S.D.E.C. Trustees C.O.Application liqFlood Permit Examined ,20 Single&Separate Truss Identification Form Storm-Water Assessment Form Contact: Approved ,20 Mail to: Disapproved a/c Phone: Expiration 120 Bu' mg nspector APPLICATION FOR BUILDING PERMIT Date June 18 520 19 INSTRUCTIONS a. This application MUST be completely filled in by typewriter or in ink and submitted to the Building Inspector with 4 sets of plans, accurate plot plan to scale. Fee according to schedule. b. Plot plan showing location of lot and of buildings on premises, relationship to adjoining premises or public streets or areas, and waterways. c. The work covered by this application may not be commenced before issuance of Building Permit. d. Upon approval of this application,the Building Inspector will issue a Building Permit to the applicant. Such a permit - shall be kept on the premises available for inspection throughout the work. e. No building shall be occupied or used in whole or in part for any purpose what so ever until the Building Inspector issues a Certificate of Occupancy. f Every building permit shall expire if the work authorized has not commenced within 12 months after the date of issuance or has not been completed within 18 months from such date. If no zoning amendments or other regulations affecting the property have been enacted in the interim,the Building Inspector may authorize, in writing,the extension of the permit for an addition six months. Thereafter, a new permit shall be required. APPLICATION iS HEREBY MADE to the Building Department for the issuance of a Building Permit pursuant to the Building Zone Ordinance of the Town of Southold, Suffolk County,New York, and other applicable Laws, Ordinances or Regulations, for the construction of buildings, additions, or alterations or for removal or demolition as herein described. The applicant agrees to comply with all applicable laws, ordinances, building code, housing code, and regulations, and to admit authorized inspectors on premises and in building for necessary inspections. Vineyard View Housing Development Fund Company, Inc. (Signature of applicant or name,if a corporation) 2100 Middle Country Road, Centereach, NY 11720 (Mailing address of applicant) State whether applicant is owner, lessee, agent, architect, engineer, general contractor, electrician, plumber or builder Owner Name of owner of premises Vineyard View Housing Development Fund Company, Inc. As on the tax roll or latest deed K (� ) I li i t= signat re�of'duly,author-ized 'officers (Na e nd title of corporate officer) Builders License No. Plumbers License No. Electricians License No. Other Trade's License No. 1. Location of land on which proposed work will be done: 62600 County Road 48, Building 5, Greenport House Number Street Hamlet County Tax Map No. 1000 Section 40 Block 03 Lot 01 4 Subdivision Filed Map No. Lot 2. State existing use and occupancy of premises and intended use and occupancy of proposed construction: a. Existing use and occupancy undeveloped b. Intended use and occupancy multifamily 3. Nature of work (check which applicable):New Building_? Addition Alteration Repair Removal Demolition Other Work (Description) 4. Estimated Cost$1,024,577 Fee (To be paid on filing this application) 5. If dwelling, number of dwelling units 5 Number of dwelling units on each floor If garage, number of cars 6. If business, commercial or mixed occupancy, specify nature and extent of each type of use. NA 7. Dimensions of existing structures, if any: Front NA Rear Depth Height Number of Stories Dimensions of same structure with alterations or additions: Front NA Rear Depth Height Number of Stories 8. Dimensions of entire new construction: Front 62' Rear 62' Depth 49' Height 25' Number of Stories 2 9. Size of lot: Front 393.5' Rear 432.43' Depth 908.43' 10. Date of Purchase 4/15/19 Name of Former Owner KACE LI. LLC 11. Zone or use district in which premises are situated HD 12. Does proposed construction violate any zoning law, ordinance or regulation? YES NO X 13. Will lot be re-graded? YES x NO Will excess fill be removed from premises? YES NO 14. Names of Owner of Dremises Conifer Realty 56 Railroad Avenue, Copiague NY, 631.721.9555 Name of Architect— BHC Architects 1300 Walt Whitman Road, Melville, NY 631.300.1010 Name of Contractor- Conifer LeChase 205 Indigo Creek Dr, Rochester, NY 585.760.5336 15 a. Is this property within 100 feet of a tidal wetland or a freshwater wetland? *YES X NO * IF YES, SOUTHOLD TOWN TRUSTEES &D.E.C. PERMITS MAY BE REQUIRED. b. Is this property within 300 feet of a tidal wetland? * YES NO IF YES, D.E.C. PERMITS MAY BE REQUIRED. 16. Provide survey, to scale, with accurate foundation plan and distances to property lines. 17. If elevation at any point on property is at 10 feet or below, must provide topographical data on survey. 18. Are there any covenants and restrictions with respect to this property? * YES X NO * IF YES, PROVIDE A COPY. STATE OF NEW YORK) SS: COUNTY OF Gwen O'Shea being duly sworn, deposes and says that(s)he is the applicant (Name of individual signing contract) above named, (S)He is the President (Contractor, Agent, Corporate Officer, etc.) of said owner or owners, and is duly authorized to perform or have performed the said work and to make and file this application; that all statements contained in this application are true to the best of his knowledge and belief, and that the,Qraa �9 ln�si performed in the manner set forth in the application filed therewith. �� P�COM�;T•yF Sworn to before me this Q NOTgRy P °A•• 2_q day of vy , 20 ( I = Q NA�F�EOINSS �C; 4k) ' ♦ •2�COUNT y Z Notary Public ' nature of Applicant '.,oaNew(°��, °1811110, Michael J.Domino,President *1�f SOUlyO Town Hall Annex John M.Bredemeyer III,Vice-President ti0 1p 54375 Route 25 P.O.Box 11 Glenn Goldsmith #[ Southold, New York 11971 A.Nicholas Krupski Telephone (631) 765-1892 Greg WilliamsO Fax(631) 765-6641 11001UNTi BOARD OF TOWN TRUSTEES TOWN OF SOUTHOLD Permit No.: 9174A Date of Receipt of Application: February 23, 2018 /;;4 3 ii Applicant: Kace LI, LLC c/o Michael Kontokosta 2Q,8 SCTM#: 1000-40-3-1 Project Location: 825 North Road, Greenport Date of Resolution/Issuance: March 23, 2018 Date of Expiration: March 23, 2020 Reviewed by: Board of Trustees Project Description: To conduct minor construction activities within 100' from the landward edge of the wetlands for the construction of a 50-unit affordable housing development with a community building, communal play & recreation areas, on-site parking lots, and various rain garden/stormwater retention areas for drainage; and to install and maintain throughout all construction a line of staked hay bales and/or silt fencing to be installed no closer than 100' from the landward edge of wetlands. Findings: The project meets all the requirements for issuance of an Administrative Permit set forth in Chapter 275 of the Southold Town Code. The issuance of an Administrative Permit allows for the operations as indicated on the site plan prepared by L.K. McLean Associates, P.C., dated February 23, 2018, and stamped approved on March 23, 2018. Special Conditions: None. Inspections: Final Inspection & Hay/Bale and/or Silt Fencing. If the proposed activities do not meet the requirements for issuance of an Administrative Permit set forth in Chapter 275 of the Southold Town Code, a Wetland Permit will be required. This is not a determination from any other agency. Michael J. Domino, President Board of Trustees Glenn Goldsmith,President tf so Town Hall Annex Michael J.Domino,Vice-President ,�Q� ��® 54375 Route 25 John M.Bredeme er III P.O. Box 1179 Y 3 Southold,New York 11971 A.Nicholas Krupski CPTelephone(631) 765-1892 Greg Williams �O �Q Fax(631) 765-6641 BOARD OF TOWN TRUSTEES TOWN OF SOUTHOLD CERTIFICATE OF COMPLIANCE # 1724C Date: July 16,2020 THOS CERTIFIES that the conduct of minor construction.activities within,100' from the landward'edge of the wetlands for the construction of a 50-unit affordable housin ,d evelopinent with a-community bgildhig, communal play &recrea_t - ion areas-on-site parking lots and various rain garden/stormwater retention areas for drainage and to install and maintain throughout all construction a line of staked hay_ bale`s'and/or;silt fencing to be'insta]led-to closer than 106' from the landwardd-edge ofwetlands.i At 62600 C.R. 48, Greenport' Suffolk County Tax Map#1000-40-3-1 Conforms to the application for a Trustees Permit heretofore filed in this office Dated February 23, 2018 pursuant to which Trustees Administrative Permit#9174A Dated March 23, 2018,was issued and conforms to all of the requirements and conditions of the applicable provisions of law. The project for which this certificate is being issued is for the conduct of minor construction activities withih 1,00'from the landward-edge of the wetlands for,the-construction of a 50=unit affordable housing development with a commtulity_ building, communal play&recreation-.areas on-site-parkina lets, and various fain gar'den/siormwater retention areas for,drainage; and to install mid`inaintain 1.hroughout all construction a line 6f`staked hay bales and/or-silt fencing to be installed no closer than 1.00-',from the landward edge ofwetlands. The certificate is issued to Kace LI, LLC c/o Michael Koritokosta owner of the aforesaid' ropen�ty'. Authorized Signature NEW YQRK STATE DEPARTMENT OF ENVIRONMENTAL CONSERVATION Division of Environmental Permits,Region 1 SUNY d Stony Brook,50 Circle Road,Stony Brook,NY 11790 P (631)444-0365 1 F (631)444-0360 www dec.ny.gov LETTER OF NO-JURISDICTION: FRESHWATER WETLANDS ACT & NOTIFICATION OF POSSIBLE ENDANGERED SPECIES ACT JURISDICTION September 18, 2018 Vineyard View LLC 1000 University Ave., Ste. 500 Rochester, NY 14607 Re: DEC# 1-4738-03637/00002 62600 Co Rt. 48 Greenport, NY 11944 SCTM# 1000-40-03-01 Dear Vineyard View LLC: Based on the information you have submitted, the New York State Department of Environmental Conservation has determined that: Your proposed project, to construct a 50-unit housing development with a community building and communal play and recreation areas, as shown on•the plans prepared by BHC Architects/ L.K. McLean Associates, P.C. last revised July 19, 2018, is more than 100 feet from regulated freshwater wetlands. Therefore, no permit is required pursuant to the Freshwater Wetlands Act(Article 24) and its' implementing regulations (6NYCRR Part 663). Be advised, that all construction, clearing, and/or ground disturbance must remain more than 100 feet from the freshwater wetland boundary. In.addition, all excavated sediments must be contained on your property and prevented from washing into the street and subsequently into the wetland Furthermore, any additional work, or modification to the project as described, including any expansion of the lawn area beyond the "proposed silt fence installed at limits of clearing" shown on the referenced plan, may require authorization by this Department. Please contact this office if such are contemplated. Please be further advised that DEC has documented the presence of suitable habitat for the Northern Long Eared Bat (NLEB) on the subject property; in addition, the occurrence of this species in multiple locations In the surrounding area has been confirmed by this Department. The Northern Long Eared Bat is listed by both New York State and the U.S Fish&Wildlife Service as a threatened species. Your proposed project could result in a "take" of this protected species if tree cutting were performed when any Northern Long Eared Bats were actively using roost trees on the,property. The term "take" is defined in part'as the direct killing or injury of individual members of a protected species, interference with critical breeding, foraging, migratory or other essential behaviors, or the adverse modification of the species' habitat The r NEW YORK Department of sort as __ U+.`t'+"244i1fY Environmental y Conservation Iddd 1 ' J` i "take" of a species listed as endangered or threatened is prohibited in the absence of a permit from this Department issued pursuant to ECL §11-535. ` Since the habitat at the project site is similar in structure to confirmed habitat for this species in nearby areas, it is reasonable to anticipate that the NLEB could potentially use this area during the summer roosting season. In order to avoid the Endangered Species "take" situation, we strongly recommend that NO tree cutting activities be conducted at the project site between the dates of April 1 and October 31 of each calendar year. In the event that tree management activities take place between April 11t and October 31St, and any bats are observed flying from a tree, or on a tree that has been cut, tree management activities in the area should be suspended and DEC Wildlife staff notified immediately (at 631-4440307 or kevin.jennings@dec.ny.gov). An Incidental Take permit may be required to continue work prior to November 111 Finally, please be aware that DEC's guidance on NLEB management is subject to change as new information becomes available; thus while an Incidental Take permit-is not required for the referenced project at this time, it may be required in the future. If you have questions about the presence of protected species on or near,your property, the potential effects of activities on these species or your responsibilities as a landowner or project sponsor under the Endangered Species Regulations, please contact the Regional Wildlife Manager at (631) 444-0307 This letter shall remain valid unless site conditions change. Please note that this letter does not relieve you of the responsibility of obtaining any necessary permits or approvals from other agencies or local municipalities. Check#14665 for$100 is being returned to L.K. McLean Associates with their copy of this letter. Currently, no fee is required for a jurisdictional determination. Sincerely, George W. Hammarth Permit Administrator sla cc: L.K. McLean Associates, P.C. BOH Wildlife file °OFFICE LOCATION: MAILING ADDRESS: Town Hall Annex �QF SQUry P.O.Box 1179 54375 State Route 25 �� Ol0 Southold,NY 11971 (cor. Main Rd. &Youngs Ave.) Southold, NY Telephone: 631 765-1938 N www.southoldtownny.gov oly00U ,� PLANNING BOARD OFFICE TOWN OF SOUTHOLD March 12, 2019 Christopher F. Dwyer L.K. McLean Associates PC 437 South County Road Brookhaven, NY 11719 Re: Approved Residential Site Plan for Vineyard View Located at 62600 CR 48, ±1,600' n/e/o Chapel Lane.& CR 48, Greenport SCTM#1000-40.-3-1 Zoning District: Hamlet Density - HD Dear Mr. Dwyer: This letter is to inform you that conditions A - D detailed in the January 14, 2019 Planning Board resolution approving the site plan have been satisfied,. Enclosed, please find the endorsed site plans for the residential site plan application referenced above. We have also enclosed the Planning Board letter dated January 17, 2019 permitting clearing to begin prior to building permits being issued. If you have any questions regarding this Site Plan or its process, please do not hesitate to call this office. Respectfully, Brian A. Cummings Planner _ cc: Joanna Cuevas, Conifer Michael Verity, Chief Building Inspector with map James Richter, Stormwater Manager with map Encl. OFFICE LOCATION: MAILING ADDRESS: Town Hall Annex ��f S�Ury P.O.Box 1179 54375 State Route 25 �Q� �� Southold,NY 11971 (cor.Main Rd. &Youngs Ave.), Telephone: 631,765-1938 Southold,NY _ www.southoldtownny.gov cou�m PLANNING BOARD OFFICE TOWN OF SOUTHOLD January 17, 2019 Christopher-F. Dwyer :. L.K. McLean Associates PC -,437 South County,Road ' Brookhaven, NY11719 Re: Site Plan Approval: Residential Site Plan for Vineyard View Located at 62600 CR 48, ±1,600' n/e/o Chapel Lane & CR 48, Greenport SCTM#1000-40.-3-1 Zoning District: Hamlet Density - HD Dear Mr. Dwyer: The following resolution was adopted at a meeting of the Southold Town Planning Board on January 14, 2019: WHEREAS, this proposed Residential Site Plan is for 50 multiple dwelling.units in seven buildings. All units are proposed to be offered for rent at rates set by the federal government for affordability for.the next 50 years. The plan includes 14 one-bedroom units, 22 two-bedroom units and 14 three-bedroom units, a 2,649 sq. ft. community center, 104 parking spaces; and various other associated site improvements, on a vacant 17.19-acre parcel of which 10 acres will be preserved as open space (6.3 acres upland and 3.7 acres wetlands), in the Hamlet Density (HD) Zoning District located on the s/s of County Road 48 ±1,600' n/e/o Chapel Lane, Greenport; and WHEREAS, on February 28, 2018 and March 22, 2018, Christopher Dwyer, authorized agent, submitted a Residential Site Plan Application for review; and WHEREAS, on March 26, 2018, the Planning Board accepted the application as complete for review; and WHEREAS, on April 6, 2018, the Planning Board, pursuant to Southold Town Code §280- 131 C., distributed the application to the required agencies for their comments; and Y Vineyard View Page 2 January 17, 2019 WHEREAS, on April 9, 2018, the Planning Board, pursuant to State Environmental Quality Review Act (SEQRA) 6 NYCRR, Part 617, determined that the proposed action is an Unlisted Action as it does not meet any of the thresholds of a Type I Action, nor does it meet any of the criteria on the Type II list of actions; and WHEREAS, on April 9, 2018, the Planning Board,set the preliminary public hearing for May 7, 2018; and WHEREAS, on April 10, 2018, Christopher Dwyer, authorized agent, submitted a code- compliant photometric plan for review; and WHEREAS, on April 10, 2018, the Southold Town Chief Building Inspector determined that the proposed use is not permitted in the Hamlet Density (HD) Zoning District; and WHEREAS, on April 18, 2018, the Architectural Review Committee (ARC) approved the proposed action as submitted; and WHEREAS, on April 20, 2018, the Suffolk County Department of Health Services (SCDHS) determined that a wastewater treatment permit is required; and WHEREAS, on April 27, 2018, the Southold Town Transportation Commission provided recommendations to the Planning Board; and WHEREAS, on May 4, 2018, the Suffolk County Water Authority (SCWA) issued a letter of water availability for the subject site; and WHEREAS, on May 7, 2018, a Preliminary Public Hearing was held and closed; and WHEREAS, on May 14, 2018, the Southold Town Trustees approved the proposed action as submitted; and WHEREAS, on May 16, 2018, the Planning Board sent a request to the Southold Town Zoning Board of Appeals (ZBA) for a determination on whether the proposed use is permitted in the Hamlet Density (HD) zoning district; and WHEREAS, on May 29, 2018, the, Southold Town Fire Inspector reviewed and determined that there was adequate fire protection and emergency access for the site; and WHEREAS, on May 31, 2018, the Greenport Fire District determined there was adequate fire protection for the site; and WHEREAS, on June 20, 2018, the Southold Town Engineer reviewed 'the proposed application and determined the site plan met the minimum requirements of Chapter 236 for Storm Water Management; and T Vineyard View Page 3 January 17, 2019 WHEREAS, on June 22, 2018, the Planning Board reviewed the proposed application and required a Visual Impact Analysis due to the property's location on the New York State Scenic Byway. They also required some additional information, and that the driveway location be marked at the site to facilitate a site visit by the Planning Board and the Suffolk County Department of Public Works (SCDPW); and WHEREAS, in answer to the request by the Planning Board for a clarification on interpreting the bulk schedule relative the density and unit size for this project, as well as a determination on the proposed use and whether it is permitted in the Hamlet Density zoning district, the Southold Town Zoning Board of Appeals (ZBA), on July 30, 2018, determined the following: (1) the Planning Board's utilization of the Density; Minimum Lot Size and Bulk Schedules in the Town Code as described is consistent with the Zoning Code; and (2) the residential site plan known as Vineyard View, consisting of seven (7) multiple dwellings containing a total of 50 dwelling units, as applied for; is a permitted use in the HD zoning district and all of the proposed dwelling units comply with Density, Minimum Lot Size and Bulk Schedules in the Town Code pursuant to ZBA file #7195; and WHEREAS, on August 6, 2018, a Public Hearing was held and kept open for written comments until August 20, 2018; and WHEREAS, on August 7, 2018, Christopher Dwyer, authorized agent, submitted a Visual Impact Analysis for review; and WHEREAS, on September 5, 2018, the Planning Board accepted the revised yield map dated October 2017 and last revised August 30, 2018. The yield map required revision due to the New York State Department of Environmental Conservation's requirement that a different wetlands delineation than the one they originally used was required; and WHEREAS, on September 12, 2018, Christopher Dwyer, authorized agent; submitted a revised photometric plan for review; and WHEREAS, on September 14, 2018, the Town of Southold Local Waterfront Revitalization Program Coordinator reviewed the proposed project and determined the project to be consistent with Southold Town LWRP policies with recommendations to the Planning Board; and WHEREAS, at a Work Session on September 24, 2018, the Planning Board reviewed the proposed application and required revisions to the Site Plan to make it comply with various applicable sections of the Town Code; and WHEREAS, on September 25, 2018, the Planning Board received a Letter of No Jurisdiction from the New York State Department of Environmental Conservation with Vineyard View Paqe 4 January 17, 2019 recommendations for the protection of Northern Long-eared Bats, a federal and state-listed threatened species; and WHEREAS, on October 9, 2018 the Suffolk County Planning Commission (SCPC) provided comments regarding the proposed action; and WHEREAS, on October 15, 2018, the Southold Town Planning Board, as Lead Agency pursuant to SEQRA, made a determination of non-significance for the proposed action and granted a Conditioned Negative Declaration; and WHEREAS, on October 15, 2018, the Southold Town Planning Board determined that while the proposed residential site plan presents a proper case for requiring a park, a suitable park cannot be properly located on the property, and a fee of $343,000.00 is required in lieu thereof; and WHEREAS, on October 15., 2018, the Southold Town Planning Board determined that the proposed action is consistent with the policies of the Town of Southold Local Waterfront Revitalization Program; and WHEREAS, on October 23, 2018, the Southold Town Board passed a resolution, (2018- 946) to waive the Park & Playground fee for this application; and WHEREAS, on October 25, 2018, the Suffolk County Department of Public Works (SCDPW) determined that a highway work permit is required; and WHEREAS, on December 14, 2018 the Planning Board received a Bond Estimate (aka Performance Guaranty) and referred it to the Office of the Town Engineer for review; and WHEREAS, on January 4, 2019, Christopher Dwyer, authorized agent, submitted revised site plans for review; and WHEREAS, at their meeting on January 14, 2019, the Planning Board approved the Bond Estimate (aka Performance Guaranty) in the amount of $223,185.30, and recommended same to the Town Board; and WHEREAS, on January 14, 2019, the Southold Town Planning Board determined that all applicable requirements of the Site Plan Regulations, Article XXIV, §280 — Site Plan Approval of the Town of Southold were met; and RESOLVED, that the Southold Town Planning Board hereby grants Approval With Conditions, listed below, of the residential site plan entitled "Vineyard View" prepared by L.K. McLean Associates, P.C., dated March 5, 2018, and last revised December 18, 2018, and authorizes the Chairman to endorse the site plan after Conditions "A" through "D" below are met: Vineyard View Page 5 January 17, 2019 Conditions (to be fulfilled prior to approval/endorsement of site plan) A. Obtain approval from the Suffolk County Department of Health Services (SCDHS) and provide one (1) print of the approved plan including the allowable flow for the site with the seal, stamp and signature of the SCDHS. B. Obtain a highway work permit from the Suffolk County Department of Public Works (SCDPW). C. Performance guaranty (aka Bond) estimate approved by resolution of the Town Board, as submitted on 12/17/2018. The intent of this performance guaranty is to include any off-site improvements required by the Board, and, at a minimum, enough funds to take the necessary steps to secure or restore'the site (e.g. security fence) and prevent erosion and runoff, and any other hold-over measures should there be a failure'on the, part of the applicant to complete the project. D. Performance Guaranty submitted and accepted by Planning Board and Town Board. Conditions of approval (ongoing) Vineyard View Site Plan Application Approved January 14, 2019 1. There shall be no subdivision of this parcel resulting in additional building lots. No lot lines shall be changed unless authorized by the Town Planning Board by a majority plus one vote and after a public hearing. ,2. All aspects of the project shall be constructed and maintained substantially in accordance with the approved site plan including the architectural drawings, except where the site plan is amended as authorized by the Town Planning Board. r3. Covenants and Restrictions (C&Rs) acceptable to the Planning Board are to be filed by the applicant with the Office of the Suffolk County Clerk prior to receiving certificates of occupancy. 4. The community building and grounds are for the personal enjoyment of the occupants of units in Vineyard View and their guests, and shall not be rented or leased for use by others for special events, including but not limited to weddings, fund-raisers and parties. 5. There shall be no more than 50 dwelling units. Accessory apartments a`re not permitted. 6. The property owner will provide signage for bike safety as frequently as`the Suffolk County Department of Public Works (SCDPW) will allow in the stretch of CR 48 between the site's driveway and Moore's Lane; on both sides of the road. The design of Vineyard View Page 6 January 17, 2019 the signs will be in accordance with the SCDPW. In addition, the Town Planning Board will send a request to the SCDPW for additional measures to provide bicycle and pedestrian safety along this stretch of CR 48, and if additional measures such as pavement markings or additional signage are approved by the County prior to their receiving their certificate of occupancy, Conifer will install them in the shoulders between the site driveway and Moore's Lane. 7. The property owner will purchase and install a bus shelter as shown on the approved site plan, if approved by the SCDPW prior to their receiving their certificate of occupancy. The design of the bus shelter must be substantially similar in appearance to the other bus shelters located in the Town, or otherwise acceptable to the Town Planning Board. The property owner shall maintain any future bus shelter located at this site. 8. All exterior lighting on the property, including lighting on the residential units, shall comply with the provisions of Chapter 172 of the Town Code, and the lighting plan pages of the approved site plan. Any future exterior light fixtures not shown on the approved site plan must be reviewed for compliance and approved by the Planning Board prior to installation. 9. All exterior signage on the property, shall comply with Town Code. Any future signage not shown on the approved site plan must be reviewed for compliance and approved by the Planning Board prior to installation. 10.Parking for residents or visitors to this development is permitted in designated parking areas only. No parking on County Road 48. 11.All trees and landscaping are required to be maintained by the property owner as shown on the approved site plan. Should a tree die or otherwise be destroyed, it must be replaced with the same species and size as shown on the approved site plan within 6 months. Any change in tree or landscaping species must be approved in writing by the Planning Board. 12.Affordability a. In years 1 through 50, the maximum rents and maximum family income of tenants shall be in accordance with section 42 of the IRS tax code, or as Section 42 may be amended in the future. Fifty percent of the units shall be affordable and reserved for households earning up to 50% of the U.S. Department of Housing and Urban Development (HUD) Area Median Income (AMI) for Nassau and Suffolk County (or the current designated geography) and 50% of the units shall be affordable and reserved for households earning up to 60% HUD AMI for Nassau and Suffolk County (or the current designated geography). Year 1 begins upon receipt of the final certificate of occupancy Vineyard View Page 7 January 17, 2019 b. From year 51 on, 50% of the units shall be affordable and reserved for families earning up to 80% of the HUD Area Median Income for Nassau and Suffolk County (or the current designated geography) in accordance with the same formula used in calculating Section 42 rents and income. c. The owner or manager of this property will provide updates on the AMI and utility allowances to the Town Planning Board and Town Government Liaison annually. 13.Groundwater Conservation a. A separate well(s) shall be used for all irrigation to reduce the use of water from the Suffolk County Water Authority's system. b. No more than 1,000 gallons per day shall be used for irrigation. c. The well(s) shall include a meter to monitor the use of water for irrigation. A report of the number of gallons of water used each month for irrigation must be sent annually to the Planning Board. d. The pump for the well(s) shall not create noise that measures more than 50dB at the nearest residential structure. e. The use of native, drought-tolerant plants and drip irrigation in landscaping is _ required. f. An irrigation timing plan will be implemented for the site to be irrigated in phases so that sections of the site are irrigated on alternating days and the entire site is not irrigated all at the same time. g. An organic matter soil amendment (i.e. composted leaf mold) will be incorporated into the topsoil at a ratio of one part organic matter to two parts native topsoil, to increase its water-holding capacity. h. Coarse mulch at a minimum depth of 3" is required on all planted material. i. Soil moisture sensors will be used with the irrigation system, to water only when .necessary during times of low soil moisture. j. Total long-term irrigation of the site will be limited to 15% of the land area of the site. k. Low-flow plumbing fixtures shall be used within the residential units and the community building on the property. Vineyard View Page 8 January 17, 2019 14.Surface and Groundwater Quality Protection a. The application of synthetic herbicides and pesticides is prohibited. b. The use of pesticides on and around surface waters (wetlands, storm water controls, ponding) is prohibited. c. The application of integrated pest management is encouraged. d. Fertilizer will be applied only after it has been determined to be necessary by soil test, and only in the smallest amount necessary. e. Only organic-based nitrogen fertilizer with a low-Nitrogen nutrient ratio and high percentage of Water-Insoluble Nitrogen (WIN), 50 percent minimum is permitted to be used. This practice will allow for slow release of nitrogen, driven only by biological activity, typically in soil temperatures above 55° F, and will prevent nitrogen leaching. f. A maximum of 1 Ib of nitrogen per 1,000 square feet in any one application with cumulative application of no more than 2 lbs per 1,000 square feet per year is permitted. g. The use of phosphorous containing lawn fertilizer is prohibited unless establishing a new lawn or soil test shows that the lawn does not have enough phosphorus. Fertilizer labels have three bold numbers. The number in the middle is the percentage of phosphorus in the product, e.g. 22-0-15. Use of products with 0.67 in the middle or lower is not restricted. Products with a number higher than 0.67 may only be used if a new lawn is being established or a soil test indicates it is necessary. h. A staging area, during construction, for heavy equipment, vehicle parking, materials and stockpiling, fuel storage and handling, etc. should be pre- designated and located as far from wetlands as possible. Spill protocols shall be enacted. 15.Wildlife Habitat Protection Areas (Non-Disturbance Buffer and Wetlands) a. A vegetated non-disturbance buffer hereinafter the "non-disturbance buffer", and the wetlands areas, as shown on the approved site plan, shall be protected for the purpose of preserving existing trees and natural vegetation, and providing wildlife habitat and a buffer to the adjacent wetlands and woodlands. The areas are to be left in their natural state. Vineyard View Page 9 January 17, 2019 b. Vegetation Removal or Disturbance i. The cutting, removal or disturbance of vegetation, including trees, shrubs, and groundcover, is prohibited in the non-disturbance and wetland areas, except to remove dead or invasive non-native plants or trees. Any cutting, removal or disturbance of vegetation must receive prior written consent of the Southold Town Planning Board. This written consent may be granted only to control or prevent the spread of disease or invasive plant or animal species. The non-disturbance buffer may be supplemented with native vegetation plantings according to a re-vegetation plan with prior written consent of the Southold Town Planning Board. ii. A dead or diseased tree in the non-disturbance buffer that, in the opinion of a certified arborist, represents an imminent threat to structures or people, may be removed without prior Planning Board approval, and the arborist shall submit a report of any such removal to the Planning Board within one business day after such removal. Vegetation must be hand-pulled, hand-cut, or cut with machinery selective enough to keep nearby native plants intact to the greatest extent practicable. c. Excavation, grading and removal'of natural materials are prohibited. d. No structures are permitted in the non-disturbance and wetland areas. e. The use of motorized vehicles is prohibited in the non-disturbance and wetland areas. f. Dumping or accumulation of unsightly or offensive materials including, but not limited to trash, garbage, sawdust, ashes or chemical waste is prohibited in the non- disturbance and wetland areas. 16.Wildlife Protection During Construction a. The land area to be cleared shall be staked and inspected by the Planning Board or their designees, as well as the Town Engineering Department prior to any land clearing. b. Site clearing activities shall begin at CR 48 and proceed towards the open space/natural areas. c. The Town Planning Department and the Town Engineering Department shall be notified by phone or email two days prior to clearing taking place on site. d. Wildlife sweeps conducted by a qualified wildlife biologist prior to clearing by heavy equipment will be required. Vineyard View Page 10 January 17, 2019 17. Eastern Box Turtle To minimize the loss of Eastern Box Turtles, the entire area of construction must be encircled by silt-fencing (aka turtle barriers) as described below prior to any clearing at the site. Any clearing at the site scheduled from April 1St through October 31St will be preceded ` by box turtle surveys following the protocol below: a. Prior to the commencement of any clearing activity, temporary turtle barriers (silt fencing) shall be installed around the limits of work and pre-construction turtle surveys must be conducted during appropriate weather conditions. b. Installation of the temporary turtle barriers must minimize vegetation disturbance. No clearing may occur outside the Limits of Work as shown on the approved site plan page E1 "Conditions and Removals". c. The bottom of the silt fencing must be buried in a 4-6 inch deep trench. The trench must be backfilled and compacted. If it is not possible to dig a trench, then the bottom of the barrier must be affixed to the surface. d. The silt fencing must be composed of at least 2 %Z feet of vertical barrier above ground. Once installed, the barrier shall be taut between the stakes. Slumps or loose materials will undermine the effectiveness of the barrier. No hay bales or other backing material shall be used. e. The limits of work must be encircled completely by the silt fence to exclude turtles from entering the area, but able to be opened for equipment to go in and out during working hours (and closed again at the end of the work day). f. The turtle barrier (silt fencing) should be installed immediately prior to the required survey. g. The biologist leading the survey shall inspect the barrier and facilitate any repairs/alterations necessary to ensure the integrity of the barrier. h. Turtle barriers may not be removed from the site until the project is complete and is stabilized by vegetation. i. Surveys for Eastern Box Turtles must be led by a herpetologist or wildlife biologist with experience locating wild box turtles. j. The survey effort required must equal the following. area of impact x 4 person- hours/acre = total person-hours of survey effort. Vineyard View Page 11 January 17, 2019 k. Timing of survey • The survey for Eastern Box Turtles must be conducted immediately preceding clearing activity. • Surveys must be conducted at the time of peak activity for turtles, to the greatest extent practicable and as advised by the herpetologist. I. Any box turtles found during the search will be captured and relocated to an undisturbed area on the property as far from the proposed clearing as possible. M., Documentation and results of the survey must be provided to the Planning Department as soon as possible after completion and prior to clearing. Routine turtle barrier maintenance: Maintenance of the turtle barrier is required during the Turtle Active Season (April 1 st through October 31 st) — Once per month a person familiar with barrier maintenance and installation shall inspect the barrier and facilitate any repairs or alterations. The turtle barrier should remain taut between stakes and any holes along the bottom repaired. Outside the Turtle Active Season (November 1st through March 31st) A biologist shall conduct an early season inspection in late March or early April to facilitate any repairs or alteration necessary for the turtle barrier to function for turtle protection. 18.Northern long-eared bat a. No tree removal during the pup season from June 1 through July 31. b. A wildlife biologist experienced with finding bats will be deployed on site prior to any tree-clearing to search for any signs of bat roosting. c. As recommended by the NYS DEC, any clearing between April 1 and October 31 will require vigilance to avoid a taking of this federal and state-listed threatened species. d. Trees around the perimeter shall be preserved within the buffer shown on the site plan. e. Trees capable of providing roost trees within the development area shall be preserved to the greatest extent practicable. Vineyard View Page 12 January 17, 2019 19.Construction Management a. Construction activities shall only occur from 7:00 a.m. to 6:00 p.m. on weekdays and Saturdays. b. No construction activities are permitted on Sundays, year-round, or the following holidays: • New Year's Day • Memorial Day • Independence Day (July 4th) • Labor Day • Thanksgiving • Christmas Day Please also note the following requirements in the Southold Town Code relating to Site Plans: 1. Any additional lighting fixtures or lighting fixtures that are different than those approved as part of the Lighting Plan for this site plan application require Planning Board review and approval prior to installation. 2. All storm water run-off from grading, driveways and gravel areas must be contained on site. 3. Proposed storm water run-off containment systems must be inspected by the Town Engineer at the time of installation. Please call the Southold Town Engineer prior to beginning this work. 4. Approved Site Plans are valid for eighteen months from the date of approval, within which time all proposed work must be completed, unless the Planning Board grants an extension. 5. Any changes from the Approved Site Plan shall require Planning Board approval. 6. Prior to the issuance of a Certificate of Occupancy, the Planning Board must inspect the site to ensure it is in conformity with the Approved Site Plan, and issue a final site inspection approval letter. Should the site be found not in conformance with the Approved Site Plan, no Certificate of Occupancy may be issued unless the Planning Board approves the changes to the plan A copy of the Approved Site-Plan is enclosed for your records. One copy will also be sent to the Building Department and the Town Engineer/Highway Department. Vineyard View Page 13 January 17, 2019 If you have any questions regarding the above, please contact this office. Respectfully, Donald J. Wilcenski Chairman Encl. cc: Allen Handelman, Conifer Michael Verity, Chief Building Inspector James Richter, Stormwater Manager By signing this letter, the applicant acknowledges that there are Town Code requirements and conditions, including those listed above, that must be satisfied prior to the issuance of a Certificate of Occupancy. Vineyard View, LLC. BY:Vineyard View Managing Member, LLC. BY:Conifer Realty, LLC. Print name: By: Lisa Kaseman, Regional Vice Preside Applicant Signature: Date: 02/15/2019 NEW YQRK STATE DEPARTMENT OF ENVIRONMENTAL CONSERVATION Division of Environmental Permits,Region 1 SUNY r Stony Brook,50 Circle Road,Stony Brook,NY 11790 P.(631)444-03651 F:(631)444-0360 www.dec.ny.gov LETTER OF NO-JURISDICTION: FRESHWATER WETLANDS ACT & NOTIFICATION OF POSSIBLE ENDANGERED SPECIES ACT JURISDICTION September 18, 2018 Vineyard View LLC 1000 University Ave., Ste. 500 Rochester, NY 14607 Re: DEC# 1-4738-03637/00002 62600 Co Rt. 48 Greenport, NY 11944 SCTM# 1000-40-03-01 Dear Vineyard View LLC: Based on the information you have submitted, the New York State Department of Environmental Conservation has determined that: Your proposed project, to construct a 50-unit housing development with a community building and communal play and recreation areas, as shown on the plans prepared by BHC Architects/ L.K. McLean Associates, P.C. last revised July 19, 2018, is more than 100 feet from regulated freshwater wetlands. Therefore, no permit is required pursuant to the Freshwater Wetlands Act(Article 24) and its' implementing regulations (6NYCRR Part 663). Be advised, that all construction, clearing, and/or ground disturbance must remain more than 100 feet from the freshwater wetland boundary. In,addition, qll excavated sediments must be contained on your property and prevented from washing into the street and subsequently into the wetland. Furthermore, any additional work, or modification to the project as described, including any expansion of the lawn area beyond the "proposed silt fence installed at limits of clearing" shown on the referenced plan, may require authorization by this Department. Please contact this office if such are contemplated. Please be further advised that DEC has documented the presence of suitable habitat for the Northern Long Eared Bat (NLEB) on the subject property; in addition, the occurrence of this species in multiple locations in the surrounding area has been confirmed by this Department. The Northern Long Eared Bat is listed by both New York State and the U.S Fish&Wildlife Service-as a threatened species. Your proposed project could result in a "take" of this protected species if tree cutting were performed when any Northern Long Eared Bats were actively using roost trees on the property. The term "take" is defined in part as the direct killing or injury of individual members of a protected species, interference with critical breeding, foraging, migratory or other essential behaviors, or the adverse modification of the species' habitat. The r NEW YORK I Department of AIL Ctl �_ iv+rnn•nr Environmental Conservation f "take" of a species listed as endangered or threatened is prohibited in the absence of a permit from this Department issued pursuant to ECL §11-535. Since the habitat at the project site is similar in structure to confirmed habitat for this species in nearby areas, it is reasonable to anticipate that the NLEB could potentially use this area during the summer roosting season. in order to avoid the Endangered Species "take" situation, we strongly recommend that NO tree cutting activities be conducted at the'project site between the dates of April 1 and October 31 of each calendar year In the event that tree management activities take place between April 1st and October 31St, and any bats are observed flying from a tree, or on a tree that has been cut, tree management activities in the area should ' be suspended and DEC Wildlife staff notified immediately (at 631-4440307 or kevin.jennings@dec.ny.gov). An Incidental Take permit may be required to continue work prior to November 1St Finally, please'be aware that DEC's guidance on NLEB management is subject to change as new information becomes available; thus while an Incidental Take permit is not required for the referenced project at this time, it may be required in the future. If you have questions about the presence of protected species on or near your property, the potential effects of activities,on these species or your responsibilities as a landowner or project sponsor under the Endangered Species Regulations, please contact the Regional Wildlife Manager at (631) 444-0307. This letter shall remain valid unless site conditions change. Please note that this letter does not relieve you of the responsibility of obtaining any necessary permits or,approvals from other agencies or local municipalities. Check#14665 for$100 is being returned to L.K. McLean Associates with their copy of this letter. Currently, no fee is required for a jurisdictional determination. Sincerely, George W. Hammarth Permit Administrator sla cc: L.K. McLean Associates, P.C. BOH Wildlife file r , : "" FF BUILDING DEPARTMENT- Electrical Inspectorell ; TOWN OF SOUTHOLD Town Hall Annex - 54375 Main Road - PO Box 1179 Southold, New York 11971-0959 Telephone (631) 765-1802 - FAX (631) 765-9502 ,- rogerr@southoldtownny.gov— seandCa southoldtownny.gov c APPLICATION FOR ELECTRICAL INSPECTION ELECTRICIAN INFORMATION (All information Required) Date: 10/29/2019 t Company Name: Three Brothers Electric, Inc. Name: Mark Kassay, President (Suffolk County License Holder) License No.: 3792-ME email: MK3BROS@MSN.COM u Address: 6 Enterprise Drive, Suite A, East Setauket NY 11733 i Phone No.: 631-473-0911 JOB SITE INFORMATION (All Information Required) Name: Vineyard View Apartments, Building#05 G Address: Greenport NY Cross Street: W/O Cha el Lane Phone No.: 585-360-7022 Dan Philhower, Job Super BIdg.Permit#: 43994 email: Dan.Philhower@Lechase.com 3 Tax Map District: 1000 Section: Block: 3 Lot: BRIEF DESCRIPTION OF WORK (Please Print Clearly) Wiring of(2)Story Aparment Building consisting of (5)Apartment Units&(1)100 amp,Common Area Meter. Circle All That Apply: Is job ready for inspection?: YES / NO Rough In Final Do you need a Temp Certificate?: ES NO Issued On Temp Information: (All information required) Service Size 1 P 3 Ph Size: 400 A #Meters 6 Old Meter# x New Service Fire Reconnect- Flood Reconnect-Service ReconnectedUnderground - verhead # Underground Laterals 1 2 H Frame Pole Work done on Service? Y N Additional Information: �a PAYMENT DUE WITH APPLICATION 'n� - ^� ( ,,b J� _ -C)5z �g //�c� Request for Inspection Form,xis C' ) (4 BUILDING DEPARTMENT- Electrical Inspector 4" TOWN OF SOUTHOLD ; . Town Hall Annex-54375 Main Road-PO Box 1179-Southold, NY 11971-0959 Telephone (631).765-1802-FAX (631) 765-9502 Temporary Certificate # _ 1-5-7 Date /1-10 - 2020 Customer Name Electrician Name Address , 14 Phone b !1-773 -_0011 *4w UI *- ,5 _ e-mail k - -- M= Phone License # . Size A Phase _ Overhead Underground _ #of Meters Remarks #of Underground Laterals -_ 1 - 2 New, "H" Frame or Pole i H P Fire Reconnect Was work done on Service? Y/N Flood Reconnect Old Meter# Service Reconnected Application for electrical service equipment is on file with the town of Southold.On the applicant's notification that this'installation is complete,the town will conduct a premises inspection of the service equipment. This verification is vali r 9Q d s the date ab ve. Authorized by p� O BUILDING DEPARTMENT-Electrical Inspector TOWN OF SOUTHOLD G Town Hall Annex-54375 Main Road-PO Box 1179-Southold, NY 11971-0959 Telephone (631)765-1802-FAX (631) 765-9502 Temporary Certificate # Date / // 2019 Customer Name Electrician Name S f be- Address 1Aa Phone Q �� e-mail e-mail /L' e Phone License# 717--M SizeLIN) A Phase Overhead Underground #of Meters Remarks #of Underground Laterals 1 2 New "H" Frame or Pole H P Fire Reconnect Was work done on Service? Y/N Flood Reconnect Old Meter# Service Reconnected Application for electrical service equipment is on file with the town of Southold.On the applicant's notification that this installation is complete,the town will conduct a premises inspection of the service equipment. This verification is alid for the date e. Authorized by ��------------------------------------------- Town Hall Annex �$4' Telephone(631)765-1802 54375 Main Road Fax(631)765-9502 P.O.Box 1179 _ Southold, NY 11971-0959 BUILDING DEPARTMENT NOTICE OF UTILIZATION OF TRUSS TYPE CONSTRUCTION, PRE-ENGINEERED WOOD CONSTRUCTION AND/OR TIMBER CONSTRUCTION Date: June 18, 2019 ' Owner: Vineyard View Housing Development Fund Company, Inc Location of Property: 62600 County Road 48, Greenport, NY 11944 Please take notice that the (check applicable line): X New commercial or residential structure Addition to existing commercial or residential structure Rehabilitation to an existing commercial or residential structure to be constructed or performed at the subject property reference above will- utilize (check applicable line): Truss type construction (TT) x Pre-engineered wood construction (PW) Timber construction (TC) in the following location(s) (check applicable line): Floor framing, including girders and beams (F) Roof framing (R) x Floor and roof framing (FR) Signature: Name (person submitting this form): Gwen O'Shea Capacity(check applicable line): X Owner Owner representative TrussReg15.docx Effective 1/1/2015 COUNTY OF SUFFOLK D IR SEP 9 2020 STEVEN BELLONE SUFFOLK COUNTY EXECUTIVE DEPARTMENT OF PUBLIC WORKS ]BUILDING DEPT.. LD JOSEPH T.BROWN,P.E. Cr COMMISSIONER ERIC M.HOFMEISTER DARNELL TYSON,P.E. PHILIP A.BERDOLT DEPUTY COMMISSIONER CHIEF DEPUTY COMMISSIONER DEPUTY COMMISSIONER August 26,2020 Conifer Realty,LLC 1000 University Avenue, Suite 500 Rochester,NY 14607 RE: Permit#48-2004 Date Issued: January 28,2019 Location: CR 48,Middle Road To Whom It May Concern: Our inspection indicates that a portion of the work which you performed upon the County right-of-way, under the above-referenced permit,is not acceptable. You are required to correct this work as listed below in accordance-with Suffolk County standards and specifications: Nature of Correction: • Grind out old thermoplastic edge line. • Clean/sweep asphalt in front of catch basins on CR 48,Middle Road, and clean out basins. Please notify this office when these corrections have been completed in order that a final inspection can be made. If you have any questions,kindly contact this office at(631) 852-4100. Very truly yours, Alexander J.Prego,P.E.,P.T.O.E. Director of Traffic Engineering AJP:KD:shd cc: Town of Southold,Building Department SUFFOLK COUNTY IS AN EQUAL OPPORTUNITY/AFFIRMATIVE ACTION EMPLOYER (631)852-4081 335 YAPHANK AVENUE ■ YAPHANK,N.Y.11980 ■ FAX(631)8524079 Town Hall Annex ��® Telephone(631)765-1802 54375 Main Road o ;Z Fax(631)765-9502 P.O. Box 1179 c Southold, NY 11971-0959 BUILDING DEPARTMENT NOTICE OF UTILIZATION OF TRUSS TYPE CONSTRUCTION, PRE-ENGINEERED_ WOOD CONSTRUCTION AND/OR TIMBER CONSTRUCTION Date: June 18, 2019 Owner: Vineyard View Housing Development Fund Company, Inc Location of Property: 62600 County Road 48, Greenport, NY 11944 Please take notice that the (check applicable line): x New commercial or residential structure Addition to existing commercial or residential structure Rehabilitation to an existing commercial or residential structure to be constructed or performed at the subject property reference above will utilize (check applicable line): Truss type construction (TT) x Pre-engineered wood construction (PW) Timber construction (TC) in the following location(s) (check applicable line): Floor framing, including girders and beams (F) Roof framing (R) x Floor and roof framing (FR) Signature: Name (person submitting this form): Gwen O'Shea Capacity(check applicable line): X Owner Owner representative TrussRegMdocx Effective 1/1/2015 '� :: -"7;:2�+�-t f� ".,<.4 Y�-ir K„y; L�•rp v'+z, .max cz•uFF�.:re_% :FRN f - I Sufrolk County Departnle �at ealtla Ue..... AP" s a�41 ter Cansta•t.ctiQn_G,,h1•T'• �•, e -hari Single ranlily Reference No. ��'�-Qoo7 Design Flow "I O Use(s) Q9 Ti.ese plans have�eerl re:iL�ed for�£; t ' Count Le �, errl co�,Lerrsrza,,�:vit: `Y Department of h Suliull; Fpl Healtll �r�rs�,c .; s�. xr g �„ I �o<. alis, relating to Prater Sil L'lld .Y:$NL' Ql_•potal. Pkozardles- iucor,sis�ellcies ur lzcl� cf' _ of alit' cllli;siolls, t3 QCta�, L7:i5�i"c:'�lfu� i3 J."fl'tiiF$(i -W` �32 1T1 accordance t7 a fllc: ,� �standards,un),, Con o_C• :.1..0t+•.,1..y`.�2crt2---d�lda, applicable .jsaDpro.jalebP lre3dyears from fife approval UP.tX e6sExt, T ded c n I d. Approval Dat, XjRi 0 r -hD � 1300 Walt Whitman Road, ~` 11747 Melvl ` Coven in+s IZD, CC11 YLe L+(b n Phone 631 300 1010 C wl 1 owner/developer k . / �l.(�L(QC t lCONIFER REALY LLC ,. 83 E. Main Street,Suite 600, tq?A2"Afs � Rochester, New York 14604 tet, � � 3� C.D Site/Civil Consultant • yam, XA S-9 Funfib iW*Aiw 0 Aul ,5 LSC. AATE�, P!C: Water Line(s)WWT REP tnS By]`he LONG 'ISLAND,:M, 437 SOUT?j COUNTRY RD., Suffolk COLIrtY Def'-: N-k--wm Sues. BRROOKhiAVEN, NEW YORK 11719 Cali 852-575q. 41 Hcv,,, ::}r,avance, Tel: 631.286.8668 To Schedule Inspection(s). VINEYARD VIEW NORTH ROAD TOWN OF SOUTHOLD, N.Y. tj PEB EL-23.25 � I / I /`/\ rwNMrm+vut HIR rtiN� I�,a`�`n••� •// I ' //,/•-„;ia• '”" ...Cr"'.•.CY•'...T,Y•"• �rK`�// ��a1/ /" ' / �t�\ `ZO� :F'), Irn ° BLDG.4(TYPE Al � � W o FIN.FLR.EL.=23 25' LLJ LL o \` SE6 / WET /U� --- - - - - - e � (10 's Cal -YA P p (..CT y•'•..' „•,''" '/ tet*.�:1� �'•\ ° �`.] 7� BLDG.5(TYPE Al _„� FIN.FLR.EL.-25 15' ,BET ACK (OfS ) 0 W” D ELII gTfON Y CW.A 0 A =LAND ��jjS EQ' LO,,OIC ! / SER CE IN / I . I (TYPIC / // ..r'••. �_ - __ -- � 1 �1 Y.a.�.?(• :.X'Y"k"�'".�.Y'YY'YY1'�'YYYYs.!`.!"I I ��`.' •1.17' ry n „n —,.--n- .n...•–t:---••-n- •.�v 4 A, box tri 7',v /KI / N 0 / O 564,Ste, J� ,�,OF NFw 1 hereby certify that this map was made 1 completed by me on 07/16/2019, 08/12/' 050528 LAND S TAMARA L. SULU' " P.L.S. NYSPLS No. 5052 - rrc,:._-si . •- - _rr zF`t�;r-!-�'�,:'. ,.-"ter _ . .^• .- _ xr,:�,-_'._�.-._r.�...k,.-.--.-e._..r_.=..._._.1�0 -. � .. -..--..--' - ��.-.. ....I� _ - I I I j SUFFOLK COUNTY DEPARTMENT OF HEALTH SERVICES i • -ApPROM OF CONSTRUCTED WORKS I ' I I pa H.S.Ref.No. C IkMg -0-0 The sewage disposal an8water sucpted andlores I at this location have pe certified by this 4epanent or other agencies and f and to be atisfactory. j Craig Knepper, P.E., Chief Office of Wastewater-Man-agement i SHEETS L 6 ` "SHEET 3 RECEIVE® _ SHEET 2," ..SHEET 4 ti V.l `a VIE SEP 11 2020 LM SEP 1 8 2020 j l SUFF.CO.HEALTH SERVICES OFFICE OF WASTEWATER MGT. U gN(; R T ITC e�_.I.]THOLD I - 09/11/2020 D.M. INCLUDED DETAIL'OF PUMP STATION T.L.S. ' DATE BY DESCRIPTION` APPROV. BY REVISIONS ; Town- of Southold Suffolk "County, New York 626,00 , COUNTY ROAD 48 VINEYARD' VIET!IT, ")LLC As-BuiltSur ,- �;OF._NEwy Pump Station and _ vey ,Force Main L. K. _McLEAN ASSOCIATES, P y CONSULTING ENGINEERS Sc LAND SURVEYnRS, 437 SO. ' COUNTRY ROAD," BROOKHAVEN, NEW 'YORK; ! Sheet -No.'` t� \��F' 050528 Q4 Designed BY P.L. Scale: 1"= 30' ¶ �II REScheck Software Version 4.6.5 Compliance Certificate Project Vineyard View - Building's 4 & 5 Type A Energy Code: 2015 IECC Q.GHITECT Location: Greenport, New York pP PPRD C C Construction Type: Multi-family Project Type: New Construction LLJ T Conditioned Floor Area: 2,812 ft2 CUO O ;f Glazing Area 18% a- �v } Climate Zone: 4 (5572 HDD) d'-7j6S Permit Date: Old Permit Number: STATE Construction Site: Owner/Agent: Designer/Contractor: County Road 48 Conifer, LLC BHC Architects, LLC Greenport, NY 11944 1000 University Avenue 1300 Walt Whitman Road Rochester, NY 14607 Melville, NY 11747 (585) 324-0546 (631) 300-1010 chardeen@bhc-architects.com 'Compliance: Passes using UA trade-off compliance- 2.3%Better Than Code Maximum UA: 832 Your UA- 813 Maximum SHGC: 0.40 Your SHGC: 0.40 The%Better or Worse Than Code Index reflects how close to compliance the house is based on code trade-off rules It DOES NOT provide an estimate of energy use or cost relative to a minimum-code home. Envelope Assemblies Gross Area Cavity Cont. Perimeter Floor 1: Slab-On-Grade:Unheated 231 10.0 0.767 177 Insulation depth: 2.0' Floor 2:All-Wood joist/Truss:Over Unconditioned Space 2,812 19.0 0.0 0.047 132 Roof 1: Flat Ceiling or Scissor Truss 2,812 38.0 0.0 0.030 84 Front Wall: Wood Frame, 16" o.c. 1,107 21.0 0.0 0.057 48 Window A:Vinyl/Fiberglass Frame:Double Pane with Low-E 26 0.360 9 SHGC: 0.40 Window B:Vinyl/Fiberglass Frame:Double Pane with Low-E 35 0.360 13 SHGC: 0.40 Window E:Vinyl/Fiberglass Frame:Double Pane with Low-E 26 0.360 9 SHGC: 0.40 Door A: Glass 100 0.250 25 SHGC: 0.40 Door B: Glass 80 0,190 15 SHGC: 0.40 Rear Wall: Wood Frame, 16"o.c. 1,107 21.0 0.0 0.057 47 Window A:Vinyl/Fiberglass Frame:Double Pane with Low-E 52 0.360 19 SHGC: 0.40 Window B:Vinyl/Fiberglass Frame:Double Pane with Low-E 210 0.360 76 SHGC: 0.40 Door C: Solid 20 0.130 3 Project Title: Vineyard View- Building's 4 & 5 Type A Report date: 06/12/19 Data filename: LA10002 -Conifer-Vineyard View\00-Design\02-Documents\06-ComCheck & Page 1 of10 ResCheck\ResCheck- Building A.rck Gross Area Cavity Cont. Perimeter Left Wall:Wood Frame, 16" o.c. 882 21.0 0.0 0.057 45 Window A:Vinyl/Fiberglass Frame:Double Pane with Low-E 52 0.360 19 SHGC: 0.40 Window B:Vinyl/Fiberglass Frame:Double Pane with Low-E 18 0.360 6 SHGC: 0.40 Window D:Vinyl/Fiberglass Frame:Double Pane with Low-E 23 0.360 8 SHGC: 0.40 Right Wall:Wood Frame, 16"o.c. 882 21.0 0.0 0.057 45 Window A:Vinyl/Fiberglass Frame:Double Pane with Low-E 52 0.360 19 SHGC: 0.40 Window B:Vinyl/Fiberglass Frame:Double Pane with Low-E 18 0.360 6 SHGC: 0.40 Window D:Vinyl/Fiberglass Frame:Double Pane with Low-E 23 0.360 8 SHGC: 0.40 Compliance Statement. The proposed building design described here is consis with the building plans,specifications, and other calculations submitted with the permit application.The propo g h en designed to meet the 2015 IECC requirements in REScheck Version 4.6.5 and to comply with the mandatory re uirement Ii in th Scheck Inspection Checklist. UA'Co► CC(b �av l Name-Title Sign Date Project Title: Vineyard View- Building's 4 & 5 Type A Report date: 06/12/19 Data filename: LA10002 -Conifer-Vineyard View\00-Design\02-Documents\06-ComCheck & Page 2 of10 ResCheck\ResCheck- Building A.rck CREScheck Software Version 4.6.5 NJ/ Inspection Checklist Energy Code: 2015 IECC Requirements: 0.0% were addressed directly in the REScheck software Text in the "Comments/Assumptions" column is provided by the user in the REScheck Requirements screen. For each requirement, the user certifies that a code requirement will be met and how that is documented, or that an exception is being claimed. Where compliance is itemized in a separate table, a reference to that table is provided. Section Plans Verified, Field Verified # Pre-Inspection/Plan.Review Value Value Complies? Comments/Assumptions & Req.ID '' 103.1, lConstruction drawings and []Complies 103.21 1documentation demonstrate j ❑Does Not [PR11 energy code compliance for the 0 I building envelope.Thermal ❑Not Observable (envelope represented on ❑Not Applicable construction documents. 103.1, Construction drawings and ❑Complies 103.2, documentation demonstrate []Does Not 403.7 energy code compliance for [PR3]1 ilighting and mechanical systems. ❑Not Observable , CO) !dwelling serving multiple ❑Not Applicable dwelling units must demonstrate compliance with the IECC Commercial Provisions. { I 302.1, Heating and cooling equipment is; Heating: Heating: ;❑Complies 403.7 sized per ACCA Manual S based Btu/hr Btu/hr ❑Does Not [PR2]2 ion loads calculated PerACCA Manual J or other methods Cooling: Cooling: ❑Not Observable U iapproved by the code official. Btu/hr Btu/hr ❑Not Applicable Additional Comments/Assumptions: 11 High Impact(Tier 1) 2 1 Medium Impact(Tier 2) 3 1 Low Impact(Tier 3) Project Title: Vineyard View- Building's 4 & 5 Type A. Report,date: 06/12/19 Data filename: LA10002 -Conifer-Vineyard View\00-Design\02-Documents\06-ComCheck& Page 3 of 10 ResCheck\ResCheck- Building A.rck Section Plans Verified Field Verified # Foundation Inspection Value Value Complies? Comments/Assumptions & Req.ID 402.1.2 ;Slab edge insulation R-value. R- ; R- ;❑Complies ;See the Envelope Assemblies [FO1]1 ; E] Unheated ;❑ Unheated ;❑Does Not table for values. �7 ;❑ Heated ❑ Heated ;❑Not Observable ❑Not Applicable 402.1.2 Slab edge insulation ft ;❑ ft Complies ;See the Envelope Assemblies [FO3]1 depth/length. ;❑Does Not table for values. ❑Not Observable I ; ; ;❑Not Applicable 303.2.1 A protective covering is installed ❑Complies [FO11]2 to protect exposed exterior ❑Does Not insulation and extends a minimum of 6 in. below grade. ❑Not Observable ; k ❑Not Applicable ; 403.9 Snow-and ice-melting system ❑Complies ; [FO12]2 controls installed. ❑Does Not ❑Not Observable ❑Not Applicable Additional Comments/Assumptions: 11 High Impact(Tier 1) 2 Medium Impact(Tier 2) 3� Low Impact(Tier 3) Project Title: Vineyard View- Buildi'ng's 4 & 5 Type A Report date: 06/12/19 Data filename: LA10002 -Conifer-Vineyard View\00-Design\02-Documents\06-ComCheck& Page 4 of 10 ResCheck\ResCheck- Building A.rck Section Plans Verified Field Verified # Framing/Rough-In Inspection Value Value Complies? Comments/Assumptions & Req.ID 402.1.1, ;Door U-factor. ; U- ; U- ;❑Complies ;See the Envelope Assemblies 402.3.4 ❑Does Not :table for values. [FR1' ;❑Not Observable ❑Not Applicable 402.1.1, (Glazing U-factor(area-weighted U- U- ;❑Complies ;See the Envelope Assemblies 402.3.1, average). :❑Does Not ;table for values. 402.3.3, ; 402.5 ;❑Not Observable [FR2]1 i ; ; ;❑Not Applicable I I I 1 I I I I I I I I 303.1.3 U-factors of fenestration products ❑Complies [FR4] are determined in accordance with the NFRC test procedure or Does Not taken from the default table. []Not Observable i ❑Not Applicable 402.4.1.1 Air barrier and thermal barrier ❑Complies [FR23]1 installed per manufacturer's f ❑Does Not U instructions. ❑Not'Observable ❑Not Applicable 402.4.3 Fenestration that is not site built ❑Complies [FR20]1 is listed and labeled as meeting ❑Does Not AAMA/WDMA/CSA 101/I.S.2/A440 or has infiltration rates per NFRC ❑Not Observable 400 that do not exceed code ; ❑Not Applicable limits. 1 402.4.5 IC-rated recessed lighting fixtures - ❑Complies [FR16]2 sealed at housing/interior finish ❑Does Not and labeled to indicate s2.0 cfm leakage at 75 Pa. ❑Not Observable ❑Not Applicable 403.3.1 Supply and return ducts in attics ❑Complies [FR12]1 insulated >= R-8 where duct is ❑Does Not l >= 3 inches in diameter and >_ R-6 where< 3 inches. Supply and ❑Not Observable return ducts in other portions of ❑Not Applicable the building insulated >= R-6 for diameter>= 3 inches and R-4.2 ; for< 3 inches in diameter. I ; 403.3.5 Building cavities are not used as ❑Complies [FR15]3, ducts or plenums. ❑Does Not ❑Not Observable ❑Not Applicable 403.4 HVAC piping conveying fluids R- ; R- ;❑Complies [FR17]2 above 105 9F or chilled fluids :❑Does Not I I I I below 55 9F are insulated to zR- v ; ;❑Not Observable 3. ❑Not Applicable 403.4.1 Protection of insulation on HVAC ❑Complies [FR24]1 piping. II ❑Does Not [-]Not Observable ❑Not Applicable 403.5.3 Hot water pipes are insulated to ; R- ; R- ;❑Complies [FR18]2 >R-3. U❑Does Not ❑Not Observable ❑Not Applicable 403.6 lAutomatic or gravity dampers are ❑Complies [FR19]2 ;installed on all outdoor air ❑Does Not intakes and exhausts. ❑Not Observable ❑Not Applicable 11 High Impact(Tier 1) 2 Medium Impact(Tier 2) 3 1 Low Impact(Tier 3) Project Title: Vineyard View- Building's 4 & 5 Type A Report date: 06/12/19 Data filename: L:\10002 -Conifer-Vineyard View\00-Design\02-Documents\06-ComCheck& Page 5 of10 ResCheck\ResCheck- Building A.rck Additional Comments/Assumptions: 11 High Impact(Tier 1) 2 Medium Impact(Tier 2) 3 1 Low Impact(Tier 3) Project Title: Vineyard View- Building's 4 & 5 Type A Report date: 06/12/19 Data filename: LA10002 -Conifer-Vineyard View\00-Design\02-Documents\06-ComCheck& Page 6 of10 ResCheck\ResCheck- Building A.rck Section plans Verified Field Verified # Insulation Inspection Value Value Complies? Comments/Assumptions & Req.ID 303.1 ;All installed insulation is labeled ❑Complies ; [IN13]2 {or the installed R-values `` ❑Does Not provided. ' ❑Not Observable ; •❑Not Applicable 402.1.1, Floor insulation R-value. ; R- ; R- ;❑Complies ;see the Envelope Assemblies 402.2.6 ( ;❑ Wood ;❑ Wood ;❑Does Not table for values. [IN1]1 i ❑ Steel ❑ Steel ;❑Not Observable eJ I ❑Not Applicable 303.2, IFloor insulation installed per ❑Complies ; 402.2.7 manufacturer's instructions and r ❑Does Not [IN2]1 in substantial contact with the 100 underside of the subfloor, or floor ❑Not Observable framing cavity insulation is in r ❑Not Applicable ; (contact with the top side of ; sheathing,or continuous ; ;insulation is installed on the r underside of floor framing and extends from the bottom to the top of all perimeter floor framing members. 402.1.1, ;Wall insulation R-value. If this is a, R- ; R- ;❑Complies ;see the Envelope Assemblies 402.2.5, !mass wall with at least 1/z of the ❑ Wood ;❑ Wood ;❑Does Not :table for values. 402.2.6 twall insulation on the wall ;r-1mass E] mass ❑Not Observable [IN3]1 'exterior,the exterior insulation ; ; requirement applies (171110). ;❑ Steel j❑ Steel :❑Not Applicable ; I 303.2 !Wall insulation is installed per ❑Complies ; [IN4]1 Imanufacturer's instructions. ❑Does Not i ❑Not Observable ; ❑Not Applicable Additional Comments/Assumptions: 11 High Impact(Tier 1) 2 Medium Impact(Tier 2) 3 1 Low Impact(Tier 3) Project Title: Vineyard View- Building's 4 & 5 Type A Report date: 06/12/19 Data filename: L:\10002 -Conifer-Vineyard View\00-Design\02-Documents\06-ComCheck & Page 7 of 10 ResCheck\ResCheck- Building A.rck Section Plans Verified Field Verified # Final Inspection Provisions Value Value Complies? Comments/Assumptions & Req.ID 402.1.1, ;Ceiling insulation R-value. ; R- R- ;❑Complies ;See the Envelope Assemblies 402.2.1, E] Wood 'E] Wood ;❑Does Not table for values. 402.2.2, Steel ' 402.2.6 ❑ ;❑ Steel ;❑Not Observable [FI1]1 ; ;❑Not Applicable 303.1.1.1, ;Ceiling insulation installed per ❑Complies 303.2 manufacturer's instructions. ❑Does Not [FI2]1 :Blown insulation marked every 300 ftz. ❑Not Observable ; ❑Not Applicable 402.2.3 lVented attics with air permeable ❑Complies ; [FI22]2 ;insulation include baffle adjacent ❑Does Not Ito soffit and eave vents that extends over insulation. ; ❑Not Observable ❑Not Applicable 402.2.4 ;Attic access hatch and door R- ; R- ;❑Complies [FI3]1 insulation >_R-value of the ;❑Does Not ;adjacent assembly. ;❑Not Observable I ; ; ;❑Not Applicable 402.4.1.2 ;Blower door test @ 50 Pa. <=5 ; ACH 50 = ; ACH 50= ;❑Complies [FI17]1 :ach in Climate Zones 1-2, and :❑Does Not <=3 ach in Climate Zones 3-8. ;❑Not Observable ;❑Not Applicable 403.3.4 ;,Duct tightness test result of<=4 ; cfm/100 cfm/100 ;❑Complies [FI4]1 ;cfm/100 ft2 across the system or ftz ftz :❑Does Not <=3 cfm/100 f:2 without air ❑Not Observable ;handler @ 25 Pa. For rough-in ; Itests,verification may need to ;❑Not Applicable ;occur during Framing Inspection. 403.3.3 ;Ducts are pressure tested to cfm/100 cfm/100 ;❑Complies [FI27]1 :determine air leakage with ftz ftz ;❑Does Not either: Rough-in test:Total I leakage measured with a ; ❑Not Observable pressure differential of 0.1 inch I ;❑Not Applicable Iw.g. across the system including I ;the manufacturer's air handler .enclosure if installed at time of I I ;test. Postconstruction test:Total ;leakage measured with a ; (pressure differential of 0.1 inch :w.g. across the entire system I I ;including the manufacturer's air ; handler enclosure. 403.3.2.1 ;Air handler leakage designated ❑Complies [F]24]1 by manufacturer at<=2%of ❑Does Not design air flow. ❑Not Observable ❑Not Applicable 403.1.1 ;Programmable thermostats ❑Complies [F19]2 !installed for control of primary ❑Does Not i heating and cooling systems and ❑Not Observable initially set by manufacturer to ' code specifications. ❑Not Applicable 403.1.2 Heat pump thermostat installed ❑Complies [FI10]2 �on heat pumps. ❑Does Not 1 ❑Not Observable ❑Not Applicable 403.5.1 4Circulating service hot water ❑Complies [FI11]z ;systems have automatic or ❑Does Not ;accessible manual controls. []Not Observable i ❑Not Applicable 11 High Impact(Tier 1) 2 Medium Impact(Tier 2) 3 1 Low Impact(Tier 3) Project Title: Vineyard View- Building's 4 & 5 Type A Report date: 06/12/19 Data filename: L:\10002 -Conifer-Vineyard View\00-Design\02-Documents\06-ComCheck& Page 8 of10 ResCheck\ResCheck- Building A.rck Section Plans Verified Field Verified # Final Inspection Provisions Value Value Complies? Comments/Assumptions & Req.ID 403.6.1 ;All mechanical ventilation system ❑Complies [FI25]2 ifans not part of tested and listed ❑Does Not HVAC equipment meet efficacy and air flow limits. []Not Observable ❑Not Applicable 403.2 I Hot water boilers supplying heat ❑Complies [FI26]2 !through one-or two-pipe heating ❑Does Not systems have outdoor setback !control to lower boiler water ❑Not Observable ; 'temperature based on outdoor ❑Not Applicable temperature. 403.5.1.1 !Heated water circulation systems ❑Complies [FI28]2 have a circulation pump.The []Does Not system return pipe is a dedicated return pipe or a cold water supply ❑Not Observable ; {pipe.Gravity and thermos- ❑Not Applicable ;syphon circulation systems are not present. Controls for ; circulating hot water system r M pumps start the pump with signal ;for hot water demand within the !occupancy. Controls automatically turn off the pump 'when water is in circulation loop is at set-point temperature and no demand for hot water exists. 403.5.1.2 f Electric heat trace systems ❑Complies [FI29]2 comply with IEEE 515.1 or UL ❑Does Not 1515.Controls automatically ❑Not Observable {adjust the energy input to the heat tracing to maintain the ❑Not Applicable ; !desired water temperature in the piping. ; 403.5.2 :Water distribution systems that ❑Complies ; [F130]2 have recirculation pumps that ❑Does Not pump water from a heated water ❑Not Observable supply pipe back to the heated water source through a cold ❑Not Applicable water supply pipe have a ,demand recirculation water system. Pumps have controls ,that manage operation of the pump and limit the temperature ; iof the water entering the cold ;water piping to 1049F. , 403.5.4 f Drain water heat recovery units ❑Complies [FI31]2 Itested in accordance with CSA ❑Does Not 655.1. Potable water-side ,pressure loss of drain water heat ❑Not Observable I recovery units<3 psi for ❑Not Applicable individual units connected to one �or two showers. Potable water- ; !side pressure loss of drain water I heat recovery units < 2 psi for (individual units connected to (three or more showers. I I 404.1 ;75%of lamps in permanent ❑Complies (FI6]1 (fixtures or 75%of permanent ❑Does Not fixtures have high efficacy lamps. Does not apply to low-voltage []Not Observable 'lighting. []Not Applicable 404.1.1 IFuel gas lighting systems have ❑Complies [FI23]3 no continuous pilot light. ❑Does Not J I ❑Not Observable f ❑Not Applicable 11 High Impact(Tier 1) 2 Medium Impact(Tier 2) 3 1 Low Impact(Tier 3) Project Title: Vineyard View- Building's 4 & 5 Type A Report date: 06/12/19 Data filename: L:\10002 -Conifer-Vineyard View\00-Design\02-Documents\06-ComCheck& Page 9 of 10 ResCheck\ResCheck- Building A.rck Section Plans Verified Field,Verified # Final Inspection Provisions Value Value Complies? Comments/Assumptions & Req.ID 401.3 Compliance certificate posted. ❑Complies [FI7]2 { ❑Does Not ❑Not Observable ❑Not Applicable 303.3 {Manufacturer manuals for ❑Complies [FI18]3 I mechanical and water heating ❑Does Not systems have been provided. { ❑Not Observable ' , { ❑Not Applicable Additional Comments/Assumptions: 11 High Impact(Tier 1) 1,2 1 Medium Impact(Tier 2) 13 1 Low Impact(Tier 3) Project Title: Vineyard View- Building's 4 & 5 Type A Report date: 06/12/19 Data filename: L:\10002 -Conifer-Vineyard View\00-Design\02-Documents\06-ComCheck & Page 10 of10 ResCheck\ResCheck- Building A.rck 2015 I ECC Energy Efficiency Certificate Insulation Rating R-Value Above-Grade Wall 21.00 Below-Grade Wall 0.00 Floor 19.00 Ceiling / Roof 38.00 Ductwork (unconditioned spaces): Glass& Door Rating . Window 0.36 0.40 Door 0.25 0.40 CoolingHeating & Heating System: Cooling System: Water Heater: Name: Date: Comments CONSENT TO INSPECTION Vineyard View Housing Development Fund Company, Inc., the undersigned, do(es) hereby state: Owner(s)Name(s) That the undersigned (is) (are) the owner(s) of the premises in the Town of Southold, located at 62600 County Road 48, Greenport, NY 11944 , which is shown and designated on the Suffolk County Tax Map as District 1000, Section 40 , Block 03_, Lot 01 That the undersigned (has) (have) filed, or cause to be filed, an application in the Southold Town Building Inspector's Office for the following: Vineyard View That the undersigned do(es) hereby give consent to the Building Inspectors of the Town of Southold to enter upon the above described property, including any and all buildings located thereon, to conduct such inspections as they may deem necessary with respect to the aforesaid application, including inspections to determine that said premises comply with all of the laws, ordinances, rules and regulations of the Town of Southold. The undersigned, in consenting to such inspections, do(es) so with the knowledge and understanding that any information obtained in the conduct of such inspections may be used in subsequent prosecutions for violations of the laws, ordinances, rules or regulations of the Town of Southold. Dated: June 18, 2019 (S gna re) Gwen O ea, President (Print Name) (Signature) (Print Name) FIRE PROTECTION CONTRACTOR SHALL: =-- ---- - - 1. ENSURE THAT THE WORK SHALL BE DONE IN ACCORDANCE WITH NEPA CODES, ALL NATIONAL AND LOCAL RULES, REGULATI❑NS & APPLICABLE CODES, _.-_.. .... SHALL SECURE ANY & ALL PERMITS REQUIRED FOR THE WORK & WILL OBTAIN ALL REQUIRED INSPECTIONS DURING THE COURSE OF AND COMPLETION OF WORK. IM All; 2. BE RESPONSIBLE FOR & REQUIRED TO VISIT THE AREAS ENTAILED WITHIN THE SCOPE OF WORK, VERIFY DIMENSIONAL DATA, & REVIEW THE EXISTING CONDITIONS BEFORE PROCEEDING WITH THE WORK. ANT CONFLICTS WITH THE EXISTING CONDITIONS AND/OR SPECIFICATI❑NS SHALL BE IMMEDIATELY BROUGHT TO THE ENGINEER'S ATTENTION PRIOR TO COMMENCING WORK. ATTIC _ ——— — — — — — — —— — — 3. SET AND SUPERVISE: ALL SAFETY PRECAUTIONS, AS OUTLINED PER OSHA STANDARDS, IN CONNECTION WITH THE WORK THROUGHOUT THE PROJECT. ENGINEERING • CONSULTING • SOLUTIONS 4. VERIFY EXACT MEASUREMENTS AT THE JOB SITE, COORDINATE WITH EXISTING CONDITIONS WHERE INSUFFICIENT DETAIL DIMENSIONS ARE AVAILABLE. ALL DIMENSIONS ARE TO BE FINISHED FACE OF CONSTRUCTION UNLESS OTHERWISE NOTED, DIMENSIONS NOTED AS 'CLR' (CLEAR) ARE NOT BABYLON NEW YORK 11702 ADJUSTABLE WITHOUT ENGINEER'S APPROVAL, BEDROOM © BEDROOM — design .com © ® 5. ALL EQUIPMENT SELECTED SHALL FIT INT❑ THE PHYSICAL SPACES INDICATED, ALLOWING SUFFICIENT ROOM FOR ACCESS, SERVICING, REMOVAL AND 2) BEDROOM BEDROOM www. planning�j1 REPLACEMENT OF PARTS ETC, ADEQUATE SPACE SHALL BE ALLOWED FOR CLEARANCE IN ACCORDANCE WITH THE REQUIREMENTS OF APPLICABLE CODES rj BEDROOM �C,f AND LOCAL ORDINANCES. AS PHYSICAL DIMENSIONS AND SPACE REQUIREMENTS OF SUCH EQUIPMENT VARY ACCORDING TO EACH MANUFACTURER, THE CONTRACTOR SHALL BE RESPONSIBLE FOR INITIAL ACCESS AND PROPER FIT. J J 6. MAINTAIN ADEQUATE RECORDS IN WRITTEN AND ELECTRONIC FORMAT THAT CLEARLY DOCUMENT ALL TESTING, TRAINING AND REVIEW PROCEDURES, 2ND FLOOR o� o� o� CLST CLST (LST CLST HALL GEST THIS DOCUMENTATION SHALL INCLUDE, BUT NOT BE LIMITED TO, THE FOLLOWING: NAME & COMPANY ATTENDING PERSONNEL, GENERAL DESCRIPTION OF - - --- - - - - - -- - -- - -- -- - -- - - - - - - - - - - - - - PROCEDURES, DATES,, TIME OF DAY, DEFICIENCIES FOUND, CORRECTIVE ACTION TAKEN, AND NATURE OF FINAL RESULTS, DOCUMENTATION RECORDS - -- - - -- SHALL BE KEPT IN AN ORDERLY, LEGIBLE AND UP-TO-DATE FORMAT, AND READILY AVAILABLE FOR REVIEW BY THE ENGINEER. EACH PROCEDURE CLST (LST DOCUMENT SHALL BEAR THE NAME AND SIGNATURE OF AUTHORIZED REPRESENTATIVE. J HALL J BATH 7. SECURE CERTIFICATES OF INSPECTION AND OF OCCUPANCY AS MAY BE REQUIRED BY AUTHORITIES HAVING JURISDICTION OVER THE WORK HALL BATH 1A ANDPROVIDE RECORD COPIES TO PLANNING AND DESIGN INC„ BABYLON, NEW YORK, 11702, UPON COMPLETI❑N OF THE WORK. CO CO c0 CO BATH qUTIL U711L z Z 8, ALL EQUIPMENT TO BE U,L, LISTED FOR FIRE SERVICE AND SHALL BE COMPATIBLE WITH SYSTEM BEING USED, THE FIRE ALARM PANEL MUST HAVE A '� CO Ir F7(;) q I GROUND SOLID CONNECTION TO COLD WATER MAIN AS PER NEPA 70 & 72. 1170-01 00 O O CO CLST c. UTIL CLST 0\ O O 0 9. MANUAL PULL STATIONS TO BE INSTALLED AT 48' AFF PER NEPA. — — �� i VIS �� AA KITCHEN KITCHEN AA O 10, ALL WALL MOUNTED VISIBLE NOTIFICATION APPLIANCES SHALL BE MOUNTED AT 80' AFF PER NFPA 72. FA.001 ( { lM ( FA.A 0 11, ALL SPOT TYPE DETECTORS SHALL BE A MINIMUM OF 4' FROM CORNERS AND 3' FROM HVAC DIFFUSERS & FLUORESCENT LIGHT FIXTURES. WALL -- CLST __ CE z U) MOUNTED SMOKE DETECTORS SHALL BE MOUNTED 4' FROM CEILING MIN. CEILING WITH 12' MAX. FROM CEILING & ONLY USED WHEN CEILING MOUNTING AI l lF IM CE m O IN ATTIC IN ATTIC IN ATTIC IS NOT POSSIBLE. wZ :) U)ABOVE - - ABOVE CLST ABOVE =) W U) 12. WITH REGARD TO THE PLACEMENT OF SPOT TYPE DETECTORS MANUFACTURE'S RECOMMENDATION'S & NFPA DERATING TABLES WERE USED T❑ VS VS WF P \O W \O DETERMINE THE RATED SPACING FOR THE DEVICES, 1ST FLOOR Vl"J J LD U LL cc 0) 0) 13, REMOTE LED's SHALL BE INSTALLED ON ALL DETECTORS NOT READILY VISIBLE & SHALL BE INSTALLED IN THE IMMEDIATE VICINITY OF THE W r T W DEVICES THEY ARE CONNECTED TO THIS INCLUDES BUT IS NOT LIMITED TO DUCT DETECTORS AND ABOVE CEILING SMOKE DETECTORS, LIVING BEDROOM LIVING Q Q 14, A GENERAL ALARM SHALL BE ANNUNCIATED UPON ACTIVATION OF ANY PULL STATION, FLOW SWITCH, OR DETECTION DEVICE. A SUPERVISORY SIGNAL TELCO LINE FACP SHALL BE ANNUNCIATED UPON ANY TAMPER SWITCH ACTIVATION. A TROUBLE SIGNAL SHALL BE ANNUNCIATED UPON ANY FAILURE OF ANY DEVICE. '` ® O 111clil O 15. CONTROL (RELAY) MODULE FOR FAN SHUTDOWN (IF APPLICABLE) SHALL BE LOCATED WITHIN THREE FEET OF DEVICE BEING CONTROLLED AS WELL AS BEING SUPERVISED. ,CONNECT TO 120\/Ar, - PROJECT BY: 16, ALL WIRING SHALL BE SECURED INDEPENDENTLY TO BUILDING STRUCTURE EVERY FIVE FEET, ALL WIRE BELOW 8' ABOVE FINISHED FLOOR SHALL BE F IRL ALAkM C KT IIP PROTECTED AS PER NFPA AND LOCAL REGULATIONS, F �. ..,... � 17. ALL CABLES & WIRING THAT IS PART OF THIS SYSTEM MUST BE SUPERVISED BY THE FACP S❑ THAT IF THERE IS A FAILURE OF ANY CIRCUIT THE FACP WILL ANNUNCIATE A TROUBLE SIGNAL OR THE CIRCUIT WILL CAUSE A 'FAIL-SAFE CONDITION'. MANUFACTURERS RECOMMENDATIONS AS WELL AS NFPA CODES SHALL BE FOLLOWED, EARTH GROUND ` ' 18. FIRE ANNUNCIATOR SHALL BE INSTALLED AS SHOWN AND THE LISTED LOW TEMP SWITCH AND ALL WEATHER HORN/STOBE SHALL BE USED, = 2ND FLOOR PLAN SERVICES GrOUI' INC. „ 19. THE LOCATION OF THE DEDICATED ELECTRIC CIRCUIT BREAKER FOR THE FIRE ALARM SYSTEM SHALL BE NOTED AT THE FACP AND\ MARKED IN THE SCALE 1/8 = 1 BREAKER BOX AS PER NFPA 72, FIRE ALARM RISER n�v.'fr°P'� C1-tiv�i^��^�r�'Ez�-�:�s !ec` STATE OF ,�r� n �A Cu /� Q�1I OPPORTUNITY VO��r'�R—o 6��f:L\A L7lk�e�'�`��''�4 20, SOLENOID CONTROLLED DOORS CIF APPLICABLE> SHALL BE FAIL SAFE AND WIRED SUCH THAT UPON ALARM ALL WILL OPEN TO AN UNLOCKED NTS 95 TOLEDO ST FARMINGDALE NY 11735 POSITION. 21. WIRE SPECIFICATIONI: AW9 ALL CABLE WILL EQUAL OR EXCEED MANUFACTURERS SPECIFICATIONS- ALL CABLE SHALL BE A MINIMUM OFA VS < z )K INITIATING CIRCUITS WILL BE AT LEAST 16 AWG FPL INDICATING CIRCUITS WILL BE AT LEAST 14 AWG FPL } L_: rK ANNUNCIATOR CIRCUITS WILL BE AT LEAST 16 AWG FPL NYS TOXICITY# PLENUM, = 16020-970918-4001, NON PLENUM, = 16020-970905-4001 NMEEMEEMEN Y 0 V W c 0_ NYS SEQUENCE OF OPERATION W i HVI i®HVI CO &— © D_ W W 1, ACTIVATION OF MANUAL PULL STATIONS, HEAT DETECTORS & AREA SMOKE DETECTORS SHALL CAUSE THE FOLLOWING TO OCCUR: BEDROOM BEDROOM RMim BEDROOM BEDROOM U O� D_ -TRIP SYSTEM INTO ALARM FACT' -DISPLAY ON FACP DEVICE IN ALARM: ® ® ACU: QO QQO > U) 0 -TRIP CENTRAL OFFICE TRANSMITTER & CALL FIRE DEPARTMENT BEDROOM � W -ACTIVATE TEMPORAL 3 NOTIFICATION APPLIANCES THROUGHOUT THE BUILDINGIr z -ACTIVATE STROBE LIGHTS THROUGHOUT THE BUILDINGI J Q CLST `'' �1 2. ACTIVATION OF THE FACP INT❑ ALARM SHALL CAUSE THE FOLLOWING TO OCCUR: CLST \ CLST J CLST CLST r% z ALL AUDIBLE APPLIANCES WILL SOUND TEMPORAL 3 ��VI -ALL VISUAL APPLIANCES WILL ACTIVATE IN SYNCHRONIZATION AS PER NFPA 72 FACP FIRE ALARM CONTROL PANEL MS96000DLS 1 [7� �j �o p -SEND A SIGNAL TO A CENTRAL STATION TO BE HANDLED AS PER NFPA 72. = 6 J -PRESSING THE 'SILENCE' SWITCH WILL SILENCE THE AUDIBLE APPLIANCE BUT, THE VISUAL APPLIANCES WILL CONTINUE UNTIL THE FACP IS RESET BY ACO�� FIRE ALARM COMMUNICATOR SLCLS LOO 2 1 CLST CLST I— 'S- 00 A SEPARATE 'RESET' SWITCH.. p �� J CLST gq HALL 10 Q W �J -THE TRANSMISSION OF A FIRE ALARM SIGNAL TO CENTRAL STATION SHALL ONLY OCCUR WHEN THE ALARM IS INITIATED FROM WITHIN THE PROTECTED BATH HALL HALL BATH •J PREMISES. & NOT FROM ANY OUTSIDE SOURCE, © SMOKE DETECTOR SD355 18 X ® LO UTIL ____-__ UTIL C� INSTALLATION BY: U 3. A SIGNAL WILL BE SENT TO THE CENTRAL STATI❑N IN THE EVENT OF ANY ALARM, TROUBLE SUPERVISORY SIGNAL AS WELL AS THE DAILY TEST SIGNAL HEAT DETECTOR 302-AW-135 3 ----- Ll� Q o WHERE THEY SHALL_ BE HANDLED AS PER NFPA 72, NYS & LOCAL LAWS & REGULATIONS. 7O-O --- CO CQ O CertifiedAlutiAledinSohitionsLTD. d' Q CO - O O 95 Toledo Street CO CARBON MONOXIDE DETECTOR C01224TR 6 AA �. Farmingdale,New York 11735 z cc C _ O AA Office:(631)756-2626, ADDITIONAL NOTES: FA.001 CO — _ ADDRESSABLE INPUT MODULE SK-MONITOR 8 KITCHEN H CLST KITCHEN O CLST KITCHEN FA.001 Fax:(631)756-8521 1- 1. THIS BUILDING IS FULLY SPRINKLED WITH THE EXCEPTIONS OF THE ATTIC SPACES WHICH ARE COVERED WITH HEAT DETECTORS AS THE FACP IS _-__ C7rristirrraA.1'etersoralll Iz LOCATED IN THE SPRINKLER ROOM AND THE AREA IS COVERED WIT A LOW TEMP DETECTOR, A SMOKE DETECTOR IS LOCATED ABOVE THE FIRE PANEL N(F WATER FLOW DETECTOR WFD-80 1 -------i _______ Website:www.solutions-nys.com 0 AS PER NFPA. -------;; „------- �0< I nas-license�12000 n9s9 z 2. SMOKE DETECTORS LOCATED WITHIN BEDROOMS, HALLS AND LIVING SPACES WHEN TRIGGERED WILL ONLY ALARM LOCALLY AND NOT TO THE FIRE _ ____J' DEPARTMENT, VS VALVE SWITCH TAMPER OSYSU-A2 2 LOW TEMPERATURE SWITCH TA-40 1 " � � J' � ' °` IT IS A VIOLATION OF LAW FOR ANY LIVING O� PERSON, UNLESS ACTING UNDER THE DIRECTION OF A LICENSED PROFESSIONAL O� HORN STROBE COMBINATION P2RGL 6 THIS IS A HVA RESIDENCE LIVING LIVING ENGINEER OR ARCHITECT, TO ALTER AN (SFE HVI UNIT NOTE ITEM ON THIS DRAWING IN ANY WAY. IF AN M/ <�w OUTDOOR HORN STROBE COMBINATION P2RRK 1 ora THIS DRAwINc ITEM IS ALTERED, THE ALTERING TRIBEPROFESSIONAL SHALL AFFIX TO THE ITEM NORTH BELL VIBRATING SSM24 1 HIS SEAL AND THE NOTATION "ALTERED BY" f FOLLOWED BY HIS SIGNATURE AND THE END OF LINE DEVICE _ 1 �' DATE OF SUCH ALTERATION, AND A .,. a.: SPECIFIC DESCRIPTION OF THE I INTELLEGENT POWER SUPPLY FCPS24FS8 1 :t ., r ` r t f. 0Lur ALTERATION. © MANUAL PULL STATI❑N BG12LX 1 13 7. ® �...:: .� J JUNCTI❑N BOXES FOR HVI INSTALL 1ST FLOOR PLAN ��/ S / F ® a SCALE 1/8" = 1 `7" 3 /O/ GENTIX HVI SMOKE DETECTOR 7109CS CO HARC CARBON M❑N❑XIDE DETECTOR SC-CO2 1 `-°:=t�f16 * (lam O (CONTRACTOR TO INSTALL DEVICES MANUFACTURE BY FIRELITE) _ _ `�s �10-N EQUIPMENT LEGEND scot NTS TITLE: 0 0l�ffyyyy=yyyyyu_u_yy � I©® °® ®® r�®® ®® ®® 0� E3 C3 UNITS 4A, 5 A tl Il n A �n BULK o HEN• HAuuILW�A�Y HALLWAY STORAGE AY RITCc' 2 010 ®® 00 00 ®®1. oo 00 00 FIRE ALARM HVI UNIT NOTE: AREAS OF WORK1. IN HVI UNITS PROVIDE A HARC SA-101 S❑NIC RECIEVER IN THE MASTER BEDROOM, THE RECIEVER SHALL PLUG INTO A 120V RECEPTACLE AND ACCEPT DATE: PROJECT NO.: THE PLUG FROM A SC-VIB-PJ BED SHAKER. 8/27/19 190827 2. IN HVI UNITS PROVIDE GENTIX 7109CS SMOKE DETECTORS WITH VISUAL SIGNAL, SMOKE DETECTORS SHALL BE HARDWIRED AND INTERCONNECTED WITH nn nn • TC �III(=1j ALL OTHER NOTIFICATION DEVICES IN THE UNIT, ADJACENT TO THE HALLWAY SMOKE DETECTOR INSTALL A HARC SC-CO2 CARBON MONOXIDE DETECTOR Fr,--WHEN HALLWAY HALLWAY: KITCHEN HALLWAY m � SCALE. DRAWING NO.: WITH TRANSMITTER, THE DETECTOR SHALL BE HARDWIRED. ®® ®® ❑ ®® 3. PROVIDE AND INSTALL BUILDING FIRE ALARM SYSTEM VISUAL SIGNALING DEVICES IN ALL HVI UNIT LIVING ROOM, BATHROOMS AND BEDROOMS AS NOTED 4, ALL HVI PLUG IN ITEMS SHALL BE TURNED OVER TO THE OWNER AT THE END OF THE PROJECT 5. PROVIDE HARDWIRED DOOR SIGNALER WITH STROBE FOR HVI UNITS IN LIVINGROOM AND BEDROOMS. PROVIDE HARDWIRED PUSH BUTTON. PROVIDE " " DRAWN BY: TRANSFORMER AT 7'-0' A.F.F. FOR CHIME/ STROBE AND INSTALL AT 7'-0' A.F.F.. CONNECT TRANSFORMER TO LOCAL RECEPTACLE CIRCUIT. i MP �T PLOT PLAN `� �'� —'`• FA - 100 NTS SECTION AA (FRONT PARTIAL SECTION) CHECKED BY: SCALE 1/8" = 1" JB SUBMITTAL COVER SHEET Vineyard View •. GENERAL CONTRACTOR: ARCHITECT: Con,iferConifer-LeCha'se Construction,LLC205Indigo Crk Drive BHC Architects 235 Rochester,NY 14626 Wireless Boulevard Hauppauge, LeChas,- e Ph: (585)760-5336 NY 11788 Fax: (585)760-5353CONSTRUCTION CLC Project No. 1971002 Project No. 10002 TYPE OF SUBMITTAL: PRODUCT DATA CERTIFICATION MFGR COMPLIANCE SAMPLE MFGR DRAWING RECORD DOCUMENT COLOR SELECTION x SHOP DRAWING CLOSEOUT DOCUMENT TEST REPORT SUBSTITUTION OTHER SUBMITTAL DESCRIPTION Building Trusses-Building D CONTRACTOR I VENDOR DaVinci Construction MANUFACTURER/SUPPLIER Universal Component Corp. SPEC. SECTION#&TITLE 061753-Building Trusses ( SUB-PARAGRAPH DRAWING NUMBER x FIRST TIME SUBMISSION REVISION NUMBER CONTRACTOR'S STAMP/CERTIFICATION: ARCHITECT/ENGINEER REVIEW STAMP: 7 I HEREBY CERTIFY THAT I HAVE REVIEWED THIS SUBMITTAL, VERIFIED THE PRODUCTS,VERIFIED FIELD MEASUREMENTS WHERE APPROPRIATE AND HAVE COORDINATED THE INFORMATION WITHIN THE SUBMITTAL WITH THE - REQUIREMENTS OF CONTRACT DOCUMENTS. THE SUBMITTED ITEM(S)COMPLY IN EVERY RESPECT WITH THE REQUIREMENTS OF THE CONTRACT DOCUMENTS AND SPECIFICATIONS CONTRACTOR,COMM ENTS: CONIFER-LECHASE SUBMITTAL NO. 061753-004 BY: Jack Susman Date: 6/4/2019 14'5 314' t6'8' 31'10 3/4' 14'5 314" _ BEARING WALL LOCATIONS,CONFIGURE �—r 31 -- TRUSSES TO SPAN F r BETWEEN BEARING WALLS P19 I _ I -Tr - --- - ,F2"1 F7; F2 V 11 114^ j r321 F't n F28 I X31 FIS F16 Ftp, F31 1 Fab o a :1B s 4_-� 1 f 12 4 314] 6- FU IM FYF3 7�2�..�.r J_ ,_f? = —®T.-- .F � I�..._ I,i7 R _ -^-- _ _"J• :•aa®>®rte"- 1 __ _ FSI! F2'l4 v F,Fl- Fz? I I F34 e r F i 8 -"_'-" 1:30 m� J . ' - -- -'F-G�.• p ,•,. F3s--�I _ S o ti `2 T— ¢ Pjr 1 F7r �- FF33-F77 I.2ir `. I _ F17F26'-1'� o yy..2'6• F11 ml 1727 1`26� Ik Fct 93a �. s� g i a,� In5 1j6 _ F 1C s=c lTF�" q $ p V7 114" - �- "� FOS �n � t F1.f -1.� F23 F2,5 _I 4 a g e F2.1 -1.. 3'63/4' qF d`- P F15 F03 F2'. F28 F24— G21_ -2.� Fj•i aw w.a.a. Narw n�s> a ; a'°a =� �1''F13 1'a v2" ^sl ❑ ❑w.vr.w. s�z_ ry�n�n5r� G`h ❑sm m ¢ :2 w4ro�b�a°'n°rte>w zr � Itil 19j *:m`°�°.pr..�,a"'`""'> W n 2t 10 ill Illi Illi IIII III �ro�ro.,.�t�e`Y. �da�� IIiI X41 IIII Illi lilt Ipi �e'�n�c""`k>�,d � 5 2$�9 14'5314' 2271/6' 16'33/8• 14'5314' 2'0^ —911M,AF a � 73'11" I NOTE.DRAWINGS WERE E'-as= P Architect/Builder shall review all truss engineeringilayouts and verify all spans,depths,mechanical openings,loading etc prior to truss fabrication CHECKED FOR LOADING 9 79 3 m _ CRITERIA AND GENERAL CONFORMANCE WITH THE ° _ € CONSTRUCTION 9 a w 2 DRAWINGS i 6= 5 Building D,2nd Floor Framing Layout Scale NTS tealttti Nil MITek USA, Inc. .16023 Swingfey Ridge Rd . Chesterfield, MO 63017 314-434-1200 Re: 35970F3 Vineyard View Building D 2nd Floor The truss drawing(s)referenced below have been prepared by MiTek USA,Inc. under my direct supervision based on the parameters provided by Universal Component Corporation. Pages or sheets covered by this seal: I37921891 thru I37921926 My license renewal date for the state of New York is January 31,2020. o. NE(� " cc n h " r w _ July 24,2019 Garcia,Juan IMPORTANT NOTE:-The seal on these truss component designs is a certification thafthe endirfadr,named is licensed in the)urisdiction(s)ldenilrkdrand dial'the 'designs corroiy with ANSWP- 1. Those deslgns:are based upon parameters shown(o.g.,taadsi supporis,dimensions,-'sfiapes.and design cones).WhIcli were given to MiTek or,TRENCO_ 'Any project's�acifir:_i6formatioh iocludedis'for MiTelcs'or TRENtas,custorners file reference.purpose only,-,and•was not takeninto accourit,16,tile preparation ofthesd designs.`MiTQk or;TRENCo has not independently verified the applipabiHty of-tile'design,parameters;o(ylh'a,iiesigns for any particular building. Before use, ;the building deslgnershauln verify applicablilly of desigrl,parameters`ann,'proparly 'incorporate these dnigns.lnla the overall building debign per ANS14pt 1,Chapter 2, Job ---�-ass mss';ype City Ply Vinuyatd�Vlew Buliding D 2nd Floor 137921891 35970F3 F01 FLOOR GiRQER 1 2 _ -..loh Relate ncc(n twnat _ Universal Component Corp., EAST H+1VEN CT 06512 8.010 S Aug 112017 MITak Industries,Inc. Wed Jul 2,1116:39.,27 201+9 rage 1 10:fidiSDAt{LEtJvOlPk!BgAWryltytja•XQ2t8R?Z lQSBMgPPIDI'936aymekHGBCw3o%'JMioLk 2-6-0 s�-14� 0-14111--� Scale=1 3x6 FP= Special 3x6 FP= 4x6 11 6x14 = 7x10 MT18H I I 6x12 = 6x6 t 31 2 32 3 33 4 5 6 7 B 34 9 36 10 36 11 1237.{13 24 25 23 26 22 21 20 19 27 18 28 17 29 16 15 1+ - 3x6 MT16H FP= 4x6 11 7x10 MTIBH - 6x6 = 6x12 = 6x10 - 7x10 MT1BH = 3x13 MT18H FP = 3xB I I 19-2-6_ 17.7.0-20.1 t-6 I 166-14 -= °-=-='I-- 2:I=3 14-8_ _ Platt)UftSels(X Yj- -.(B'0-3- 'Ed-a 9:0-3-0,0-0-01x(10:0-3=4,Edgej4 12:0-3-D Ed 91, 14:Ed e 0 3 0 L(1Sw0.3 0.0�0�,x:0.7 8 Ednej.('ta:M-D.Edga LOADING (psf) SPACING- 2-0-0 CSI. DEFL. in (loc) Mail L/d PLATES GRIP TCLL 40.0 Plate Grip DOL 1.00 TC 0.30 Vert(LL) -0.25 18 >999 360 MT20 1971144 TCDL 12.0 Lumber DOL 1.00 BC 056 Vert(CT) -0.39 18 >644 240 MT1BH 197/144 BCLL 0.0 Rep Stress incr NO W8 0,76 Horz(CT) 0.07 14 n/a n/a Weight 319 ib FT=20%F,I I%E BCDL 10.0 Code IBC2015/TP12014 Matnx-S LUMBER- s BRACING- TOP CHORD Structural wood sheathing directly applied or 6-0-0 oc purlins, TOP CHORD 2x4 SP 2400E 2.0E(flat) except end verticals BOT CHORD 2x4 SP 240OF 2,DE(flat) WEBS 2x4 SPF No.2(flat)*Except* BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing, 10-16:2x4 SPF 210OF 1,BE(flat) REACTIONS. (Ib/size) 24=2332/0-4-6,14=5266/0-4-6 FORCES. (ib)-Max-,Comp./Max Ten.-All forces 250(lb)or less except when shown. TOP CHORD 1=24i=-27710,13-14=-1321348,2-3=-8269/0,3-4=-8269t0,4-6=-1381110,6-8=-1381 110, 8-9=-15981/0,9-10=-1598110,10-11=645310,11-12=-6453/0 BOT CHORD 23-24=0/4444,21-23=0/11342,19-21=0/15981,18-19=0/15981,17-18=0117108, 16-17=0/17108,15-16=0/6453,14-15=016453 WEBS 2-24=-494410,2-23=0/4256,3-23=-291/0,4-23=-342010,4-21=0/2746,6-21=277/0, B-21=-2404/0,8-19=0/424,10-17=01331,9-18=-85/264,10-16=-1176310,11-16=0/2489, 12-15=0/2827,12-14=-8722/0,10-1 8=-1 24 310 NOTES- 1)Fasten trusses together to act as a single unit as per standard industry detail,or loads are to be evenly applied to all plies 2)Unbalanced floor live loads have been considered for this design. 3)All plates are MT20 plates unless otherwise indicated. 4)All plates are 3x6 MT20 unless otherwise indicated 5)This truss has been designed for a moving concentrated load of 250.0ib live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,noncon current with any other live loads. 6)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 oc and fastened to each truss with 3-10d(0,131"X 3")nails �r'OF NE Strongbacks to be attached to walls at their outer ends or restrained by other means C� 7)Hanger(s)or other connection device(s)shall be provided sufficient to support concentrated load(s)5095 Ib down at 16-6-14 on top GAIL? Q� chord, The design/selection of such connection device(s)is the responsibility of others B)In the LOAD CASE(S)section,loads applied to the face of the truss are noted as front(F)or back(B) LOAD CASE(S) Standard 1)Dead+Floor Live(balanced):Lumber Increase=1.00,Plate Increase=1.00 r- ) r 4T F W Uniform Loads(plf) Vert 14-24-20,1-13=-104 -fi .srs.�ue ti Concentrated Loads(lb) s� Vert 10=-5015(F) Q .NO• � "FessiO��"� July 24,2019 WARNING-Venfy design parameters and READ NOTES ON 7N15 AND INCLUDED bfIJEK REFERENCE PAGE MI1•7473 rev.1016312015 BEFORE USE �� A�.10n viilz{!dr mse acly tvdh Mi'fokJ Ear 10 iota Thzn dasi$n!n Oased Holy dp^n pa'anotias fain,and is ter an indrodu01 bodaing co"i*rmi,not �• _a tmst:syvl0m,r391orn esn:tha bv�ldatp deOfOnnr moat ve+ify thn opLUurLlUty of i}a:s10n f+a}amniors nnA aronwty Ltesrpnra{a{his danlgn into ilio uvarpU MITO ra<lklinp din,Brr.�pQF.^+!�!r^.t!Ip IePrrwegt hvckt�r�of fndi,3d+int l+uss xab sndlor dsCrd mOnrborrs�riV.AdG+iitlnnl tnmpornry n!id perrrwp_'nt kreligp is always reguileo--tar statni+ty and io Qwn+nl+l s0{1apGow•31i p0ss,t1�,�0 pera=91 indxy and propel damage Fa g0rsttr.>+q,ndnnsn rcOnrdmg O+n16023 i+rtrrtc4l{ary ntnajlu,ACilV6i„araUEfrn and tradny of tr in"gitrl VU77 uyo{cane.000 +1t3S1rt'pt1 punf(ly Lntnri0,ASt3.84 and AC5{8alldln0 Component P Chesterieid,MO 6301 Rd Sataty Information nvnilingo from Toss Pk-•to tnntwo.218 N.Leo Shont,Svila 317,AkexnniUlo:'lA 2231A. _ -, ^s-� - - ^-_ Job russ Truss Type- Qty 131Y Vineyard View Building D 2nd Floor 137921892 35970F3 F02 FLOOR GIRDER 1 Job Reference(oQhonal) Un(v0rsa4Cdrrtpanant Corp. - -EAST HAVEN CT 06512--' - 8.010 s Aug 11 2017 MiTek Industries,Inc.Wed/JUI 2416 39.29 2019 Page 1 I D.ndIRDAhL EUvQ7PkiBgAvyTyugda-TpAdZ70pYl lt45gBw{G9EUBsHkHnl_MhONHdOryuoLi -i Scale=1.27 2 Special Special Special Special Special Special Special Special Special Special 3x6 I1 804 MT18H = Special 3x6 11 Special 6x8 = Special 3x6 11 Special 8x14 MT18H = 3x6 II 1 17 18 2 19 3 20 21 22 4 23 5 24 25 6 26 27 28 7 12 13 11 14 10 15 9 6x12 = 16 8 602 MT18H = 6x12 = 3x6 11 6x12 MT18H = 115.9-0 - { Plate Offsets KY)--_' 112:0-13A2,Edge];. Q.f6:0-212.Ecf r9:0.2.8:tdgel'ii1:0 LOADING (psi) SPACING- 2-0-0 CSL DEFL. in ([cc;) Ildefl Ud PLATES GRIP TCLL 40.0 Plate Grip DOL 1,00 TC 0.73 Vert(LL) -0.21 10 >885 360 MT20 197/144 TCDL 12.0 Lumber DOL 1.00 BC 0.59 Vert(CT) -034 10 >560 240 MT18H 197/144 BCLL OA Rep Stress Incr NO WB 0,84 Horz(CT) 0,06 8 n/a n/a BCDL 10.0 Code IBC2015(rP12014 Matrix-S Weight 194 Ib FT 20%F,11%E BER- BRACING- CHORD 2x4 SPF No.2(flat) TOP CHORD Structural wood sheathing directly applied or 6-0-0 cc purlins, ., CHORD 2x4 SPF 210OF 1 8E(flat) except end verticals, WEBS 2x4 SPF No.2(flat)`Except" BOT CHORD Rigid ceiling directly applied or 10-0-0 cc bracing. 2-12,6-8:2x4 SPF 2100F 1.8E(flat) REACTIONS. (Ib/size) 12=5119/Mechanical,8=5747/Mechanical FORCES. (lb)-Max Comp/Max Ten -All foroes 250(lb)or less except when shown TOP CHORD 1-12=-61010,7-8=-992/0,2-3=-14481/0,3-4=-14481/0,4-5=-1493010,5-6=14930/0 BOT CHORD 11-12=0/9105,10-1 1=0116557,9-10=0/16557,8-9=0/9606 WEBS 2-12=-10130/0,2-11=0/5981,3-11=-1585/0,4-11=-2289/0,4-10=-68/264,6-8=-10688/0, 6-9=0/5924,5-9=-1775/0,4-9=-1794/0 NOTES- 1)Fasten trusses together to act as a single unit as per standard industry detail,or loads are to be evenly applied to all plies. 2)All plates are MT20 plates unless otherwise indicated. 3)Referto girder(s)for truss to truss connections. 4)This truss has been designed for a moving concentrated load of 250.O1b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 5)Recommend 2x6 strongbacks,on edge,spaced at 10-0.0 cc and fastened to each truss with 3-10d(0.131"X 3")nails Strongbacks to be attached to walls at their outer ends or restrained by other means. 6)Hanger(s)or other connection device(s)shall be provided sufficient to support concentrated load(s)760 Ib down at 0-8-0,851 Ib down at 2-4-0,851 Ib down at 3-11-4,851 Ib down at 5-7-4,851 Ib down at 7-3-4,851 Ib down at 8-11-4,851 Ib down at 10-7-4, 131 Ib down at 11-6-0,109 Ib down at 11-11-12,851 Ib down at 12-3-4,109 Ib down at 13-7-12,851 Ib down at 13-11-4,and 133 Ib down at 15-3-12,and 875 Ib down at 15-3-12 on top chord. The design/selection of such connection device(s)is the G'QF NE responsibility of others._ tr y 7)In the LOAD CASE(S)section,loads applied to-the face of the truss are noted as front(F)or back(B) CO�Q�,J(S, LOAD CASE(S) Standard ` Y 1)Dead+Floor Live(balanced):Lumber Increase=11,00,Plate Increase=1 DO Uniform Loads(plf) r ' Q Vert B-12=-20,1-7=104 UJ Concentrated Loads(lb) Vert*2=-851(F)5-851(F)17=760(F)19=-851(F)20=-851(F)22=-851(F)23=-851(F)24=-131(8)25=-961(F=851,B=-109) 26=-961(F=-651,B=-109)28=-1008(F=-675,B=-133) 1 o ti9,090oe w EssioN� ( July 24,2019 ®WARNING-Venry design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCEFAGE M11-7473 rev 10/0320115 BEFORE USE ( m� tle�pn4utWlarr4uartywiilfNk7clauncKl�s 7nduslQelxt�echlaniy0penporpmntarashcyrt.andisfaanirtdtvdanttu0din9r�mrwnent no nUueCeg%,EomltiafarcUoa,YftabUi�dngdOrj!tlHera{rlvAtyntily.Utpnrpgcnbll�ryGftleptgn)ralpmutaranbplapei't�alrArRoralotldsdWe6afntnlhnoJdpu tt�t�RYr F truUclinarlasipit. t!r'nJnnlntliaalydirstapr4�•nitthr.ektuign3tGntiNvtdUatWday.uhnpdMrchard'tnenlburaonly:lutdillan.:llamperacgtt`vtdpemnnncPthraci+ig 'y,i'f�,IC i !s atw'oy"�+a4uiraa tat 01ptt1{,{ynaC to,re�ranl oatnlY+O vrth pa3Fihio _ry Pnd rmcpeRy dmm�ge.FruA_unecalr ai$ar�e reearduttt Uta (nericption,olomlu,daliv-,eracfion Arid brtc4y]0!trU350x turd trUs3-sysiam..sec �ANSIrtPt1 Oaatlty Criteria,p58•-89 and BC5{Hulfdlnp Component 16023 Swfngley Ridge Rd 5ntnly lntortnd8on avallia�oatTnrsS Piste fOSI'thtL,213 K,lap Strap/saplq a12 Nexpndr4t,YA 2231st. chesterfield,NO 63017 ---- - '- - - - = Qty ply vineyard View Building D 2nd Floor _ Job - - -' russ- '-- -" ---" miss Type 13799 21893 359701`3 F03 Floor 1 1 --._ JobReference_ Untversel Component Corp., EAST HAVEN-CTD6512 8,010 s Aug 112017 M1Tek Industries,Inc..WGd`dUt2A 16'39-29 2019-Page 1 = ID ndIRDAhLEUv67PklBgAvyTyugda-TpAdZ70pY1it45gBwjG9EUBx5kLFIBDhONHdOryuoLl "- _I 1 1x3 II 9 2 10 3 1x3 11 Scale 1, I i - 1 1x3 II e 7 5 8 4, 3x3 = 1x3 II 7. LOADING (psf) SPACING- 2-0-0 CSI. DEFL. in (loc) Ildefl Lld PLATES GRIP TCLL 40.0 Plate Grip DOL 1.00 TC 0.42 Vert(LL) -0.12 5-6 >369 360 MT20 1971144 TCDL 12 0 Lumber DOL 1.00 BC 037 Vert(CT) -0.17 5-6 >265 240 BCLL 0.0 Rep Stress Incr YES WB 0,02 Horz(CT) 0.00 nla We Weight:ie lb FT=20%F,11%E BCDL 10.0 Code 1BC2015/TPI2014 Matrix-S LUMBER. -- BRACING- TOP CHORD Structural wood sheathing directly applied or 3-11-0 oc purlins, TOP CHORD 2x4 SPF 2100E 1.BE(flat) except end verticals. BOT CHORD 2x4 SP 285OF 2.3E(flat) WEBS 2x4 SPF No-2(flat) BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing REACTIONS. (Ib/size) 4=235/0-2-4,6=235/Mechanical Max Grav 4=333(LC 10),6=333(LC 7) FORCES. (lb)-Max,CompJMax.Ten_-All forces 250(lb)or less except when shown. TOP CHORD 1-6=-292/0,3-4=-287/0 NOTES- 1)Unbalanced floor live loads have been considered for this design. 2)Refer to girder(s)for truss to truss connections: 3)Provide mechanical connection(by others)of truss to bearing plate at joint(s)4. 4)This truss has been designed for a moving concentrated load of 250,01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 5)Recommend 2x6 strorigbacks,on edge,spaced at 10-0-0 oc and fastened to each truss with 3-10d(0.131"X 3")nails Strongbacks to be attached to walls at their outer ends or restrained by other means NE,1!!i`y 14 GARC�off' - m fu w July 24,2019 ! ®WARNING-Verltydesrgn'paramerersand READ NOTES ON TMS AND INCLUDED MITEK REFERENCE PAGE Mll-7473 rev.Ya/a32615BEFORE USE j clr tn'vti�ifarir t adywRts►Aifgk�ecmndclas-ThedhWlf"lis b ed only upohpnrar tern,shcvm:.anlf+sfatanf»dR duxl,tw°t nDcwnp4nWrt,ngt- �' n uttag ay9tatn; pfdrU'us1z,'iha hVidinO dauignarmust va'»ly,the fPjP1 Aiblltty of 6001 r►t nnmalora end brcDply 47sctperJl®thls+lavtDn arta Utp rn t� pp� bdi(t!1% dealglt Srartngtnd!ultells`lopttvaftihsur4DtiD'ntlndlti'du rtnx<�t4cb"DtYdICI.'th9ldMahtftarsnrtly,}tddtUonilkientporaryand'{tnrmeitontgt n9 �MiTek' ,Is�t,unytf ttiquactl rorUtahiliy and t0't?tF7vUnl COltpaso v4ih MY+3!Ma Oatian61iR1mY4�roi'e ,p9 nn3fQ&5i t;;upcNncom onent 16023 Swtngley Ridge Rd IaDrltptto»,gtara,Dor,dcriyety�q`RLfLDn nittl`Tu+s vttluasu's oilii Uiwb Syatw'Y-:w G3 . A4`t•.f1TPJt-R-=•^ice^ D� D- p chesterfield.MO 63017 SWnty,tnrrnmatto»eves!abt'c"TtuanPlateinaUCuta'2,18N.Lea,ShenKsultast2:+�b'Tndria•V1t22314. _ - _ _ ." �-� yµ• �.N -- - - Job TsUSs_ ++Ttu95Type - Qty-- Pty" lVineyard View Build ing D 2nd Floor 137921894 359703' F04 IFLOOR,GiRDER '11 -- - - -- -- - _ Job Roicirepce(Op4l(ntal) - Unlvt isal Conipdnrent Corp., EAST HAVEN CT 06512 - 8.010 s Aug 412017 MTTek industries,Inc, Wed Jul 24 16:39:312019 Paga 1 ID.ndIRDAhLEUvQ7PkrBgAvyTyugda-PBINzp234fyaJ0_a27ldKvGBIY71Dxz_rhmkSkyuoLg 2-Fr0 1-2-6 Scale=1:27,9 1,5x3 I I Special 1.5x3 11 6x6 = 4x12 = 1 5X3 11 4x4 = 3x6 FP= 1,50 11 4x8 = 1.5x3 11 1 27 23 28 4 29 5 30 6 31 7 8 32 9 33 10 9 M 21 19 16 22 17 23 16 15 24 14 25 13 12 26 5x6 II 3x6 11 3x6 I1 46 1 3x6 11 3x6 FP= 6x10 = 5x6 11 6x6 = 3x8 MT18H FP = Plate Offsets(XY1 2:D 1.8,Edget,J6:0-1-8.Edge (1�f:0.3-O;U O.0];(15:0 3 O,Edaei'jl8 0-1-13,Edso. - LOADING (psf) SPACING- 2-0-0 CSI. DEFL. in (loc) I/dell L/d PLATES GRIP TCLL 40,0 Plate Grip DOL 1 00 TC 0.82 Vert(LL) -0.15 15-17 >999 360 MT20 197/144 TCDL 12.0 Lumber DOL 1.00 BC 0.47 Vert(CT) -0.24 15-17 >798 240 MT18H 244/190 BCLL 0 0 Rep Stress Incr NO WB 0,64 Horz(CT) 0.03 11 n/a n/a BCDL 10.0 Code IBC2015/TP12014 Matrix-S Weight 1911b FT=20%F,11%E BER- BRACING- CHORD 2x4 SPF No 2(flat) TOP CHORD Structural wood sheathing directly applied or 6-0-0 or,purlins, ow i CHORD 2x4 SP 240OF 2,OE(flat) except end verticals. WEBS 2x4 SPF No 2(flat) BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing. REACTIONS. (Ib/size) 20=3015/0-2-4,11=1719/0-2-4 FORCES. (lb)-Max.Comp./Max.Ten.-All forces 250(lb)or less except when shown, TOP CHORD 10-11=-274/0,2-3=-3319/0,3-4=-3319/0,4-5=-7621/0,5-6=-7621/0,6-8=-5427/0,B-9=-5427/0 BOT CHORD 19-20=0/3319,18-19=0/3319,17-18=0/8935,15-17=0/8935,14-15=0/7621,12-14=0/7621,11-12=0/3019 WEBS 9-11=-339210,9-12=0/2706,8-12=-297/0,6-12=-2454/0,2-20=-4588/0,2-19=0/2527,4-17=0/412,3-18=-262/577, 4-18=-6265/0,4-15=-1462/0,6-14=0/774 NOTES- 1)Fasten trusses together to act as a single unit as per standard industry detail,or loads are to be evenly applied to all plies 2)Unbalanced floor live loads have been considered for this design- 3)All plates are MT20 plates unless otherwise indicated 4)Provide mechanical connection(by others)of truss to bearing plate at joint(s)20,11. 5)This truss has been designed for a moving concentrated load of 250.0Ib live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 6)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 oc and fastened to each truss with 3-10d(0 131"X 3'r)nails.- Strongbacks to be attached to walls at their outer ends or restrained by other means. 7)Hanger(s)or other connection device(s)shall be provided sufficient to support concentrated load(s)2831 Ib down at 4-3-8 on top chord The design/selection of such connection device(s)is the responsibility of others 8)In the LOAD CASE(S)section,loads applied to the face of the truss are noted as front(F)or back(B) or- NEW LOAD CASE(S) Standard � y 1)Dead+Floor Live(balanced)'Lumber Increase=1 00,Plate Increase=1..00 �� GAf C Uniform Loads(plf) ) y Vert.11-20=20,1-10=-104 Concentrated Loads(lb) Ei4 Vert'4=-2751(F) )N ��do �O,080og� SS1�� July 24,2019 ®WARNING-Venfy design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE Mtf•7473 rev.tePJ3@0158EFORE USE. a•a� DoafOg vatld fat U50 enty vath MITOQ rAirmeatsiv.Tim daclati is Crsed only Upon pmantetarn zhoimr midlotlar at IndIVIdoat building eampaganl,not 3Im Fo Uvns'nyatain.0ofdtn u><o,tho Uitl{dlpp deEJOdot rnU6f vanfy{Yt4+opptceablpty of ddalgn parnnutorsAn$ptnpu;iy tnciutiasato fnl,donri}n Into ilia notirnll ; '4srildhW des:gl•6rnr ng inn�CaLM lc topravani buculinp n(f7Civtdu,tl rruzswno andtor c?vtl(n tnchdurianty:Azid:Uenat lomparary and parfna»onl btadng t MITE{C` tz alwnysr tgvhed ral hnWVty ond'to txmrcnt 6111ake,with pa tilble pe sannl inlwyand pteportydamaga,Fornncr•t 9u'Cancn rcgansigp ilio ) (pttrfcnllan,„tpm0o,der(vuy,srocgonand brcrcjm,(at InrzsoS ttnd nU4s bf3lent3.alfa. AN9UTPIt gUnl ty Grifarfa,OSO-SO and BC91Sulldino_Component 16023 Swinglay Ridge Rd a 9ittoty htfarrr niton'm+atLwin Irgm Truss Plato InaLtulc 219 N.Let,StteDL no 312'N4xandria,VA 22314: ( Chesterfield,Mo 63017 -- Jobruss russ Type Qty Ply Vtnayalfl view Building D 2nd Floor 137921895 35970F3 F05 rLoOR GIRDER 2 ` _ ! .Jolt Reference n Yionat -- Wel Jul 24 16:39:32 2019 Pagel _ Universal Component Cop. EAST HAVEN CT 06512 — 8.070 s Aug 1120}7 SdiTak IndusUta ,InC, ID•nd iRDAliLEVv0*4pkIBiAvyty:igda•tonpa93t1ry4,4xYzntbrp5s7pCSyEoyOh74KW H?AyuoLt 1 260x1114 I Scale=1: Special 1 5x3 II 5x8 = 6x8 = 3x3 II 4x4 = 4x4 = 3x6 FP= 1.54 II 48 = 1.54 II 1 26 2 3 27 4 26 5 29 6 7 8 30 9 31 10 p' 21 19 18 22 17 23 16 15 24 14 13 12 25 � 5x6 II 6x8 = 3x6 II 10x10 = 3x6 II 3x6 11 3x6 FP= 6x10 = 3x6 I I 3x8 MT18H FP = 31-2 71-2 tE3-0 i J - 3-1-2 te_AttsaEs(�X�Y�- (2:0-7.8,Ed�e],j3:0_- Edge] P1Q .(5:01•B.Edaa1.[6 Q 1-8 EdpDl [1'z 0.3.0 001x[17:0 A-12,E e] 118'4 3 A 0 0 Ol LOADING (psf) SPACING- 2-0-0 CSI. DEFL. in (loc) Vdefl Ud PLATES GRIP TCLL 400 Plate Grip DOL 1.00 TC 0.54 Vert(LL) -017 15-17 >999 360 MT20 197/144 TCDL 12,0 Lumber DOL 100 BC 0.95 Vert(CT) -0,27 15-17 >724 240 MT18H 197/144 BCLL 0.0 Rep Stress Incr NO WB 0,68 Horz(CT) d.04 11 n/a nla Weight 16916 FT=20%F,11%E BCDL 10.0 Code IBC20151TP12014 Matrix-S LBRACING- UMBER- TOP CHORD Structural wood sheathing directly applied or 6-0-0 oc purlins, TOP CHORD 2x4 SPF 2100E 1 BE(flat) except end verticals. BOT CHORD 2x4 SPF No.2(flat) WEBS 2x4 SPF No.2(flat) BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing REACTIONS. (Ib/size) 20=2993/0-4-6,11=1749/0-2-4 FORCES. (lb)-Max CompJMax.Tem-All forces 250(lb)or less except when shown. TOP CHORD 1-20=-264/6,10-1 1=-27410,2-3=-5902/0,3-4=-928410,4-5=-9212/0,5-6=-782810,6-8=-556210,8-9=-556210 BOT CHORD 19-20=0/5902,18-19=0/5902,17-18=0/5902,15-17=0(7B28,14-15=0/7828,12-14=0/7828,11-12=0/3090 WEBS 2-20=-6599/0,2-19=0/1967,9-11=-3472/0,9-12=0/2778,8-12=-290/1,6-12=-2533/0,6-14=01729,4-17=-3189/0, 5-17=011544,5-15=-67810,3-18=218510,3-17=0/4603 NOTES- 1)Fasten trusses together to act as a single unit as per standard industry detail,or loads are to be evenly applied to all plies. 2)Unbalanced floor live loads have been considered for this design 3)All plates are MT20 plates unless otherwise indicated 4)Provide mechanical connection(by others)of truss to bearing plate at joint(s)11_ 5)This truss has been designed for a moving concentrated load of 250,01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 6)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 oc and fastened to each truss with 3-10d(0 131"X 3")nails. Strongbacks to be attached to walls at their outer ends or restrained by other means. 7)Hanger(s)or other connection device(s)shall be provided sufficient to support concentrated ioad(s)2823 Ib down at 4-5-10 on top chord.The design/selection of such connection device(s)is the responsibility of others. 8)In the LOAD CASE(S)section,loads applied to the face of the truss are noted as front(F)or back(B). NEWY LOAD CASE(S) Standard -0 GARS 1)Dead+Floor Live(balanced).Lumber Increase-1 00,Plate Increase=1.00 Uniform Loads(pif) Vert:11-20=-20,1-10=-104Ar Concentrated Loads(lb) 1— r y z Q Vert-4=-2743(B) 0 .. +` t11.1 U �ofi"'S Sl July 24,2019 ® INCLUDED MITER REFERENCE PAGE MII.7473 rev.10/03/2015 BEFORE US WARNING-Verify design parameters and READ NOTES ON THIS AND E rs i fJlrlg#1 v:tild let One Dldy ivltfl AtiTc n h1 1 C:taYr,TJX a d1,:--lin Is based only upen pammeleta chOval;zlnd 16 fa an 1ntfVkhiei"01V component,not 'n eusstystum.Bufo)a U110,1110 t)u'a63J � d0ntlr mual Verity Ihn app(Iclalti ty0f deaTpn pommel"and propra(y li)carponto 11114 0411,19"6lllithb 0umab h pt(��r� Dn hilnildcakan, 8rtlrc{IIl trlaatrd Fa topol'eattxir,exp ar Ir dlvtdnnl ours at b an dfa c 0x11 man)hrrp Only,AddlLonal larnpoaary and l omwn0nr baacfnp I Vt Is ulvruyd raginrn�taratbLl6iy and to prOVOnt eV11ap�9'+itll oostltdo iwrsannt inJury and p/9puitY'wnt00e:Forgcncrnf 7�idanm i0this11 thtr tat ticallon;alnrapro,dativ0ryr:afcztlgn fend brzvIn of Irust4`S and ba.a,:�ybrana3,'Sou- Atd3irfPtt{!ua{Ity Critnria,058-Sa and cal Q011dina Component Chesterfield,16023 "tMO 6301 Rd Safely Infermntlan aVihablo 101n Truss Piato insiihnA).710 N•Loo'SUefiL$ijtlo-312.A uxa,,dda VA-'221 7. Jbb Truss - - Truss Type ^ 'Qty - Pik ]l"n View Building 0.:2nd Floor 89 3597OF3- 1`06 Floor Girder 1 ry 137921 6 L Job Reference(Dpliona11 Universal Component Corp, EAST iiAVEN CT OCS12 - 8.010 s Aug 112017 MI7'ek Indusldes,In(L Wed Jul 24 16.39.33 2019 Page 1 ID ndlRDAhLEUvQ7PklBgAvyTyugda-LaPBOV3KcGCIZl8y9YK5PKMU1 MYshuYGJ_FrXcyucLe 1- 2.6-0 - -` H- 2-5-12 Scale=1.21.7 Special Special Special "' Special 1x3 II Special 4x8 = Special 1x3 II 3x3 = Special 4x8 = Special 1x3 II 4 14 15 2 16 3 17 18 19 4 20 5 21 22 23 6 10 4x8 = 11 9 12 B 3x6 = 13 7 4x8 4x8 = _ - -- 12-11-12 - -- - _ - t2-1,1-12 IX j: -- Plate offsets D:_ Ird -- -- LOADING (psf) SPACING- 2-0-0 CSI. DEFL. in (loc) 1/defl Ud PLATES GRIP TCLL 40.0 Plate Grip DOL 1 00 TC 1.00 Vert(LL) -0.28 9-10 >555 360 MT20 197/144 TCDL 120 Lumber DOL 100 BC 0.96 Vert(CT) -0.38 9-10 >401' 240 BCLL D,0 Rep Stress[nor NO WS 0.51 Horz(CT) 0.05 7 n/a n/a BCDL 10.0 Code IBC2015frPI2014 Matrix-S I Weight:102 Ib FT=20%F,11%E BER- BRACING- --- - CHORD 2x4 SPF No.2(flat) TOP CHORD Structural wood sheathing directly applied or 6-0-0 oc purlins, CHORD 2x4 SPF No,2(flat) except end verticals WEBS 2x4 SPF No.2(flat) BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing. REACTIONS. (Ib/size) 7=2855/Mechanical,10=2785/Mechanical FORCES. (lb)-Max.Comp/Max,Ten"-All forces 250(lb)or less except when shown TOP CHORD 1-10=-432/0,6-7=-512/0,2-3=-6375/0,3-4=-6375/0,4-5=-6347/0 BOT CHORD 9-10=0/4299,8-9=0/6347,7-8=0/4282 WEBS 5-7=-4859/0,2-10=4878/0,5-8=0/2344,2-9=0/2356,3-9=-1047/0,4-8=-1026/0,4-9=-249/273 NOTES- 1)Fasten trusses together to act as a single unit as per standard Industry detail,or loads are to be evenly applied to all plies 2)Refer to girder(s)for truss to truss connections 3)This truss has been designed for a moving concentrated load of 250,01b live located at all mid panels and,at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 4)Recommend 2x6 strongbacks,on edge,spaced at 10-D-0 oc and fastened to each truss with 3-10d(0,131"X3")nails. Strongbacks to be attached to walls at their outer ends or restrained by other means, 5)Hanger(s)or other connection device(s)shall be provided sufficient to support concentrated load(s)511 Ib down at 0-8-12,503 Ib down at 2-4-12,503 Ib down at 4-0-12,503 Ib down at 5-8-12,503 Ib down at 7-4-12,503 Ib down at 9.0-12,and 503 lb down at 10.8-12,and 519 Ib down at 12-4-12 on top chord.,The design/selection of such connection device(s)is the responsibility of others. 6)In the LOAD CASE(S)section,loads applied to the face of the truss are noted as front(F)or back(B), LOAD CASE(S) Standard 1)Dead+Floor Live(balanced)-Lumber increase=1,00,Plate Increase=1,00 OF NF 1/ Uniform Loads(plf) �i j• Vert:7-110=-20,1-6=104 14 GA& Q� Concentrated Loads(lb) y Vert.2=-503(F)14=-511(F)16=-503(F)17=-503(F)19=-503(F)20=503(1`)21=503(1`)23=-519(1`) ES July July 24,2019 ~ A WARNING-Verify design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE 4111.7473 rev f010312015 BEFORE USE # �� Onalgn,nF(1 InrUSp nnty ndifi RGTt:i:JirCrntiatlotx;Tritadas7yti{a tiastd smty upon paiamWa'jr.shuwry aril fs frir,an Urdrrtdtihi buticiigp ratnt,arugt,nnl �' c n Uu�x SYaibnc Br fora uaU,the 4eJOdh g,daslgnee musCva+dy u�u appsoatJtHy a[dcirn'paramdteca and prapa�#yTnw+tiorut0,tll rdnellg 4,inte tha uvnrnit a ;} bUtrdiil9daign.-lstradlndiaitadls'SGprov4nftturWia9Uftaiiivtt{dOltniauK'abnndtoretietdmam6rralfy.prTditieralterilp'otaryctriztfmrm�iteritbtdthiq �� '. it Ys tllwtiya nfRuUL�S fru atatiiUty dmt W ti-ro�4ar1 cdl�psa"rAdi rte^-rJUfa peiaonnl ry aiul properly dome;la`.For genanl guldanc2 regsrding 6w, " I IaUriaiiwn•atarh00,dariv0-ryry.aticlrori and Umdn;a alfmssas and,wsa ay8lernti.,+:u QN51RPIt Quality Crltarlb,D66.66 arid BC519u.1tding'Component 16023 S vingley Ridge Rd 6utotyli>famiatlun avaAntwl(Om 7ntss PiatelrtxGlutn,219 t4.Lab$pebl.'SOIle 812./deYandda:VA a23ta' )T Chesterfield,MO 63017 Jota' Truss T ss Type Dty Ply Vinoy:ifd Vis v Bsifllfing D 2nd Floor 137921897 35970F3 F07 FLOOR GIRDER 1 2 JriN Rel6rerri uc�!lonµlll_ Universal Component Corp., EAST HAVEN CT 06512 8.010 a Aug 13 2 MITek'IndusVias,Inc. Wed;JOC24l zQII:31 2019 Page 1 ID:ndIRDAhLEUVQ7PkiBgAvyTyugda-gmzWcr4yNaK9Asi9lGrKxYU zQIP�Xe?033yuoLd 2.6.0 =�i�I� 1 3 0 i 1� r Scale=11; 18x3 11 Special 15x3 I( 5x6 = 5x8 = 1.5x3 II 4x4 3x6 FP= 1.5x3 I I 4x8 = 1.5x3 I I 1 26 2 3 27 4 26 5 29 6 7 8 30 9 31 10 ..%'- s_ .sem•�.,,�� - _ '--��'``�`�._ -.` ��^��.\.�,� ,n / �• �� m61 - , E2— -- 19 18 22 17 23 25 21 16 15 24 14 13 12 5x6 II 6x8 3x6 II 3x6 II 4x6 11 3x6 II 3x6 FP= 6x10 = 5x6 11 3x6 MT18H FP = l 13-2-5 - - -Fiat o=ot(stts(x i%sem r2:0-1-BELj,Edg,1 t14:0-s a.a o,oL(os a•s•o'Edgel ('18:0-3 O,P� — _� -- LOADING (psf) SPACING- 2-0-0 CSI. DEFL. in (loc) I/deft Ud PLATES GRIP TCLL 40.0 Plate Grip DOL 1,00 TC 0.80 Vert(LL) -0.16 15-17 >999 360 MT20 1971144 Lumber DOL 1.00 BC 0.59 Vert(CT) -026 15-17 >741 240 MT18H 197/144 TCDL 12.0 BCLL 0.0 Rep Stress Incr NO WB 0.66 Horz(CT) 0.03 11 n/a n/a Weight:170 Ib FT=20%F,11%E BCDL 100 Code IBC2015/TP12014 Matrix-S ---- -- LUMBER- BRACING- TOP CHORD Structural wood sheathing directly applied or 6-0-0 cc purlins, TOP CHORD 2x4 SPF No 2(flat) except end verticals BOT CHORD 2x4 SPF 210OF 1.8E(flat) BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing WEBS 2x4 SPF No.2(flat) REACTIONS. (Ib/size) 20=2948/04-6,11=1738/0-2-4 FORCES. (lb)-Max.CompJMax Ten -All forces 250(lb)or less except when shown. TOP CHORD 1-20=-270/0,10-11=-274/0,2-3=-577510,3-4=-5775/0,4-5=-773410,5-6=-773410,6-8=-5504/0,8-9=5504/0 BOT CHORD 19-20=015775,18-19=015775,17-18=0/9186,15-17=0/9170,14-15=0//734,12-14=0/7734,11-12=013058 WEBS 2-20=6457/0,2-19=0/2242,9-11=-3436/0,9-12=0/2749,8-12=-296/0,6-12=-249310,4-17=01720,4-15=-1601/0, 6-14=0/181,3-1B=0/658,4-18=-4640/0 NOTES- 1)Fasten trusses together to arias a single unit as per standard industry detail,or loads are to be evenly applied to all plies. 2)Unbalanced floor live loans have been considered for this design 3)All plates are MT20 plates unless otherwise indicated 4)Provide mechanical connection(by others)of truss to bearing plate at joint(s)11-- 5)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 6)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 oc and fastened to each truss with 3-10d(0.131"X 3")nails Strongbacks to be attached to wells at their outer ends or restrained by other means 7)Hanger(s)or other connection device(s)shall be provided sufficient to support concenlr3ted load(s)2761 Ib down at 4-5-10 on top chord The design/selection of such connection devices)is the responsibility,of otlter,- 8)In the LOAD CASE(S)section,loads applied to the face of the tnsss aro notedas front(F)or back(B) �{ 01F NE, +� r LOAD CASE(S) Standard V 1)Dead+Floor Live(balanced)'Lumber Increase=1.00,Plate Increase=1.00 ��P GA Uniform Loads(pin A Vert 11-20=20,1-10=-104 Concentrated Loads(lb) air 01 Vert:4=-2681(8) () t �' w bi 0. ,q��'ES81.aNP' July 24,2019 ®V,,ARNING-Verify des,gn parameters and READ NOTES ON THIS AND INCLUDED BIITEK REFERENCE PAGE Mll-7473 rev 10/0312015 BEFORE USE, ar ° nw 0amlpq vdbd fol tno only 4th A41Td rnnn_cjoms 7tPz dtrnipn L•ba,od only upon poral ir�C a m 4 And iu lI',Y s canipr r�ln fh c1 n ina In d t1 u av colt In Gess ryAtom,Buldrn umt;ih0oui7oipg'dtrelgnnt fluNtvaflty tho nnnUk-okibiy,Qf dam' 9I'�'91 ' a(wabarit0 61m,,Bldlo0 A)IDtUEetn{YCl4rs{bzftrNpi)371bru11+ lI:alUu1sw!°bandia•Utcniniembo,chly._Atitlllloftaltumparf7 sadp&rmnrroit}hrapnp im atwoyn.quUUd for 6tnhaty mid td plevenl cahnPsavnA,POM00 pttscnai In)vry arW propos$dnmrspn,Pw panami puhlars rPgvd'otg ti:tr (ntulcnii;.n,mta[agC,dntrvory.nrgdlca and bpinp of Iniv5ns"Ilia itnds syntumn.sen IfTP11[lunflty Crltddo,0813-4190813-419and aCSt Bulldi16023 Swinlena Component �' Chesterfield, 17 M0 63a Rd ANSRidge 5alefy Ltforn,mUon oval/nblo from Tnius Pia,a lliminrto.2la N,Lea&hae2; ,tn 312,Noxondrin,VA22314. Job toss' toss Type Qty ply Vineyard View Building D 2nd Floor - - 137921898 3597OF3 FOB Floor Girder 1 2 -_ - -- _ i Job Reference fopgonsh Universal Component'Corp„ EAST HAVEN CT 06512 0,010 s Aug 11 2017 h11Tek Industries,Inc-Wed 16124-116:39z36'2019-Page 1 ID:ndlRDAhLEUvQ7PklBgAvyTyugda-m95GiW6CvBbtQAsXghuolz 5VZa3uFK)'?yUVBxyuoLb _ 2-6-0 2-5-12 I Scale=1'21.7 Special Special Special 1x3 II Special 4x8 = Special 1x3 II Speclal1x3 II Special 4x8 = SpeLral 1x3 II 1 14 15 2 16 3 17 18 19 4 20 5 21 22 23 6 10 4x8 = 11 9 12 B 46 = 13 7 4x6 = 4x8 = 12-11-12 _ Pfale Offsets(X,Y),- )7:Edge,G-1-6),(8c41-8,Ednei,j9:0-14Edge),(10:Edoe,GA-8] _--- LOADING (psf) SPACING- 2-0-0 CSI. DEFL. in (loc) I/deft �L/d PLATES GRIP TCLL 40.0 Plate Grip DOL 1.00 TC 0 60 Vert(LL) -0 36 9-10 >430 360 MT20 197/144 TCDL 12.0 Lumber DOL 1.00 BC 0.99 Vert(CT) -0.47 9-10 >331 240 BCLL 0,0 Rep Stress Incr NO WS 0.51 Horz(CT) 0.05 7 n/a n/a BCDL 10;0 Code IBC2015/TP12014 Matrix-S Weight'96 ib FT=20%F,11%E ISER- BRACING- 'CHORD 2x4 SPF 2100F I-BE(flat) TOP CHORD Structural wood sheathing directly applied or 6-0-0 oc purlins, .� 'CHORD 2x4 SPF No,2(flat) except end verticals. WEBS 2x4 SPF No2(flat) BOT CHORD Rigid ceding directly applied or 10-0-0 oc bracing. REACTIONS. Ob/size) 7=2847/Mechanical,10=2776/Mechanical FORCES. (lb)-Max Comp/Max.Ten -All f6rces-250 Ob)or less except when shown. TOP CHORD 1-10=43110,6-7=-513/0,2-3=-6:3421Q,3-4=-6342/O,4-5=-634210 BOT CHORD 9-10=0/4263,6-9=016342,7-8=014266 WEBS 5-7=-4841/0,2-10=4861/0,5-8=012405,2-9=012384,3-9=-1033/0,4-8=-103110 NOTES- 1)Fasten trusses together to act as a single unit as per standard Industry detail,or loads are to be evenly applied to all plies. 2)Unbalanced floor live loads have been considered for this design. 3)Refer to girder(s)for truss to truss connections. 4)This truss has been designed for a moving concentrated load of 250,01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 5)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 oc and fastened to each trusswith 3-10d(0.131"X 3")nails Strongbacks to be attached to walls at their outer ends or restrained by other means. 6)Hanger(s)or other connection devlce(s)shall be provided sufficient to su&ott concentrated load(s)569 Ib down at 0-8-12,567 Ib down at 2-4-12,567 Ib down at 4-0-12,512 Ib down at 5-8-12,518'16 down at 7-4-12,567 Ib down at 9-0-12,and 567 Ib down at 10-8-12,and 571 Ib down at 12-4-12 on top chard,The design/selection of such connection device(s)is the responsibility of others, 7)In the LOAD CASE(S)section,loads applied to the face of the truss are noted as front(F)or back(B) LOAD CASE(S) Standard QF NS 1)Dead+Floor Live(balanced):Lumber Increase=1.00,Plate Increase=l_00 Uniform Loads(plf) /�Q' J(a.ig'r" Re� Vert:7-10=20,1-6=-104 Uj 9 �+ Concentrated Loads(lb) ' Vert 2=-501(B)14=-509(B)16=-501(B)17=-501(8)19=-501(B)20=-501(B)21=-501(B)23=-517(B) t _ n W' Uj !i aou�i-t``r A" 01080 �gOFEssY' c,�� July 24,2019 AWARNING-vcrlry design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE M11-7473 rev,10103/2013 BEFORE USE. ®� s '•DnelOn,vntiA foru,o'onty vdut M1TeL.F]cb+snecfas.Thio de;✓Ijn 6urea euye}con Pnrumntero phaxT.and i¢bran IndNiddal bu[Iding tarttponCnl;nut 1 I Ituf 3 aystam<Daloro trao,ole bialdaig denigncr meal vo!iry the af1ldirahsLtyt f dastgt patnmutc s aPd t�Pntly ficroacala Uds doGEgn into Wo wainli Eu4glnp Dr slnu tnd cn aif L fo pro(°°ani truckllnq ollndividunt Uu¢3 tuna andror chord mrmttar�cnfy.�tddlitotutt irtnf>a++uYnnd polmctnanttvntlarg �� i'at+oyatogUlrgdfofsfiblUl apnsv+mtcolWPIIev�lllpa¢mYlnperFsssttn)urynndp:euutt-.+atnYQe.FP`rond+uFntBunccrogordagulo, read-atUart,1wed,dE1tYH1`).SieCllOn LtRit f17Aulg at ltUilAa tlltd lfU�9 Lyb1e1P7;SL'a'` NSIftPft,Gimilty Criitaria,DSMi and BCSI 8ollding Component ) 16023 Swingley Ridge Rd Salaty'Inrot,t nen ovagal><e,irrxp TIUSS date In¢Lwto,218 N;Lce Simis ti1iG Vit,',APrptantlrta,-VA,22314. Chestefeld,MO 53017 Job cuss Truss Type - _ Qty Fly--- Vlnepard!thew Building 0 2tsd Ftotu 137921699 35970F3' F09 FLOOR GIRDER 1 Z - - _ Job Reference r��tinndt)_ UrlWurs'alComponentCorp., ASTHAVEN CT 06512 - - 8:Ofa_sAug1�j201YMiTe>etridustries;trrc. 1511,31:11 72019 Pagaf tD:ndlfiDAhttUvQli�IZiEi AVyTyugda-�Lt(Ea7ggVj}cj3f�ROQPlzi*G z?Ydet&EXL yuoLu 2-6-0 Scale=1: Special -• _ -�_ .- , �.. - _ 1 5x3 II 6x12 = 3x3 II 3x6 = 4x4 = 3x6 FP= 1,5x3 II 4x8 = 1,5x3 II 29 9 1 24 2 25 3 26 4 27 5 6 7 28 — 8 1 19 - -17 20- 16 15 „} 21 14 22 13 12 11 23 6 6x8 A 3x6 11 10x16 = 3x6 II 3x6 If 3x8 MT1BH FP = 6x10 = 5xx6 I I I 3x6 FP= +L_ ---425 plate,OtiStYs.(X Y)-_4( 0'1-B, eJ,. LOADING (psf) SPACING- 2-0-0 CSI, DEFL. in (loc) Well Ud PLATES GRIP TCLL 40.0 Plate Grip DOL 1,00 TC 0,61 Vert(LL) -0J8 14-16 >999 360 MT20 197/144 Vert(CT) TCDL 12.0 Lumber DOL 1,00 BC 0,66 -028 14-16 >696 240 MT18H 197/144 BCLL 1 0 Rep Stress Incr NO WB 0.72 Horz(CT) 0.03 10 We nla Weight 169 Ib FT=20%F,11%E BCDL 10A Code IBC2015TrP12014 Matrix-S -- _ LUMBER- -- ^- —- -� BRACING- T TOP CHORD Structural wood sheathing directly applied or 6-0-0,00 purlins, TOP CHORD 2x4 SPF No 2(flat)*Except" except end verticals 1-6.2x4 SPF 210OF 1.BE(flat) BOT CHORD 2x4 SPF 2100F 1.8E(flat) / BOT CHORD Rigid ceiling directly applied or 10-0-0 cc bracing. WEBS 2x4 SPF No.2(flat) REACTIONS. (Ib/size) 18=3300/0-2-4,10=1790104-6 FORCES. (lb)-MaX,C*p.IMax.Ten.-All f0fc&250(lb)or less except when shown TOP CHORD 1-10?' 16,9-10=-27310„2=3=909016,3-4=-962610.4-5=-8223/0,5-7=-5675/0, 7-8=5675/0 BOT CHORD 17-18=0/6248,16-17=0/6248,14-16=0/8223,13-14=0/6223,11-13=0/8223,10-11=013150 WEBS 2-18=-6985/0,8-10=-354010,8-11=0/2837.7-11=-287/29,5-11=-3088/0,5-13=0/1054, 3-16=-332610.2-16=0/4520,4-16=0/2053,4-14=-959/0 NOTES- 1)Fasten trusses together to act as a single unit as per standard industry detail,or loads are to be evenly applied to all plies, 2)Unbalanced floor live loads have been considered for this design. 3)All plates are MT20 plates unless otherwise indicated. 4)Provide mechanical connection(by others)of truss to bearing plate at)oint(s)18 5)This truss has been designed for a moving concentrated load of 250,OIb live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 6)Recommend 2x6 strongbacks,on edge,spaced at i0-0-0 cc and fastened to each truss with 3-10d(0.131”X 3")nails:, Strongbacks to be attached to walls at their outer ends or restrained by other means. 7)Hangers)or other connection devices)shall be provided sufficient to support concentrated load(s)3138 Ib down at 4-2-8 on top ®fj:.N E vV chord.,,The design/selection of such connection device(s)is the responsibility of others. 8)In the LOAD CASE(S),section,loads applied to the face of the truss are noted as front(F)or back(B).. G AR LOAD CASE(S) Standard 1)Dead+Floor Live(balanced):Lumber Increase=1,00,Plate Increase=1 00 Uniform Loads(plf) (L Vert:10-18=-20,1-9=-104W 4 Concentrated Loads(Ib) -111 Vert 1 Vert:3=-3058(F) 0,108 pRQPit s si July 24,2019 A WARNING'-Veril`Y deslgn paramefcrs and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE M17-7473 rev.10/03/2015 BEFORE USE �s 6esignYUld,ferusoonly%Nqh,).tiTok0GpnneciamTKrdvii0nt*bn ad,ssivvyUibn[ly�"tCisshtrvin and/%Gpanitfdlyldvnllis�'Jdl6g'companvnl;nal; Ik tiro nm Mndvorntl atruvsay5irrn.8oioiptls+r,d}abldliPm d4danermudt4nilf ura'un 11ca��Il-eldad/n 5r6mvtamand po�tylgmrporalvNsj6dvk.0,t4, 'build'u�gdiis"sgnc8wainglnd°rrr.•ntelttifOprtcvpnibusWlRr??(mdivliiilnJlhi�SWdB.dsfd(nrrnnntlp�Irbeay�orllY.A6tgdfOrlrtlp+rriit6:ar/vistpvmtaneulbincinfl � ,M �� ' icolwvy5raquirod`for--,4tuabu+ty,nndto}S+uva�SeFGovaU�FaoLsild-PonnlinjJrya 'fa'4peny,dd,•nar}0.'For ganalvlymddrrcarognr¢m[111!~'- I 16023Sw1n la Rrd'eRd fatalcitNat:esb�vgv.dvLvvq.maCsnnndbrAdnrjvttrdssesandWu_.a:yatdm• 's��, ' AN•4iriPtlQunitrycltta�4aaasB88and8CSt8vUd_inp,vmponent ! Cneslerneld9No53017 Sarni-IMomiMlon-aysUmxnfmm 71U54 P1nte Institute,215 N.Leo SVeat%�a 312,'Nnmridri,:VA 2:914. - ." - — 3 - �-•-_ -- - - Job russ- -- -Truss Type - - Qty" '' PIY Vifleyprd Vew Building D 2nd Flb_ui" 137921900 35970F3 F10 FLOOR GIRDER 1 e� - _ - � 4 Jti6.Rssfe7eil"c� Universal Component Corp, EAST HAVEN-CT 06512--- - `- - " '$,010 3 Aug 17 201,TMrTmk lridutitrlas;lila Wed ilul•24-16:39:39 2019•Page ll ID ndIRDAhLEtivp7Pki0G}Ivy Cjlty4gii;lY[]1SC7SRotbff0 hr5wG 03RWNh1�}524SQzcCtjyuo.2 2-6_ -0 AP? 13-0 2.4-8 1-9-10 4 Scale=1 28,9 rvw. 2x4 I I Special 15x3 11 6x8 MT18H = 54 = 4x4 = 4X4 = 3x6 FP= 1,50 I I 48 = 1,5x3 II 1 26 2 3 27 4 28 5 29 6 7 a 30 9 -31 10 r ., •� �.�.- _ _ � _ 1. � ix 0 a2� 21 1918 22 17 116 23 ~LL 15 - 24 14 13 '12 25 exa II 3x6 II 64 = 3x6 II 30 II 6x10 = 5x6 II 5x6 11 3x6 FP= 3x8 MT18H FP = - 16-8-4 342--- - -- --- - --Ir 3 . - v ---- 1382 -0-2 Ptaie=Offsets(,KY,�•�2:0-4•B;Cdge��j3:0=f�8.0-Q�01�f5:U-1�$Ectga};t6?0�1=8.Edg1f14.03�D.�0.O1?f'f8 0-�•O.Edu'ei:'f20:Edge 0-i-$; - -- - - - -- LOADING (psf) SPACING- 2-0-0 CSI. DEFL. In (loc) I/deft Ud TPLATES _ GRIP TCLL 40,0 Plate Grip I]OL 1.00 TC 0;63 Vert(LL) -0.18 15-17 >999 360' MT20 1971144 TCDL 12,0 Lumber DOL 1.00 BC 6,58 Vert(CT) -0.2815-17 >698 240• MT18H 197/144.- BCLL OA Rep Stress Incr NO WB 0,75 MOTZ(CT) 0.03 11 n/a n/a BCDL 10.0 Code IBC2015/TPI2014 Matrix-S Weight.195 lb FT 20%F,11%E BER- `-_ BRACING- - ^- CHORD 2x4 SPF 2100F 1.BE(flat) TOP CHORD Structural wood sheathing directly applied or 6.0-_0 cc purlins, t1u t CHORD 2x4 SP 240OF 2.OE(flat) except end verticals WEBS 2x4 SPF No.2(flat) BOT CHORD Rigid ceiling directly applied or 10-0-0 cc bracing REACTIONS. (Ib/size) 20=3349/OA-6,11=1847/0-4-6 FORCES. (lb)-Max Comp/Max,Ten.-All forces 250(ib)or less except when shown- TOP CHORD 1-20=-270/0.10-11=-273/0,2-3=-6530/0,3-4=-653010,4-6=10262/0,5-6=-8614/0,6-8=-589210,8-9=-5892/0 BOT CHORD 19-20=0/6530,18-19=016530,17-18=0110262,15-17=018614,14-15=016614,12-14=018614,11-12=013261 WEBS 2-20=-730110,2-19=0/2423,9-1 1=-3663/0,9-12=0/2957,&12=-28517,6-12=-3043/0,3-18=0/895,4-16=-5117/0, 5-17=0/1852,5-15=-88810,6-14=0/940 NOTES- 1)Fasten trusses together to act as a single unit as per standard industry detail,or loads are to be evenly applied to all plies. 2)Unbalanced floor live loads have been considered for this design. 3)All plates are MT20 plates unless otherwise indicated. 4)This truss has been designed for a moving concentrated load of 250,OIb live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 5)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 cc and fastened to each truss with 3-10d(0131"X 3")nails 'Strongbacks to be attached to walls at their outer ends or restrained by other means 6)Hanger(s)or other connection device(s)shall be provided sufficient to support concentrated load(s)3223-Ib down at 44-10 on top chord The design/selection of such connection devices)is the responsibility of others. - 7)In the LOAD CASE(S)section,loads applied to the face of the truss are noted as front(F)or back(B). LOAD CASE(S) Standard 1)Dead+Floor Live(balanced)-Lumber Increase=1.00,Plate Increase=1.00 '- Uniform Loads(plf) Q� .GA Vert'11-20=-20,1-10=-10aefq Concentrated Loads(lb) ' Vert-4=-31,43(B) W ESS1;4��,. July 24,1019 ®WARNING•Verity design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PA GE Mll-7473 rev.1010312015 BEFORE USE t -OWanymd tot USCCfl{yi'Wlltt Mti4♦rlB ionneIarim Th"s ddrat06,6lwced cnly Qpm-p amUteia s1lam luldN Loan lndlktii,gtbUltdlttp'canpatlurit:not dLruno6Ybtdlti?Baturaidest ihotlultWl tivo7�is4roia�yailtyUlanP cnblllty_of aAl»pommotprsand pmplrf;yittirxrparatot) ilaNiotinto [a,arerplt buTdlnp dllslpn,Br5CFni ind ailnif 1dlaprativnl Wi:Jfhp 4t tlydlv(3uel uuis r�L 1tidYor'tid nbhl6ers��ty:,AddlppNN Eomjinraty.r�d ptlrmnn6ot b8ldng p g Ir:always itigk6eaforWA1901Yandtoprevent&1lopsevrdhp6siVepvragnnlInjuryand prapR.nvdomagu.fojgCngmtOutdunmteonWtntilttc- f ''V'�� fntlllcri on.*onop,doWe- arodtan and fxirc{ig of Ifo oiamd bu;1 xysttlrils.Dea AN5UrP11 Qutlllty'Crittltlo,DSB 89 nod 8C51 Building Component 16023 Swingtey Ridge Rd Safety IkVo`rmnlfan ayailnbbin'fro>h,TrUsn Plata Inmlltuto,216 N.LlidSlreel,Stidt+312,Alexandria,VA 22314,-' _ Chesterfield;MO 63017 = - - - tb Truss - - _ 'LL T `'Type - "Dty Ply ylneyatd View Bulltllti0 D 2nd Floor russ137921901 359T,OF3, F11 Moor Girder 1 2 dOh Re -..-_ - -- ferenca.dplianal ag1 Universal Component Corp„ EASTHAVEN_CT 06512 -"`__ $,010 t#Adg 112077 MiTtikindustNer,;Ir1D.,Wpd 1u12416 39 a9 201tJ'PQ ID:gdIRDJ\IiLEU4QiPO4AvgYyugzSPHdFiSWntt1!ebcXtJmfy5aD�IswiOlGytioLY Scale=1 special "- -. _ ._ - . . -- - - --Speual "._ - - .- .. • _ _ .- Special Special 1X3 iI 4x10 = Special 1.5x3 II Spedal 1.5x3 11 special 4x10 = Special 1x3 11 1 14 15 16 2 3 18 19 20 4 Special 21 22 5 23 6 4x6 = 13 7 10 4x10 = 11 9 i2 _8 4x10 = 4x6 = '13-4 10 - [ -_ ._ --- ---- ---_ - - -4.70 ._-- - --- • - - `` PlateO(f ets,�X Y9w- [7.Edae;0-1=8);(8:0x1=8.Ed`e 1,(8710.8112 B LOADING (psf) SPACING. 2-0-0 CSI. DEFL. in (loc) Well] Ud - PLATES GRIP -0.31 7-8 >520 360 MT20 197/144 TCLL 40.0 Plate Grip DOL 1Vert(LL)TC 0,94 ) Lumber DOL 1.00 I BC 0,73 1 Vert(CT) -0.46 7-8 >343 240 TCDL 12.0 WB 0.63 Horz(CT) -0.05 10 n1a n1a 13CLL 0.0 Rep Stress Incr NO Matrix-S Weight:9816 FT=20%F,11%E BCDL 10-0 Code IBC2015%TPI2014 LUMBER- - 'Y - - — - - - - _ - "BRACING- TOP CHORD 2x4 SPF 2100E 1 BE(flat) TOP CHORD Structural wood sheathing directly applied or 6-0-0 oc purlins, except and verticals BOT CHORD 2x4 SPF 2100F'18E(flat) BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing. WEBS 2x4 SPF No,2(flat) REACTIONS. (Ib/size) 7=3162/Mechanical,10=3247/Mechanical FORCES. (lb)-Max,Comp/Max.Ten:-All forces 250(lb)or less except when shown- TOP CHORD 1-1 0=-565/0,6-7=-333/0,2-3=-788510,34=-788510,4-5=-7885/0 BOT CHORD 9-10=0/4952,8-9=017885,7-8=0/5272 WEBS 5-7=598310,2-1 0=-5620/0,5-8=013033,2-9=013379,3-9=139210,4-8=1437/0 NOTES- 1)Fasten trusses together to act as a single unit as per standard Industry detail,or loads are to be eveNy applied to all pies. 2)Unbalanced floor live loads have been considered for this design: 3)Refer to girder(s)for truss to truss connections. 4)This truss has been designed for a moving concentrated load of 2500b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 5)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 oc and fastened to each truss with 3-10d(0.131"X 3")nails. Strongbacks to be attached to walls at their outer ends or restrained by other means. 6)Hanger(s)or other connection device(s)shall be provided sufficient to support concentrated load(s)598 Ib down at 0-6-12,594 Ib down at 2-2-12,594 Ito down at 3-10-12,546 Ib down at 5-6-12,527 Ib down at 7-2-12,572 lb down at 8-5-12,594 lb down at 9-2-12,and 594 lb down at 10-4-12,and 594 Ib down at 12-0-12 on top chord. The design/selection of such connection device(s) is the responsibility of others. 7)In the LOAD CASE(S).section,loads applied to the,face of the truss are noted as front(F)or back(B). NES' LOAD CASE(S) Standard BAR 0 1)Dead+Floor Live(balanced):Lumber Increase=1.00,Plate Increase=1.00 a\ C/, Uniform Loads(plo Vert 7-10=20,1-6=404 _ r Concentrated Loads(Ib) Vert:_'4=-527(F)14=545(F)16=-527(F)17=-527(F)l8=-527(F)20=-527(F)21=527(F)22=-527(F)23=527(F) LU Eu • QUA--�o,.'b80Qg�'_�4,�f7 q4F SS1aN�' q July 24,2019 ®V.,ARNING-Verity design parameters andREAD'NOTESONTHISANDrNCLUDED`MITEKREFERENCEPAGEMII-7473reK1010312015BEFORENSE' ticap4volid•far tnao1114iNNIRA)cariti,--�S TklsduplrinLSWARdonfyuponpatns�utem.ha+n.andisrwnnlutir ii3ltuCSinpcumAonnnl;nW, a tn+eGn oyetarn.Bofuiti u`se Uid unit ik p du4>hmu mn�ivtuify 17ia apt>K�kliily,Qt •l8rlauobfltvact�ctoyrplUf9inlmo;rremlmrc.n:0QBoenr:,rdutipenutg�irut'"'nuoffr4rocmNTfussCc taSltoa4 i5buUdoa3dal1f�Sr2tn".cptl'uotnrpJxdmantmadErnaVons,ripYOnrAbtl?op2frdoypr,dn`irrlydIdnlictaSrtttirl lOtCdiYeilseair�nryA_Tr,ipdp}?lnr_m-rdw' bad 1 tkl!aprdvVntti00lk1 tidiodualtf w• 4M lfie Isalvay. roWWWO 01fnryn � tyCdfNDSEhilICSleutltn®component 16023 h1Y�1967�T6� f�it RidgeRd '_ Chesterfield, unnnfldllluto,Rla N,tcn _ __ Job - Truz -— - -- 7russType - - city Ply Vineyztd View Mildirig D 2nd Floor - 1 137921902 35970F3 F12 Floor 1 1 _ Job Rdfifed�otionni' Universal Component Carp,,, EAST HAVEN GT 05512 - "- -" -8,010 S Aug 11,2017 MlTek,InilusVlca,Inc, Wed Jul 2416.39:40 2019-Page 11- fU:ndiRDAhLEUv47PitiBq/tvyfyugd'a;etviinsuJJcQ�JlmAlaWykBp8okA2Gc{fivi+va�SOiiyuuJ�X' 2-6-0 - ss ( I 1-0-8 ,1 Scale 112"=1' 1x3 II 3x6 = 1x3 II 3x3 = 1x3 II 3x6 = 1x3 II 1 19 2 20 3 21 4 22 5 23 6 24 7 - - I Y t o 1, 14 12 15 11 16 10 17 91 18 R01 44 1x3 II 4x4 = 1x3 II 3x6= 4x4 14-M - - - - - �Plate Offsets(X, _�(B:Edrlti,U 7-B 1,f 1'Q-1-B.Eeiaej,jIjj dge&_1-61 _ — - - LOADING (psf) SPACING- 1-8-0 CSI. DEFL, in (loc) Ildefl L/d PLATES GRIP TCLL 400 Plate Grip DOL 1.00 TC 0,52 Vert(LL) -0,34 8-9 >504 360 MT20 1971144 TCDL 12.0 Lumber DOL 1.00 BC 0.53 Vert(CT) -042 8-9 >405 240 BCLL 0.0 Rep Stress Incr YES WB 0,28 Horz(CT) 0,02 8 n/a n1a BCDL 10.0 Code IBC20151TP12014 Matrix-S Weight 62 lb FT=20%F,11%E IBER- - BRACING- CHORD 2x4 SPF No,2(flat) TOP CHORD Structural wood sheathing directly applied or 6-0-0 or purlins,, rsvi'CHORD 2x4 SP 285OF 2,3E(flat) except end verticals. WEBS 2x4 SPF No.2(flat) BOT CHORD Rigid ceiling directly applied or 10-0-0 cc bracing.- REACTIONS. racing:REACTIONS. (Ib/size) 13=73210-4-6,8=732/0-4-6 FORCES. (lb)-Max,CompJMax.Ten.-All forces 250(Ib)or less except when shown. TOP CHORD 1-13=-27110,7-8=-27110,2-3=1831/0,3-4=-183110,4-5=-180910,5-6=-1809/0 BOT CHORD 12-13=0/1179.11-12=011179,10-11=0/1831,9-10=611631,8-9=011133 WEBS 2-13=-1331/0,2-12=0/300,2-1 1=0f762,3-11=254/18,6-8=1286/0,6-9=0(767,5-9=3`16/0,4-9=-2431282 NOTES- 1)_Unbalariced flodr,live iifsloads have been considered for this design. , 2)T ,lruss has;beeh desighed fora moving concerltratedload of 26b,tllb Sive located at all mid panels and at all panel points along 'the Top Chbrd�and 9atthm,Chc l:nonc<addor(ent witti airy other live loads: 3)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 cc and Wtened Io each truss with 3-10d(0 131"X 3")nails. Strongbacks to be attached to walls at their outer ends or restrained by othermeans- p4 GARC/-9 O,A� s. r tr 0 w - July 24,2019 �V1d[ttTti�;•Varnadas(pnpar�i»riatsandiLrALM1'OTE&4}NTIrtSi5r1[il;Jfttt(CMA4irr3tREFERENGEPAEEM1r•747jai.101476:58°MR5iMF ,t7as+ga vafd{C+rwU cnty wflh M7oY�cnnnattarra:Yldo design�uaud+xiJy up:;o prarainelus 5-'�airt,and id tor`nn taillvtdint but�ding cc[mpaamif,not �1�T+➢'�tiii 6("M+yntom;tfoloro wlo,fhe buadlbg dosiyr r,muat i4alk lhonppric4tih:YoFdaalgn pornranWMArid rwopntiy Incmp61n106A dasLinbd9 lite-ove�att butidingda ign.ergc{ngiidic ttifintopxnvdmtimOngoffrefiviou-0tiutsvtbaid*chwelmemtlerscMy,,AddJaonn1 mrpomLy6pdOtniarientut 06 M!Tok,,,* tsnlvnydomignrodtreste(dityuadtolrrwontwJlapse'r+flC�passlUlat>o:o+�lin`paryandptoportydnmago;Forgorismiguidancemijanifn0ln -- tab<tcntion,stotnga;dolivoryry��arocijon and tuaiinp of trusaha'�mf traps<a„tum:,sea AH611TFC1 QualJly Crl4aefo,IaSB•8g and BC51 Building Component 16023 Svnngley Ridge Rd Salary Inlormadan rrCm/able Dom Tiusi mato ljitoauke 2la N.Leri Stica Sarla,312.'1Vaxnnddn,VA2231;t, y Chesterfield,MO 63017 toss Truss Type City Ply a Vinuyurd View Building D 2nd Floor 137921903 359?OF3 F13 FLOOR 9 1 Job_Reforence(apUgnalL _�� Universal Component Corp.,- FAST HAVEN CT 06512 8,0'10 s Aug it 2017 MITeh lndusVies,Inc. Wdd Jul 24 16:39:41 2019 Page 1 ID_tndIRDAIiLEUv07Pk19,yAVyryuflda•67u9,,EALkIDA%f,l3VdM(Ol y,,lPwzY0'SBEBGp9yu0LW 1 260 ) OJ-6 Scale=1: 4x4 = 1.5x3 II 3x10 = 1_,5x3 II 4X4 = 1.5X3 II 3x6 FP= 1.5x3 II 300 = 1 5x3 II 1 22 2 23 3 24 4 25 56 7 B 26 9 r 27 10 17 16 20 15 14 13 12 21 11 1 19 4x6 11 3x6 FP= 6x8 = 5X6 II 5x6 II 6x8 = 3x6 FP= 3x6 d S&•3.8 - I - - 18-3.6 - - Plan Offsets fX.Y)- jn 0 1 8 Edgo] T14 0 3.0 0-D•0] 115 0 3.O;Edgej -_ - - --- - LOADING (psf) SPACING- 1-8-0 CSI. DEFL. in (loc) I/defl L/d PLATES GRIP TCLL 400 Plate Grip DOL 1.00 TC 0.49 Vert(LL) -0.16 15-17 >999 360 MT20 197/144 TCDL 12-0 Lumber DOL 1,00 BC 0.50 Vert(CT) -0.26 15-17 >846 240 BCLL 0,0 Rep Stress incr YES WB 0.37 Horz(CT) 0.03 11 nla n/a Weight 92 lb FT=20%F,111/aE BCDL 10.0 Code IBC2015 /-rP12014 Matrix-S LUMBER- BRACING- TOP CHORD Structural wood sheathing directly applied or 6-0-0 cc purlins, TOP CHORD 2x4 SPF No.2(flat) except end verticals. BOT CHORD 2x4 SPF No,2(flat) WEBS 2x4 SPF No,2(flat) BOT CHORD Rigid ceiling directly applied or 10-0-0 cc bracing" REACTIONS. (Ib/size) 18=938/0-4-6,11=938/Mechanical FORCES. (lb)-Max CompJMax.Ten,-All forces 250(lb)or less except when shown. TOP CHORD 1-18=-27010,10-11=-270/0,2-3=-2673/0,3-4=-2673/0,4-5=-3208/0,5-6=-3208/0,6-8=-2663/0,8-9=-2663/0 BOT CHORD 17-18=0/1585,15-17=0/3171,14-15=0/3208,12-14=013208,11-12=0/1579 WEBS 2-1B=-178110,2-17=011 222,3-17=-293M,4-17=-560/8,4-15=-219/301,5-15=-4091378,9-11=-1774/0,9-12=0/1218, B-12=-294/0,6-12=-684/32,6-14=-453/453 NOTES- 1)Unbalanced floor live loads have been considered for this design. 2)Refer to girder(s)for truss to truss connections. 3)This truss has been designed for a moving concentrated load of 250,01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads" 4)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 oc and fastened to each truss with 3-10d(0 131"X 3")nails. Strongbacks to be attached to walls at their outer ends or restrained by other means. �A GARc'9 4A tr,c1 W n � 1�r j tu FESS1 July 24,2019 ®WARNING-verily design parameters and READ NOTES ON THIS AND INCLUDED biITEX REFERENCE PAGE M11-7473 rev 1010312015 BEFORE USE } 1 pt:i(In s}nl.d im n><n galy v,Uh rV3'f vFcV'c4nnedrua_T191 daslgd 9a bnWJ nniy upon parantoleis shown,and lu for nn ipdrviwnl pnbd)np CQryIP ani,ndt 9i a trstss sy&tane Svtarn usu,tho buddrnp dnslgncr moot v;ny Iho apptlrais!Iltyof dnsi(fn ts;iraniutars anulttnpndy lntarps�mta Utas dusJgn lnlo the Gvari:n ; bsiildlnpdcilpn,firaeiriOlnsftnnigdiSlapie>`aniteuLk9L1}jof[ndtWdualfiusswatinsidfora'»7drriCmbororJyrr�d,L6ortratnrnporaryandpermnnenttucc3n>) , irQ�{ 4:Wwaya sequlrod ior>itnhitityand its prevent ccha-.11-11 rd»I0n�m'tionl tQ N and pr+:{+arty timatir}0.tdt'9�mrxal t;uttlonte eugagtnpltsn 16023 Sxangley Rtd a Rd ralxscntbn,ais:sal7sr,4ntiuety,elaOnn�nJ CtAting cJ Vu53e9 And buss oydtonie.aeo ,Ar4SlRPlI Qsmlity.Ccnastn,DSC-S9 and 9C51 tiulltpnp Component k Chesterfield,MO 63017 5ardtylnfornsniian s♦`veilnbialromttussFealoirt3liWta,2fAN.t.CaSlmbi,Svrtoitt2',.itnxecftsflip,iA22dt�i, _ �y;4�•,..V �- __ ----- Job Truss Truss Type - - _ "Qty"--- Ply M---ardVlew 6uildinil D-2D$�floor. 137921904 3597OF3 F15 Floor 1 1 _ __ _ _ - I Job Raference o tionol " Universal Component Cole, EAST HAVEN CT 05512 -- - - --8.010 s Aug 112017 MiTek Industries.fna.Wed Ju124 16,39A2 2019 Page 1 ID ndIRDAhLEUvQ7PkiBgAvyTyugda-bJSYHaAzV1L085KhBx7CGEE9m kelOrbNuxpLbyuoLV r 2-6-0 i �1 Scale=1,27.7 1.5x3 II• 3x6 = 1 5x3 II 44 = 44 = 3x6 FP= 1.5x3 II 3x6 = 1,5x3 II 1 21 2 22 3 23 4 24 5 6 7 25 8 26 9 t 1'-# 17 15 14 13 18 12 19 11 20 10 44 = 3x8 = 3x8 MT18H FP = 1x4 II 1x4 11 3x8 ; 44 = 16-3.6. - - - - - -- 16.3-6 - Plate Offsets xrY)� 11;0 =B,EdgeJ,j5 0.1-s,Ed a 10 E11 a.Q��1.B),j16:Eda�O 1-6J_ - - LOADING (psf) SPACING- 1-8-0 CSI- DEFL. In (loc) I/dell L/d PLATES GRIP TCLL 40,0 Plate Grip DOL 1 00 TC 0,49 Vert(LL) -034 15-16 >572 360 MT20 197/144 TCDL 12.0 Lumber DOL 1.00 BC 0.53 Vert(CT) -0.43 15-16 >452 240 MT18H 2441190 BCLL 0.0 Rep Stress Incr YES WB 0 31 Horz(CT) 0,03 10 n/a n/a BCDL 10.0 Code IBC20151TP12014 Matrix-S Weight-70 Ib FT=20%F,11%E IBER- - BRACING. — CHORD 2x4 SPF No.2(flat) TOP CHORD Structural wood sheathing directly applied or 6-0-0 oc pudins, CHORD 2x4 SP 2850E 2.3E(flat) except end verticals WEBS 2x4 SPF No.2(flat) BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing, REACTIONS. (Ib/size) 10=835/Mechanical,16=835/0-4-6 FORCES. (lb)-Max.CompJMax.Ten All forces 250(lb)or less except when shown. TOP CHORD 1-16=-27010,9-10=270/0,2-3=-217910,3-4=2179/0,4-5=-246610,5-7=-217910,7-8=-217910 BOT CHORD 15-16=0/1323,13-15=0/2466,12-13=0/2466,11-12=0/2466,10-11=0/1323 WEBS 2-16=-1501/0,2-15=0/972,3-15=-30410,4-15=-461/160,8-10=-150110,B-11=0/972,7-11=-304/0,5-11=-461/160 NOTES- 1)Unbalanced floor live loads have been considered for this design 2)All plates are MT20 plates unless otherwise indicated. 3)Refer to girder(s)for truss to truss connections. 4)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 5)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 oc and fastened to each truss with 3-10d(0.131"X 3")nails. Strongbacks to be attached to walls at their outer ends or restrained by other means. OF NEyy GARC/ (P��,o A°FsS�o�P July 24,2019 WARNING.Verify design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE M11-7471 rev.IOIOMD15 BEFORE USE Design valid for use only with MiTekm connectors.This design Is based only upon parameters shown,and is for an individual building component,not a truss system.Before use,the building designer must verify the applicability of design parameters and properly incorporate this design into the overall g y- building design.Bracing indicated is to prevent buckling of Individual truss web andlor chord members only.Additional temporary and permanent bracing I �t•1'®�` is always required for stability and to prevent collapse with possible personal injury and property damage.For general guidance regarding the pp fabrication,storage,delivery,erection and bracing of trusses and truss systems,see ANSlrrPl1 Quality Criteria,DSB-89 and SCSI Building Component (t 16023 Swingley Ridge Rd Safety Information available from Truss Plate Institute,218 N.Lee Street,Suite 312,Alexandna,VA 22314, # Chesterfield,MO 63017 JOY cuss ------ ype QTY Ply Vtneyord'Vicw.Build+ng D 2nd Floor 137921905 3597UF3 F16 Floor Supported Gable 1 1 Job Retarencnti0n911 _ Universal Component Corp., EAST HAVEN CT 06512 8.010 s Aug`1�1,2017-M1(ek Industlie%Inc._Weil Jul 24 16;39'43 2019 Pagel tD.Y1t1IRDASrt EUv07Pkr8gAvyTyugtia lVilvrVwLibFLTtlEvtlMlRpR)r1PFOnw.lXaicYtllJt 1yuoLU 1 1x3 II 9 2 1x3 II 10 3 1x3 II Scale=1 t s - 9 'Y:'::Y'. "i�fYb s' 's`v.•r: ':�N.r��u.`:,'s"m`ex n�•h,,+r,,,f�l 9{y'kv+* ,r�tr<<"`.{ii 4a'. i2 v'e icy'• .�T"o ^.....'.a�MYT i� V B 7 5 B 4 1x3 Il 1x3 P 1x3 II 2.46 _ -211& (in loc Ildefl Ud PLATES GRIP LOADING (psi SPACING- 2-0-0 CSI. DEFL. ) TCLL 400 Plate Grip DOL 1.00 TC 0,18 Vert(LL) n/a n/a 999 MT20 197/144 TCDL 12.0 Lumber DOL 1.00 BC 0.19 Vert(CT) n/a n/a 999 BCLM L OA Rep Stress Incr YES a trix-S 0.03 HOrz(13T) 000 4 n/a n/a Weight 10 Ib FT=20%F,11%E BCDL 10.0 Code IBC20151TP12014 LUMBER- BRACING- TOP CHORD Structural wood sheathing directly applied or 2-4-6 oc purlins, TOP CHORD 2x4 SPF No 2(flat) except end verticals BOT CHORD 2x4 SPF No.2(flat) WEBS 2x4 SPF No.2(flat) BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing, OTHERS 2x4 SPF No.2(flat) REACTIONS. (lb/size) 6=72124-6,4=5'1/2-1.6,5i=15412.4-6 Max Grav 6=276(LC 10),4=268(1-1312),5=305(LC 11) FORCES. (lb)-Max.Comp./Max Ten.-All forces 250(lb)or less except when shown. TOP CHORD 1-6=-263/0,311=-258/15 WEBS 2-5=-276/0 NOTES. 1)Gable requires continuous bottom chord bearing 2)Truss to be fully sheathed from one lace or securely braced against lateral movement(i.e.diagonal web) 3)Gable studs spaced at 1.4.0 oc 4)This truss has been designed for a moving concentrated load of 250 Dib live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 5)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 cc and fastened to each truss with 3-1 Od(0.131"X 3")nails. Strongbacks to be attached to walls at their outer ends or restrained by other means. of NElIl - GA110Ul r �yp CC N�4 �0-0800�� °ress�o July 24,2019 WARNING-Verity design parameters and READ NOTES ONTNIS AND INCLUDED MITEK REFERENCE PAGE MII-7473 rev.1010312015 BEFORE USE Deatdti valid lei,usv,only'4h tv1(I'r,'X&capm0fiiora 1114 go i nis 41r 0 wilyy upon�r fCnramatdra:wraym,n,fd is to un Uluhvahutf I:ulldlnp canitarlcnt,mi R IMF! ntntc,sy✓ittm Balarc ust,a,6 Lulldfnd du!u}ypca naffs!vaily inn nppflablliy at riesktn p6mmalnrs and Maparfy frwbrWxtlta thio'dO51fin 1nI01hn urara t Ct Uding daxt>)n.QrnGngLtditnted Is Yo prover,/baC1d n0 ut Ind'nvidunl iluss:teb and/or chard membmn anry.A��dd4fdnti lumtxx ay+tttd cermn'nant ti+nrl,ttt is xilwny9r�tutmd for i lnbttRy and dr(roveat1;711uhsa 1vdln ptD.R hie pLrsp utl njury mrd Wapar 71N81mT1A11 a nllry Crltnanaml'0r1a R5E1016 -s Idance 9nd SCSI dullcitna Component 16023 Swingley Ridge Rd )atvJaadori.rla,400.d6011$7,0104on and waci ni el'lydssas an0 tra53dysterna.ree Chesterfield,MO 63017 'Safely intwination avellabla f ohl7ruzs fta,iathiatlt,21a1'd.Lee sires].St tie 312,Afcvnnddk VA 22314. _- - -- - j•- - JOl� TF"17 Truss Type — Qty Vineyard View Building D 2nd Floor 137921906 3597OF3- FLOOR 7 1 Job Reference/ODhonaq Unlvet'sal Component Corp, G_AST HAVEN CT 06512Aug 112017 MiTeIndustries,-Inc. Wed Jul 24 16:39 44 2019 Page 1` I D:ndIRDAh LEUvQ7PkiBgAvyTyugda-Xha IIFCDOebkNOT41M1 gLfJSRnPumuXugCQwQUyuoLT 2.6.0 0-�8 Scale=136,3 1.5x3 II 3x6 FP= 1 5x3 II 48 = 1.5x3 II 4x4 = 1.5x3 11 4x4 = 1.5x3 II 48 = 1.5x3 II 1 24 2 25 3 26 4 27 5 6 28 7 8 29 9 30 10 31 11 19 1 20 18 17 21 1615 22 14 13 23 5x6 11 6x10 = 3x6 FP= 46 II 3x6 FP= 6x10 = 5x6 11 46 11 20-11-3- _ Plate Offsets(X.YY= [t5`0 3-t},Edgej;116:0-3.05dael LOADING (psf) SPACING- 1-8-0 CSI. DEFL. in ([cc) I/deft L/d PLATES GRIP TCLL 40.0 Plate Grip DOL 100 TC ' 0.60 Vert(LL) -027 16 >923 360 MT20 197/144 TCDL 12.0 Lumber DOL 1.00 BC 0 61 Vert(CT) -042 16 >594 240 BCLL 0.0 Rep Stress Incr YES WB 0.43 Horz(CT) 0._05 12 n/a n/a BCDL 10.0 Code IBC2015/TP12014 Matrix-S Weight 104 lb FT=20%F,11%E LIBER- — - BRACING- P CHORD 2x4 SPF No.2(fiat) TOP CHORD Sttvctural wood sheathing directly applied or 5-3-0 cc purims, ovT CHORD 2x4 SPF No.2(flat) except end verticals, WEBS 2x4 SPF No,2(flat) BOT CHORD Rigid ceiling directly applied or 10-0-0 cc bracing REACTIONS. Ob/size) 19=1076/0-4-6,12=1076/0-4-6 FORCES. (lb)-Max Comp/Max Ten -All forces 250(lb)or less except when shown TOP CHORD 1-19=270/0,11-12=-270/0,2-3=-32OB/0,3-4=-320810,4-5=428510,5-6=4285/0, 6-7=-4285/0,7-9=-3208/0,9-10=-320810 BOT CHORD 1B-19=0/1853,16-18=0/3978,15-16=0/4285,13-15=0/3978,12-13=0/1853 WEBS 2-19=-2082/0,2-18=0/1522,3-18=-29210,4-18=-86610,4-16=-851564,5-16=-318/178, 10-12=-2082/0,10-13=0/1522,9-13=-292/0,7-13=-866/0,7-15=-85/564,6-15=-3181178 NOTES- 1)Unbalanced floor live loads have been considered for this design 2)This truss has been designed for a moving concentrated load of 250 OIb live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 3)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 cc and fastened to each truss with 3-10d(0.131"X 3")nails, Strongbacks to be attached to walls at their outer ends or restrained by other means. t LU LU & °- .AR°FFss�aN� July 24,2019 WARNING-Verdy design parameters and READ NOTES ON THIS AND INCLUDED 4ttTEK REFERENCE PAGE M11-7473 rev 10/03MfS BEFORE USE. tJnaiOn!mtldhuu:vonirnafHf9tiow�'i•�:ncxl'ars.'il�dcsrgntabadcdant uP�Pe+nmeteeichcWia nndlsfcranlndlvWuh7Uuitaingcmtilionaot.nat d(rV3noynlein:l3nfalD UCr7,gi4 bullding'do6igffoTfnitBl,'10ttf�rulII appllcfihl�;et driOn11 p5mnelem Pod pmportyincolponlle Ihle deuigtt Into ftt o3 tnAil- buld'ng doalpa.9racinglnalcalod(s to liiawml tvieWGrjjatadMdual tnrsi h'ab dndl4i,rl Cid nin ntiem only,AddilfoiO lomporary and peannaenl tirsclaig �� Is PlWPysruquued rcr'mawhy end 10,00,1 nt cunni sd vaih pns�tde Porsawt tnjuy'nnd oropddy dnmatte,For q:neral gglddnco regaidmg the laprkaft?sn,a!orngo,ddnecryy ereUlop and tirpdtru o1 bassos and buss aystdune.not ANSIITPN Quality Grilarli;;DSE-89 and©CSI Building Component 16023 Seangley Ridge Rd 8nf'rty Igfammiloit avhvapla fruni,Tntss Plate Inntihite�218 N,Lea Shaet,Salla 312./gtsxaittlda;i/it223f4, i Chesterfield.MO 63017 runs Truss Type Vin T Qty Ply eyard View Building D 2nd Floor „Job } 137921907 I 35970F3 F18 FLOOR 11 1 Job Reference(optional) UniYer`sal Component Corp„ EAST HAVEN CT-06512 8.010 s Atig 1 T2017 MiTek Industries,Inc. Wed to 24.16'39.46 2019 Page 1 ID•ndIRDAhLEUvQ7PkIBgAvyTyugda-T4i27xETYGrScidSQn38R4OpPb4WEn7BIWv1 UMyuoLR 2-6-0 Scale=1:3 150 II 3x6 FP= 1.5x3 II 4xB = 1.50 II 4x4 1.5x3 II 44 = 1,5x3 II 4x8 = 1.5x3 II 1 24 2 - 25 3 26 4 27 56 28 67- B 29 9 30 10 31 11 9 20 18 17 21 16 15 22 14 13 23 6x10 3x6 FP- 4x6 II 3x6 FP= 6x10 = 5x6 11 5x6 I I 46 11 Plate%)t'SBt9O,Ed,Ar ' 7j,LB`D LOtE e1 -- - _- LOADING (psf) SPACING- 1-8-0 CSI. DEFL. In (]cc) I/deft Lid, PLATES GRIP TOLL 40.0 Plate Grip DOL 1.00 TC 0,57 Vert(LL) -0,26 16 >944 360 MT20 197/144 TCDL 12,0 Lumber DOL 1.00 BC 0.60 Vert(CT) -0.41 16 >608 240 BCLL 0.0 Rep Stress Incr YES WB 042 Horz(CT) 0,05 12 n/a n/a Weight:104 Ib FT=20%F,11%E BCDL 10.0 Code IBC26151TPI2014 Matrix-S - --- _ LUMBER- - - - - - -- - _ BRACING- TOP CHORD Structural wood sheathing directly applied or 5-4-10 oc purlins, TOP CHORD 2x4 SPF No2(flat) except end verticals BOT CHORD 2x4 SPF No,2(flat) WEBS 2x4 SPF No.2(8at) BOT CHORD Rigid ceiling directly applied or 10-0-0 cc bracing REACTIONS. (Ib/size) 19=1067/0-4-6,12=106710-2-4 FORCES. (Ib)-Max.Comp./Max Ten.-All forces 250(lb)or less except when shown TOP CHORD 1-19=-27010,11-12=27010,2-3=3172/0,3-4=-317210,4-5=-4218/0,5-6=-421810, 6-7=-4218/0,7-9=-3172/0,9-1 0=-317210 BOT CHORD 18-19=0/1835,16-18=0/3925,15-16=0/4218,13-15=013925,12-13=0/1835 WEBS 2-19=-2062/0,2-18=011502,3-18=-293/0,4-18=-84610,4-16=881541,5-16=-4741309, 10-12=-2062/0,10-13=011502,9-13=-293/0,7-13=-846/0,7-15=-88/541,6-15=-474/309 NOTES- 1)Unbalanced floor live loads have been considered for this design 2)Provide mechanical connection(by others)of truss to bearing plate at lot nt(s)12. 3)This truss has been designed for a moving concentrated load of 250.0Ib live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 4)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 cc and fastened to each truss wdh 3-10d(0.131"X 3")Halls, Strongbacks to be attached to walls at their outer ends or restrained by other means, �P 3Jp,N GAq�►�q (� ' LU O.0804°'�y � QfiES S1 o July 24,2019 ®WARNING-Verify design parameters and READ NOTES ON MIS AND INCLUDED MITEK REFERENCE PAGE MII.7477 rev.1010312016 BEFORE USE # A i7o�gllrtlldfardsaatty ti8t}.IiiG asrrlccior5 714x6 Jn1�� anN.uA nt&+*eirib1ldWfl,anditiarark lntlfvls7Uatb"ft'tatpisopaM.n01 o UussLyatom,Safoto uss.tho-buuding des43tiortt uoivetty It c npWrt onitlty erdosign pracnafa?s dad trropc lq,tnWrPccaW Ud1 tieifgn Intglhn ouamU t>iaUd"+(spdgialinL`tiFatiata,tadtcatndGltup(ev,1€,:huc7l+inglh:ht+tl4iltuatknss+nnb�ptltbredvoidntdrntncr�nntq.`Adelnlartpl4ompospryanapnnganenlbeu�' MOW- _ Isah+y�ynrequvdd(apnlat»i4yUndfafrav�,lcc'inpsewlnposnNlnpetsbtnflnjUryancttstttsaiCCYydbmntlti Fat4nnaal4bl;bseeg4id acct, WdI16023 IpArkatan,slwaappD.delivery,cream 46d bracing of Inissot and hugs�riimlm.sae q(iSt/1Pli 4Unriry Cdlerin;bS6 Ft9and 6CSt t3UUdlap Component Chesterfield,M 6301 Rd Snfety`tnfotmoUon hvaltabto herrn Truss Plata Institute,218 N:Lea45hoet.u'Ullir312,At�modtm.tiA'sY3Yd,.` - __ Job Truss--- -" - Truss Type Qty itioyard View Building D 2nd Ffoor tt 137921908 P 35970F3 F19 FLOOR 3 1 (( Jab Referetfoe o banal) _ I' Uni401sat,Companent Corp., ----EAST HAVEN CT-06512 8.01Us'Aug 11'2017 M11lTt k'lndustrfa"s,ino_•Wed Jul 24 16:39:472019 Pape 1` ID1ndIRDAhLcl1v07,PIi3EgAvy7yus�d xdFC�KkiEOJZxJF�Ct llat�izl tx?M?TIG Cx4t<XAaatiSyuat:Q 2 '01 —{ Scale=1 24,3 1x3 II 3x6 — 1x3 II 3x3 = 1x3 II 3x6 = 1x3 II 1 17 2 18 3 19 4 20 5 21 6 22 7 X. 1� 13 11 14 10 15 94x6 II 16 4x6 II 6x6 = ' 3x6 II 4x6 II - i4-3-e Plate Offsets(X,Y)'� 19:0=3 D,Edga]_ — - - LOADING (psf) SPACING- 1-8-0 CSI. DEFL. in (loc) Ildefl Lid PLATES GRIP TCLL 40.0 Plate Grip DOL 100 TC 0.50 Vert(LL) -015 8-9 >999 360 MT20 1971144 TCDL 12.0 Lumber DOL 1.00 BC 0.44 Vert(CT) -0.19 8-9 >882 240 BCLL OA Rep Stress Incr YES WB 028 Horz(CT) 002 8 n/a nla BCDL 10.0 Code IBC2015rrP12014 Matrix-S Weight 71 lb FT=20%F,11%E ABER- — - BRACING- 'CHORD 2x4 SPF No,2(flat) TOP CHORD Structural wood sheathing directly applied or 6-0-0 cc purlins, oma,r CHORD 2x4 SPF No.2(flat) except end verticals WEBS 2x4 SPF No.2(flat) BOT CHORD Rigid ceiling directly applied or 10-0-0 cc bracing REACTIONS. (Ib/size) 12=73210-4-6,8=732/0-4-6 FORCES. (ib)-Max.CompJMax.Ten -All forces 250(lb)or less except when shown. TOP CHORD 1-12=-270/0,7-8=-270/0,2-3=-1882/0,3-4=-1882/0,4-5=-1903/0,5-6=-1903/0 BOT CHORD 11-12=011183,10-11=0/1903,9-10=0/1903,8-9--G/1199 WEBS 2-12=-1329/0,2-11=01786,3-11=-307/0,4-11=-271/279,6-8=-1347/0,6-9=0/791,5-9=-255133 NOTES. 1)Unbalanced floor live loads have been considered for this design. 2)This truss has been designed for a moving concentrated load of 250.0lb live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any.other live loads. 3)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 cc and fastened to each truss with 3-10d(D 131"X 3")nails Strongbacks to be attached to walls at their outer ends or restrained by other means / SOF NEty lr • +4 , LU Sdbsrxp t.'at 41, July 24,2019 ®WARNING-Verity design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE M11-7473 rev,1010312015 BEFORE USE. ��- Oesion yatto,ter-mo only Sahli 0Tak06nnoc1a;-t,_T l0 desl0n'is based eniy upon paranolem sbumi.-and In for nndivt irduat Inrl�ng component not �e f 0MI.6}'dlkln Oufarausa.thebtridgfldnsiaaermoatvorlP/-1116IpplIcablutyofOvIonpat-rrnmraarutpumntty(nca=tuAttathb4as;Orrlmutanovorou �ti�llE�i Bupdirhj dcapn.Oradng7ildlraind rs patamcsrl t+is'xlinp of lyd(riduat trusa'vraii'andlar c/+uid msrnhotsoofy,'/eddilid+yal fampotnry and ppermnn&rt[uadp0 tygt��`�� I§Hive tya requlreU tar sla6lt11y atidd'o ptavnnt cxs 1a{sen uipl�xrsiablo parse etii itth+ry and gropoltyy d un as For pnnitrrat`qutdnitce p uding kid tabticallCn,sla4g�delivery,arrJian and bmdng 01 ttussae and over aydivnra,see ANSM14.0unfily Criteria,OS8469 and 0C5tt3ulldin0 Component 16023 Swingley Ridge Rd Baroty inrormctlon 6uallablo film Ttuiii Sam lait0futa;2tS N.Lee Steel.SUeo 317, 4oxrmdr(n,_VA 22314, Chesterfield,MO 63017 Job russ Truss Type Qty Ply Vineyard View Building D 2nd Floor 137921909 35970F3 [F20 Floor Supported Gable 1 1 dab Reference o honal __ Universal Cvmpananl Corp., EAST HAVEN C009512 8.010 s Aug 11 2017 MITek Industries,Inc. Wed JuE 24 16:33:482019 Page 1 ID:ndIRDAhLEUvQ7PkIBgAvyTyugda-PTppYdFk4t5AsonrXC5cWVTF2PIRlnpUlg07ZFyuoLP Scale=1' 1.5x3 II 11 20 2 21 3 22 4 23 5 24 6 7 I ' .o _-z7777 Y oat:, `,v::..(:ti:`; '4•rA n`f-_':''^' '�.4.; '.;�,- <"r�;�,'<>:;`}:tt��:,.._�. .'� - •;,.��._ -:kms:e _>W..�.-_.: ��_.-_-��.•:. -- _ _ - . 14 _m 15 13 F ,Y 1612 17 11 18 _ 10 19 9 8 1x4 II LOADING (psf) SPACING- 2-0-0 CSI. DEFL. in (loc) Udefl L/d PLATES GRIP TCLL 40.0 Plate Grip DOL 1.00 TC 0,18 Vert(LL) n1a n/a 999 MT20 1971144 TCDL 12.0 Lumber DOL 1.00 BC 0.19 Vert(CT) n/a - n/a 999 BCLL 0.0 Rep Stress Incr YES WB 0,03 Horz(CT) 0.00 8 We n/a Weight 26 Ib FT=20%F,11°/4E BCDL 100 Code IBC2015/TP12014 14 Matrix-S LUMBER- BRACING- TOP CHORD Structural wood sheathing directly applied or 6-0-0 Dc purlins, TOP CHORD 2x4 SPF No.2(flat) except end verticals. BOT CHORD 2x4 SPF No 2(flat) WEBS 2x4 SPF No 2(flat) BOT CHORD Rigid ceiling directly applied or 6-0-0 or,bracing, OTHERS 2x4 SPF No,2(flat) REACTIONS. All bearings 7-0-6. (lb)- Max Uplift All uplift 100 Ib or less atlolnt(s)14,9 except 8=-148(LC 20) Max Grav All reactions 250 Ib or less at joints)8 except 14=274(LC 22),13=312(LC 23),12=308(LC 24), 11=308(LC 25),10=311(LC 26),9=329(LC 20) FORCES. (lb)-Max.Comp./Max.Ten.-All forces 250(lb)or less except when shown. TOP CHORD 1-14=-262111 WEBS 2-13=-281/0,3-12=-27910,4-11=-27910,5-10=-280/0,6-9=-279/35 NOTES- 1)All plates are 1x3 MT20 unless otherwise indicated 2)Gable requires continuous bottom chord bearing. 3)Truss to be fully sheathed from one face or securely braced against lateral movement(i e,diagonal web). 4)Gable studs spaced at 14-0 Do. 5)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift at joint(s)14,9 except Qt=1b)8=149. 6)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 7)Recommend 2x6 strongbacks,On edge,spaced at 10-0-0 oc and fastened to each truss with 3-10d(0 131"X 3")nails. Strongbacks to be attached to walls at their outer ends or restrained by other means OF NEW GAR i�0 >k r W M to N�OA -Al, D800°'N FESS1Q- July 24,2019 Emil Sam A WARNING-verify design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE MII-7473 rev.10/03/2015 BEFORE USE rano j 13ealpn vdrd fm,ttso oo{y twlh I.tiTt:xfJ r4n11e0or_'W1c dcrotnn is br s-cd mly W.,tn paramaL:tR:}itrwir.trod ts'!�v an indlvl6nnl hul`d[itg component,not t a 4ni1s rr?3tum.Route tmo,916 U14619 410011"..mvxl=01 the napllcow:uy of 60011 parnmutera aril propwly lAmpelnfa this onion Into too mmol lyeltdliuldo:lnn l3rccing6i3iratctliatoorovanllnitk>f+rpof,irovldoniinisswabnrld'otchotdmembsnanly:�AdriillgnaliCatlirvrnr/cvadR*tlT�rnenl4mcnq MITe rs idwny3 rc�ort0d tat utalfl7,ly and t4 p+Cvnnt cUAaR=o P;IGt rrslsR7ln paaulrnl u>!bl'ynritt pral4otty lfamatn, For't;anc103 gmdwtce regorpmg itl016023 laFeicstgrt,4tarnpe;dnGvOry,orectren and 61aaro Ct tru�osard busa Wr.,Q"s,60e - -AN8tR-2il quality Crttatia,D&Sir89 and SCSI BUIWIrti®.^'omponent Chesterfield.MO 6301 Rd 541MylnlotJnab9n AvrJahlnrfAm°([lydsRlltrnlRa4°rut^-,?7ahLLeeSttdC4SU110312,Atrsandrin,Vf22a14, - Job: Toss - !Truss Type ------- - --- Qty'" In rt8ysird,View Btilldlbfl Cl a2gd Floor 35979F,3; 137821910 F21 Floor Supported Gable _ Job Rntor'ence o ila`n•til -t A Universal Component Corp., STHAVEN CT 06512 - -- - `'"8,010 s Aug 11 2017 MiTgs Igdgs(rlps,•Inc.Wed Jul 24 16;3,9;49 2019'Page 1 ID-ndlRDAhLEUvQ7PklBgAvyTyugda-tfNBIzGMrBD1U9M15vdr2i0QloDRE3d U7h5hyuoL0 Scale=1.20.1 1.5x3 II ., -., -- - - - - _. ._.,, ,_-- ..._ � - - - - - ---• -- - .... . _, - - --- .. _�. _ � " 1x4 II - 1 30 2 31 3 32 4 33 5 34 6 35 7 36 8 37 9 38 10 p � 11 �_ _ c 3 � 1_ I i ;•- in - ',�n.�.'`�.'�i;>..��_ 4/�_ r.��`P.r-.' ^'a"�_ _'';'yl,�i� fir,4 �^ 1(•�w x's�y e v'vS"'c"',;,`.'*`.. ,�*s v,.,r'.sXn ro '�k' s�+ "�t'•td,�v rrb��"r'r-r��1`...`-rlCRrx;�f'f.'e^y.^.r' 4'.n .'i*i� '�• ��`'�+'.r��"�yy'x• n.y- �s.^;i+i^?.�w�pmN .�� -', x�,r..�+'"xs'i�.��, ...xv-w.w..,r` .x �'+.�;,^.. ',.�"'•-ry�l"k":;��,;,ti"r,� �'•n.'y' .:.1.w.+..�.,- 20 21 19 22 16 23 17 24 16 25 15 26 14 27 13 28 12 29 11 1x4 II LOADING (psf) - SPACING- 2-0-0 CSI. DEFL. in (foc) Vdefl Ud i -PLATES GRIP TCLL 40.0 Plate Grip DOL 1.00 TC 018 Vert(LL) n/a n/a 999 MT20 197/144 TCDL 12,0 Lumber DOL 1 00 BC' 0.19 Vert(CT) n/a n/a 999 BCLL 0.0 Rep Stress Incr YES WB 0,03 Horz(CT) 0.00 11 n/a n/a BCDL 10.0 Code IBC2015/TP12014 Matrix-S Weight;42 lb FT=20%F,11%E LUMBER- BRACING- TOP CHORD 2x4 SPF No.2(flat) TOP CHORD Structural wood sheathing directly applied or 6-0-0 oc purlins, F CHORD 2x4 SPF No.2(flat) except end verticals;- BS 2x4 SPF No.2(flat) BOT CHORD Rigid ceiling directly applied or 6-0-0 oc bracing. u i TIERS 2x4 SPF No.2(flat) REACTIONS. All beanngs 11-11-8 (lb)- Max Uplift All uplift 100 Ib or less at joint(s)11 Max Grav All reactions 250 Ib or less atjoint(s)except 20=275(LC 31),11=274(LC 40),19=310(LC 32),18=308(LC 33),17=309(LC 34),16=309(LC 35),15=309(LC 36),14=309(LC 37),13=309(LC 38),12=309(LC 39) FORCES. (lb)-Max.CompJMax.Ten_-All forces 250(lb)or less except when shown. TOP CHORD 1-20=-263/10,10-11=-263/12 WEBS 2-19=-280/0,3-1 8=-27910,4-17=-279/0,5-16=-279/0,6-15=-279/0,7-14=-279/0, 8-13=-279/0,9-12=280/0 NOTES- 1)All plates are 1x3 MT20 unless otherwise Indicated 2)Gable requires continuous bottom chord bearing, 3)Truss to be fully sheathed from one face or securely braced against lateral movement(i.e.diagonal web),, 4)Gable studs spaced at 14-0 Do. 5)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift,at joint(s)X11. 6)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrentwlth any other live loads., 7)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 oc and fastened to each truss with 3-1 Od(0.131"X 3")nails Strongbacks to be attached to walls at their outer ends or restrained by other means. pV:_NErv' c)" LU` N9.080g1 .�a July 24;2019 ®WARNING•Verily design parameters and READ NOTES ON THIS'AND INCLUDED MITEK REFERENCE PAGE M11-7473 rev.10/03/2015 BEFORE USE' -r 'Qa,10n vpfid for (LitTeld"i+ciinilec+fils;Thio desll rt�lkgac3 rorty upm pammaiar%saovm,tau!is(ai sa frtdfvl+ivai ttWldln�can:liandnf,'Irst• ,aDunsayutdm,Onrareuae,rhabliifdtnga6knofmurt�aNlIappilca66Ny0daolgyriDur�mataraannintote Ptoper0yln rparotgiruad�sagnaaJgfdit ° Mildinpolgn.eroejnmindratadixtgpravant6utldinOMtmfrvtldo114"SwebanaW.:wdmuniUmoeerilAddltatiWth}npaary: dpormdnantisnrlag M{Te(�. _i'sidtvaysrGquired'f:tathfj[qty-anj i?6revgntcob vp 'YiUrpdaciWeptlisGr¢linitityand,0<100,4nd:4"Fortianomlgul4,itmeFoRlding Ora (tl fcailon;dtomgedat` oroctionnndt'uuctnp,ialhns;epPndtrua�synEcma.oa° ANSllTPlfquallgrC4eda,.t2,8.09baid6 SIOulldlnac_omponent 16023Sw1ngleyRidgeRd _Sbfety,ltifolmallatl a'vel�GCin•TrlrtaPfaln6Ltllutd,2t8,N.tgO,Sn(ot SUIto312 Naxuridia Vg;231•i, ) 'Chesibdfetd;MO63017 �-- Qty- '-ply Vineyard View Building D 2nd Floor Job runs - truss Type - 137921911 3597OF3 F22 Floor 10 1 b Reference(optional) — - - - - - -- 8.010 s Au 11 2017eMiT k Industries;Inc. Wed Ju?x7,16.39:50 2019 Pae 1 Urtivetsat CdYnporrent-Corp; EAST HAVEN-CT 06512 - - g o ID ndIRDAhLEUvQ7PIdBgAvyTyugda-MrxZzJH_cULu5JxD(d84bwZWxCTWAdtnD8tEd7yuoLN Scale=1'• r 1.5x3 II 3x6 = 15x3 11; 4x4 =4x4 = 3x6 FP= 1,5x3 II 3x6 = 1,54 II 1 21 2 22 3 23 4 5 24 6 7 25 8 26 9 1 17 15 14 18 13 12 19 11 20 4x4,= 3x8 MT18H FP = 1x4 11- 3x8= 4x4 = 3x8 = 1x4 II -PlateOffsets 4501•$Edgfil I40:Ed6e;0.1 81;I16:Edgell LOADING (psf) SPACING- 1-8-0 CSL DEFL. in (loc) I/deft L/d PLATES GRIP TCLL 40.0 i Plate Grip DOL 1 X00 TC' 0.47 Vert(LL) -0.34 10-11 >566 360 MT2D 197/144 TCDL 12.0 Lumber DOL 1.00 BC 0,53 Vert(CT) -0.43 10-11 >448 240 MT18H 244/190 BCLL 0.0 Rep Stress Incr YES WB 0,31 Horz(CT) 0,03 1 10 n/a n/a BCDL 100 Code IBC2015/TPI2014 Matrix-S Weight 701b FT=20%F,11%E LUMBER- - - ---- --. __r-- -- - --- -- ---- -- - _- BRACING- TOP CHORD 2x4 SPF No,2(flat) TOP CHORD Structural wood sheathing directly applied or 6-0-0 oc purlins, BOT CHORD 2x4 SP 285OF 2,3E(flat) except end verticals, WEBS 2x4 SPF No.2(flat) BOT CHORD Rigid ceding directly applied or 10-0-0 oc bracing. REACTIONS. (Ib/size) 10=82610-24,16=82610-2-4 FORCES. (lb)-Max;,Comp,/Max.Tend-All forces 250(lb)or less except when shown-- TOP CHORD 1-16=-270/0,9-10=-27010,2-3=-2147/0,3-4--214710,4-5=-242 010,5-7=-2147/0,7-8=-2147/0 , BOT CHORD 15-16=011307,13-15=0/2420,12-13=0/2420,11-12=0/2420,10-11=011307 WEBS 2-16=-1483/0,2-15=0/953,3-15=-30210,4-15=-4361166,8-10=-1483/0,8-11=0/953,7-11=-302/D,5-11=-4361166 NOTES. 1)Unbalanced floor live loads have been considered for this design 2)All plates are MT20 plates unless otherwise indicated 3)Provide mechanical connection(by others)of truss to bearing plate at loint(s)10,16, 4)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 5)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 oc and fastened to each truss with 3-10d(0 131"X 3")nails Strongbacks to be attached to walls at their outer ends or restrained by other means. ' W 4 I„ 0.080 y_ July 24,2019 ®wARNING-Veny design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE MI1-7473 rev.10103/2015 BEFORE USE. r Dutllgnval;dfceuse dilly txL'a MiTeY.AsAI}nouXn.7tt`5+ftrslpn is nixed only upon para}naters dhtt4+i.and re for an individual building component,not i (fi d Baan ayslem BefdtttbSd;'the bmitfirs;l dOSlgifRr IauAt vR1�ty the oppilmbillty,of•design pgRimplot9pnd property incorporate this design Into the overall b{r x1p dBJtprl araaing 1n91d--led IS tppiwerilbi7 fntj'nf pividoal Iniss web and/or chard members only.Additional temporary and permanent bracing �M��'O " is always iegwred for slabihry and to prevent collapse with possible"per'sonal injury and property damage,For general guidance regarding the fabrication,storage,delivery,erection and bracing of trusses and truss systems,see ANSIrrPi1 Quality Criteria,DSB-89 and BCSI Building Component 16023 Swingley Ridge Rd Safety Informallon available from Truss Plate Institute,218 N Lee Street,Suite 312,Alexandria.VA 22314; chesterfield,MO 63017 Job, Truss Truss Type--- `= aly -di - Pry lueyatd View Building D 2nd FitiaF 137921912 3 970F3 F23 Hoar A 1 [Jib Reforeiioplional Untvurs_71 Companent Corp., EAST HAVEN"CT 0.8512 - - -' 8:010 a Aug 1120 17 MITch Industries,In u.Wed Jul 24 16:39;512019 Page-1 ID ndlRdAh1.EUvd7PRigg4yTyuqda=g2VrptHcNcjIjTWOD1t(J77ahUcptv4awRocoAayuot M Scale=127,7 1 5x3 if 3x6 = 1.5x3 II 44 = 4x4 = 3x6 FP= 1.50 it 3x6 = 1.5x3 II 1 21 2 22 3 23 4 24 5 6 7 25 8 26 9 - --'_ - t-1 i - -- - ---- 17 15 14 13 18 12 19 11 20 � 4x4 3x8 = 3x8 MT18H FP = 1x4 II 1x4 If 3x8 = 4x4 16.3.8 - Plate Offsets X- 14.0-1_8 Ed5:0j_ ,1.9,Edy>, - LOADING (psf) SPACING- 1-8-0 CSI. DEFL. 1n (loc) I/defl Ud PLATES GRIP TCLL 40,0 Plate Grip DOL 1.00 TC 0,49 Vert(LL) -0,34 10-11 >572 360 MT20 1971144 TCDL 12,0 Lumber DOL 1,00 BC 0,53 Vert(CT) -0.43 10-11 >452, 240 MT18H 244/190 BCLL 0.0 Rep Stress Incr YES WB 0,31 Horz(CT) 0.03 10 n/a n/a BCDL 10.0 Code IBC2015ffP12014 Matr(x-S Weight.70 lb FT=20%F,II%E LUMBER- BRACING- 'r+CHORD 2x4 SPF No.2(flat) TOP CHORD Structural wood sheathing directly applied or 6-0.0 oc purlins, "CHORD 2x4 SP 285OF 2 3E(flat) except end verticals 'BS 2x4 SPF No.2(flat) BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing REACTIONS. (Ib/size) 10=835/0-2-4,16=835104-6 FORCES. (lb)-Max Comp JMax-Ten -All forces 250(lb)or less except when shown TOP CHORD 1-16=-270/0,9-10=-270/0,2-3=-2181/0,3-4=2181/0,4-5---2469/0,6-7=-2181/0,7-8=-218110 BOT CHORD 15-16=011324,13-16=012469,12-13=0/2469.11-12=O/Z`469,10-11=011324 WEBS 2-16=-1502/0,2-15=0/973,3-15---304/0.4-15=462/160,8-10=-1502/0,8-11=01973,7-111=304/0,5-11=462/1160 / NOTES- 1)Unbalanced floor live loads have been considered for this design. 2)All plates are MT20 plates unless otherwise indicated- 3)Provide mechanical connection(by others)of truss to bearing plate at joint(s)10. 4)This truss has been designed for a moving concentrated load of 250,01b live located at all mid panels and at ail panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads 5)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 oc and fastened to each truss with 3-10d(0.131"X 3")nails Strongbacks to be attached to walls at their outer ends or restrained by other means, �oF NE_ - . - * LU NCO.1.0 SI July 24,2019 AwARNINO-Verify design parameters and READ NOTES ON THIS AND INCLUDED MITER REFERENCE PAGE M11-7473 rev,fO/03/2015 BEFORE USE. as Da:.rpn,;4d for use o*wAh LAmea'60i,Upon pnlumetNre It far an lndluiduntbuilditig r,:lrmroncnt,no,t 11 �' a Bunn my6lv+rt BatWd uoo.tho building tlavigndr in u bydrity�d o 0p01pbluly of dnatgn paramulurr:and ruopartyfnce�gar+tic this defl6n)qte i!ia aver;q tn+Ydngdes! grndnpf6dicntediatorrm/enlbuckf6Catllndividaalllns•ti4nboW46iCKwdmeniba+.only._h�ldiilonaltnmporalj m4pumwn0n:brodrsJ M!Tek• iva!ra l'IuqulredteriaobWtyandtnp+dvuntcolla{innroei'pfl slfAipefsonatinjinynddp:opady,damnge.FargenuralpuidnncarannritlnRlhe ! inatPcr+lian,G orag0,delivery;nrutaian and hradrig,af ffumn,and Kiel syale+ref tau ANStRPIt goal ty a[D(dt(a a58�86 ni+d BCS18ulid(na Component 16023 Swingley Ridge Rd sti(uty h+fafnlatlori avallnbra(font Tluss'Pldto fnir8tutd,218 N,Lea Streal:Sprta 12:1�f4xnrddn;YA2z314: — t Chesterfield,MO 63017 Job _ toss - --- Truss Type ply Vineyard View Building D 2nd Floor- ---- 137921913 13597OF3 F24 Floor 3 1 Job Reference(o tl°nall___ -_ _ Carp_. EAST HAVEN CT 06512"- - - 8.010 s Alig 11,2017 MtTek Industries,Ina'Wed�ul Z4 16:39:522019 Page 1 Universal Component I D:ndl RDAhLEUv07PkiBgAvyTyugda-IE3J0_IE86ccLd5cm2AYgC&NoCxebf3gSMLtOyuoLL 1 1x3 II- 12 2 e 13 3 3x3 = 14 4 1x3 II Scale=1:1t ! 4 to i E_I a 1 1x3 II 1x3 {I $ g 7 10 B 11 °- 3x3 3x3 3-1 0 -- -- - _-- •i DEFL. n oc I/deft L/d PLATES GRIP LOADING (psi] SPACING- 1-8-D CSI. ) TCLL. 40,0 Plate Grip DOL 1.00 TC 025 Vert(LL) -0,02 7-8 >999 360 MT20 197!144 TCDL 12.0 Lumber DOL 1.00 BC 0.26 Vert(CT) -002 7-8 >999 240 BCLL 0.0 Rep Stress Incr YES WB, 0.04 Horz(CT) 0.00 5 n/a n/a Weight 19 lb FT=20%F,11%E BCDL 10.0 Code IBC20151TP12014 Matr-a-S - ._ - ,_ - _ LUMBER- --- -^ BRACING- TOP CHORD Structural wood sheathing directly applied or 3-11-0 cc pudins, TOP CHORD 2x4 SPF No.2(flat) except end verticals. BOT CHORD 2x4 SPF No.2(flat) BOT CHORD Rigid ceiling directly applied or 10-0-0 cc bracing. WEBS 2x4 SPF No.2(flat) REACTIONS. (lb/size) 8=196/Mechanical,5=19610-2-4 Max Grav B=320(LC 7),5=320(LC 11) FORCES. (lb)-Max,CompJMax.Ten.-All forces 250(lb)or less except when shown,, TOP CHORD 1-8=261/5,4-5=-261/5 WEBS 2-8=-261/0,3-6=261/0 NOTES- 1)Unbalanced floor live loads have been considered for this design. 2)Refer to girder(s)for truss to truss connections, 3)Provide mechanical connection(by others)of truss to bearing plate at)oint(s)5. 4)This truss has been designed for a moving concentrated load of 250 Olb live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 5)Recommend 2x6 strongbacks,on edge,spaced at10-0-0 cc and fastened to each truss with 3-10d(0.131"X 3")nails Strongbacks to be attached to walls at their outer ends or restralned by other means. p�NES_ * A g July 24,2019 AND INCLUDED MI7EK REFERENCE PAGE MIF7479 rev.101031201S aEFOREUSE. ®WARNING-verity design parameters and READ NOTES ON THIS tqn vifid tar ucrl Qaty tailh M.Few emtiL^rlarF:.7f�aua^1gn kn busbd'nN)'upon pnramctwslMown,undls.tor no incfi9dust"ding awnponeni,not, a OuseCyxlom.8afottavac:thatitntatOt!<vJanalniti€taonNUlu aripucuhi;ty"ofdall¢nripmmohdr* tpravpfiyl+idmporotatldvtluel®ntntt� t4>w�nr pig ;Ov}idtttpdrupn.Brtic�+jriitdiaafauif;taptevanl4urkruipnl 1g1v1duMu�we6andfar.elmtdmom�tltsonty Add}Ilonp11co7�xAyarlflparrprnont,prar]ryp � 11I,6T��(� , L56tvmy�roryrlErotltar nLollityand to;¢trrvant cllpn©+t,++1}I1Dsr3afltePsisa�nl njury,and P!apoAyBnrnatps.-FMsr�eimrstpntrancereud+dinggta_. ,. 1a6ztcawcn rYorn4e deCruoN.p[eavanandtlracirrppi4u:e33t185aia�sayplrntill ANSilTp)1S"ual.ry`Criterjo DS8996ddeG518uttdEnBComponent 160235wld.IAO 3017 ChesleAleld,M063077 j 'Salety lnrormntlan avallobta 1talJt"rNEn plata lnstltd.d.218 N:Loa'Stn0,'SWta312:Attw4'ogQrla,,VA1?314, -- S_qN, cuss, Truss Type - - —-- ";Qty " Pty 'Vineyard Vrew Building D 2nd Floor c ` 137921914 35970P3 [F25 Floor 8 1 Job RQflnce to tionall Universal Component Corp„ EAST ttAVEN CT 06512 ` - ---^ -" 8,010 s Aug 11-2017 f l ffek Industries,,Inca'4V'ed JO 24 16:39'53 2019 Page 1 ID.ndIRDAhLEUvQ7PkiBgAvyTyugda QdrbKJsvPkTynfoKlhnDYB11QUDN_aDv65uE5yuoLK / Scale=1:27.8 1Sx3 li 3x6 = 1,50 II 4x4 = 4x4 = 3x6 FP= 1,5x3 II 3x6 = 1.5x3 II 1 21 2 22 3 23 4 24 5 6 7 25 8 26 9 �- --- - 4.: - -. - o - T 17 15 14 13 18 12 19 11 20 0 4x4 3x8 =3x8 MT18H FP = 1x4 II 1x4 11 3x8= 44 tfr'3-t} r - - 16-3-0- -- - _- _ -- - -plffte:OtfsetS(XC,Y)-- (4:0?1 8,Ed4ej:�5:01 9,Ed9y it nsaae 0 1.81 J1fi:E�e.03$�_ _- - - LOADING (psf) SPACING- 1-8-0 CSL I' DEFL- in (roc) I/deft L/d PLATES GRIP TCLL 40,0 Plate Grip DOL 1.00 TC 0,48 Vert(LL) -0.34 15-16 >571 360 MT20 197/144 TCDL 120 Lumber DOL 1110 BC 0,53 Vert(CT) -0.43 10-11 >451 240 MT18H 244/190 BCLL 0,0 Rep Stress Incr YES WB 0;31 Horz(CT) 0.03 10 n/a n/a BCDL 10.0 Code IBC2015/TP12014 Matrix-S Weight:76 lb FT=20"/oF,11%E LUMBER- -Y BRACING- CHORD 2x4 SPF No,2(flat) TOP CHORD Structural Wood sheathing directly applied or 6-0-0 oc purlins; CHORD 2x4 SP 285OF 2 3E(flat) except end verticals: —.3S 2x4 SPF No.2(flat) BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing REACTIONS. (Ib/size) 10=83310-4-6,16=833/0-2-4 FORCES. (lb)-Max CompJMax.Ten.-All forces 250(lb)or less except when shown TOP CHORD 1-16=-270/0,9-10=-270/0,2-3=-2173/0,3-4=2173/0,4-5=-2458/0,5-7=-2173/0,7-8=2173/0 BOT CHORD 15-16=0/1320.13-15=0/2458,12-13=0/2458.11-12=0/2458,10-11=0/1320 WEBS 2-16=-149810,2-15=01968,3-15=304/0,4-115=456/161,8-10=-1498/0,8-11=0/968,7-11=30410,5-11=456/161 NOTES- 1)Unbalanced floor live loads have been considered for this design. 2)All plates are MT20 plates unless otherwise indicated. 3)Provide mechanical connection(by others)of truss to bearing plate atfoint(s)16,- 4)This truss has been designed for a moving concentrated load of 250.O1b live located-at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 5)Recommend 2x6 strongbacks,'on edge,spaced at 10-0-0 oc and fastened to each truss with 3-1 Od(0.131"X 3")nails Strongbacks to be attached to walls at their outer ends or restrained by other means- _ n W; LJ 0� ssrQNP July-24,2019 ®WARNING,-Verify deslgn parameters and READ NOTES ON THISAND INCLUDED MITEK REFERENCE PAGE MII.7473 rev.10103/1075 BEFORE USE -��_ E Oax?gnvuAdfor„u;oc7rtytdrthBtTekgcprjnaMom:lh?edrSlgiisku!!ilctityiippnparumrtCrsshaV!L nA,1SWranlgtkifduelliinldary`camporant,not, prut �v ;dttuesdy tan Salon, n,U?p0uldingdoal'y+ratrntwty'u?Iry,pioanp8'abiltlyefriocJOn smotursand *VIiimgroratolotzrtuii8nintotnaovomIT it 4 Ira11d(ipdan•Otaafng dkntadiiluPre!4plbtrrpporlgdtiduptuuss=rnrigndlA,frtsatJ,mmtir+C.ftr�y:hdaplon3tlatrilxr�zYpndpurmenaatGrnabp ®1 , is rdwuyp(agalrwf(w efhlY a u!tit gaa4nnt alape JEuipnsut6ta paisouPl kyvrynnd pr4pertyddmaga'Far gaperatgdnncn ragardln'p,Ihv :febi/cotron,ators�o:dal(mr�ares?ton rind brodnj aftrdssaa apdtrusaayaiems;ear. ' ANStr-EPI1 Qanlitq Cilt!rla,_D$t1.8.8 a1td,RC51 Bullding Component 16023 Swingley FLdga Rd Snfntytn(aematl4n u4a7aWtiugm7russPtatnlnnUlulo,2t&H.LeaStrookShcle 312,Atoxnndtla,VA22314,- chesterfield, 63017 Job Truss Trvss Tyra Qty Pty Vineyard Vlew Budding D 2nd Floor 137921915 3587flF3 F26 FLOOR 8 1 Job Reference(ootionall 8.470 s Aug 11 2017 MiTek Industries,Inc, Wed Jul 24T65-6:54 2019 Page 1 Universal Component Corp.. EAST HAVEN CT 06512 ID ndIRDAhLEUvQ7PkiBgAvyTyugda-EdB4ogKVglsJaxE7uTC01mjC3ps36STMBmrSnvyuoLJ 2-6-0 0-11-14 Scale=1" 1x3 II 44 = 1x3 II 1x3 II 4x4 = 1x3 II 1 14 2 15 3 16 4 17 - 5 18 6 ! 11 9 12 8 4x6 II 13 7 ,1 M 4x6 11 4x6 11 4x6 11 11•;-14 - - — 11-5-14-" Plate Offse_Iss XM.- (8:0-3.0,Eda :0.3-0.Ed e LOADING (psf) SPACING- 1-8-0 CSI. DEFL. 'in (loc) I/dell Ud PLATES GRIP TCLL 40.0 Plate Grip DOL 1.00 TC 047 Vert(LL) -016 9-10 >853 360 MT20 1971144 TCDL 12,0 Lumber DOL 1 00 BC 0,43 Vert(CT) -0.19 9-10 >707 240 BOLL 0.0 Rep Stress Incr YES WB 0,21 Horz(CT) 0.01 7 n/a n/a Weight 571b FT=20%F,11%E BCDL 10.0 Code IBC2015/TPI2014 Matrix-S — LUMBER- BRACING- TOP CHORD 2x4 SPF No.2(flat) TOP CHORD Structural wood sheathing directly applied or 6-0-0 oc purlins, BOT CHORD 2x4 SPF No.2(flat) except end verticals: WEBS 2x4 SPF No,2(flat) BOT CHORD Rigid ceding directly applied or 10-0-0 oc bracing REACTIONS. (Ib/size) 10=5B7/0-2-4,7=587/Mechanical FORCES. (lb)-Max:Comp.lMax Ten -All forces 250(lb)or less except when shown: TOP CHORD 1-10�270,(0,6-7=-270/0,2-3=•129610.3-4=-1296/0,4-5=-1296/0 BOT CHORD 9-10=0/904,8-9=011296,7-8=0/904 WEBS 2-1 0=-1 01 510,2-9=0/487,5-7=-1015/0,5-8=01487 NOTES- 1)Unbalanced floor live loads have been considered for this design 2)Refer to girder(s)for truss to truss connections. 3)Provide mechanical connection(by others)of truss to bearing plate at joint(s)10. 4)This truss has been designed for a moving concentrated load of 250,01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 5)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 oc and fastened to each truss with 3-10d(0 131"X 3")nails Strongbacks to be attached to walls at their outer ends or restrained by other means. pF N E ,• GA&C,�O'9 w 016 0.980v ROFESS1 July 24,2019 ®WARNING-Venry design parameters and READ NOTES ON THIS AND INCLUDED M/TEK REFERENCE PAGE MY-7473 rev.10/03/2015 BEFORE USE. � Mlian'.ulnl fur nr+1 only with h17¢ u+nnectcus.11ux+l+ra!On ty I:nind witty upon p=matorn sho-&j,vnd 14!bran Individual lwdr5n9 cQ111parI¢p1.1101 n uu8 oys!dnl,0ufu!o re,tho W+WiQp"da54jnaa masa vend)Wo npp4enhtGly,of dUe13a pnramafara mid propnrty mcolpofale his AIL-Mull hta tri¢avarall butldinp daatpn,Qrran0inglcdnd lit to pid'rr 1 bt c drip of Fritr6vedunl tnru,vnLe rid oLehori!maalWJr6 ordy,AddfUohol trihparary and twrmG-,eal txarinQ is¢Fvayn r¢:tuhnd lorSNt+Itlly and W�tnvent g910pnn'm;Rr pasrl!!!o(crsgn¢f lnlury and prn3mn3'd0rn¢Un,ror Onndrai pd4ilnncrteannlln0 ilia fagncn}{on,s`.o+apo,deLvor,efucllongndL;.e4s)Crlltri7M sdansssyn!sme.nttU MtSiRPlitivaAtyCrllarla,S16873(iandnC518Nld1npComp¢nant 160235ield,M 63017d Sololy InfortndUon +<+v0tln o fmm 7n+su flnlu Irallturo,'.18 N,Lao Str¢dLSu�Jo 112,fdoxan -VA 2R'314, �� Chesterfield,MO 63017 Job Truss Truss Type - Qty T p Ifneyanl View BulidIng D 2nd Floor" -uc ; I 1379221910 35970F3 F27 FLOOR --- - - lJobAeforence antionatl' Universal Component.gpPik, EAST HAVEN CT 06512 - _ - -"8.010 s Aug.11,2017 MIII industries,Inc:Wed Jul 2416:39:55 2019;Pafp 11 ID ndIRDAhLEUvQ7PkIBgAvyTyugda4pkS00K7R1 AC4pBSA1FIzGNpDCGrvIWMPa7JLyuoLl 2-6 0 - ( 1-0-6 Scale=1:18,6 1x3 ]I"-- 4x4 = -1x3 II -"1x3 II ,.., 44= = c 1x3 II - 1 14 2 15 3 16 4 17 5 18 6 IT -- --- - m 1 11 9 12 8 46 11 13 7 46 II 46 11 4x6 11 it `._ _�_--_- _. _._ ---- -----'-- --'— - _ .21•Q•6 - � P/_ilio Off5c4 xr., i- a:Er-3 0,E-ele# LOADING (psf) SPACING- 1-8-0 CSI. 1 DEFL. `fn (loc) I/defl L/d PLATES GRIP TCLL 40,0 Plate Grip DOL 1,00 TC 0.47 I Vert(LL) -016 7-8 >849 360 MT20, 197/144 TCDL 12.0 Lumber DOL 1.00 BC 0.43 Vert(CT) -019 7-8 >704 240 BCLL OA Rep Stress Incr YES WB 0.21. I' ' Horz(CT) 0,01 7 n/a n/a BCDL 10,0 Code IBC2015frP12014 Matrix-S ` Weight-57 Ib FT=2b%F,11%E LUMBER- BRACING- -)CHORD 2x4 SPF No,2(flat) TOP CHORD Structural wood sheathing 81rectly applied or 6-0-0 oc purlins, f CHORD 2x4 SPF No2(flat) except end verticals, 3S 2x4 SPF No,2(flat) BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing REACTIONS. (Ib/size) 10=58910-2-4,7=589/Mechanical FORCES. (Ib)-Max,Comp./Max Ten.-All forces 250(lb)or less except when shown. TOP CHORD 1-10=-270/0,6-7=-270/0,2-3=-1304/0,3-4=-1304/0,4-5=-1304/0 BOT CHORD 9-10=0/906,8-9=0/1304,7-8=0/908 WEBS 1_57=1 020/0,2-10=-1020/0,5-8=0/490,2-9=0/490 NOTES- 1)Unbalanced floor live loads have been considered for this design 2)Refer to girder(s)for truss to truss connections. 3)Provide mechanical connection(by others)of truss to bearing plate at iolnt(s)10 4)This truss has been designed for a moving concentrated load of 250.O1b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 5)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 Do and fastened to each truss with 3-10d(0,131"X 3")nails. Strongbacks to be,attached to walls at their outer ends or restrained by other means. X. ?v N GAr, ` °08Q4�� i� - - ��fiESS10�'t'• July 24,2019 'A WARNING-Verify design parameters and READ NOTES ON THIS AND INCLUDED MITEtr REFERENCE PAGE 4410473 revs 10/03%2015 BEFORE USE. i Anaignv�rWforuco,t�l Vt6httie� mnnestatsjhlgdalttjn Uasattotdyuglpaititic ra-stiIii and l%WsnlndlvfdudbitWl( cgmjxl""Inot. ! liQuaEay5lntje-Pn1wauda:thebulldmpdaslgrdrmv5tvndryStnnMtQtabiGtyo!darlgnp^arndtarsandpropatlyinaqrporafathla'#IAI (niaQrnavnraR. �nFbot bu�din9,t[gslprF,t3n�lnfllridir,5lad(atgpravQnt67 dlinpatllndlvidunfttuasweb P"dfardwilmamharrv- ,Wt.AddiQnn9l,yctntxuaiy`atdop".iimlbraOfj eV1�i3OW' lu mays{yg ta'�LLLC;d tbt atahTtlJrl+ull6 ptevt:H�t uk7t c'.Klii po9'S1br0 t�rs0iiffl lnjUrY and 00parfy`dgm-te F&gomful guidan"t09-oft f,lh0•, LibQanQon alcaq o;dahWOey;ai0sllen'and brnein3 of uu&as00nd,nusay:dm5,sea ' ANSftTPit quglit_y`Ct{t0tta.BS6 89atid_BC$I Balltdtt,p Component t 16023 Svnngley Ridge Rd Snfuty falOfmnUsn:7yallAoein ffoan YTUII PIW 105tdntd.:$1a N Leo`firadl Suis 912,ArnxHMllin VA'22314: -' --^ -^_' -`- _ _ Chesterfield,MO 63017 Job -;Truss Truss Type QtypN Vineyard View Building D 2nd Floor 137921917 ' 3597OF3 F28 FLOOR 31 Job Reference(optional Unlversa(Component Corp., 'EAST HAVEN CT.06512 8,010 s Aug 11 2017 MttTvk Industries,Inc.Wed Jul 24'1[8:311.67 2019 Page 1 ID ndIRDAhLEUvQ7PkIBgAvyTyugda-eCsCRIMNyeEUROzaZbmlNOLhWlivJINpgi36NDyuoLG 1-1-8 r 1-7-5 0-He Scale=1.2 i 2x4 11 1.5x3 II 44 = 1.5x3 li 1,50 II 4x8 = 30 II 412 = 1,5x3 = 1 19 2 20 3 21 4 22 5 23 6 24 7 25 8 14 `!� 1 �-- [ 1 .•- 15 12 16 11 17 18 9 46 II 4x6 II 6x6 = 6x10 = 6x8 = 11-7.8 11 I 11-7-8 4 4's 4-4 - Plate Offsats[X.XI- 16:0-1-8,Edge]z[41.0-1-81Edge1 1[ 2:0-3.0 Edpe ----------- - ----- LOADING (psf) SPACING- 1-8-0 CSI. DEFL. in (loc) Ildefl PLATES GRIP TCLL 40.0 Plate Grip DOL 1.00 TC 0.5B Vert(LL) -016 12-13 >879 36600 MT20 1971144 TCDL 12.0 Lumber DOL 1.00 BC OA9 Vert(CT) -0 21 12-13 >647 240 BCLL 010 Rep Stress Incr NO WE 0.58 Horz(CT) -0.01 10 n/a n!a Weight 82(b FT=20%F,11%E BCDL 10.0 Code IBC2015rrP12014 Matrix-S _ -, LUMBER- BRACING- TOP CHORD 2x4 SPF 2100F I AE(flat) TOP CHORD Structural wood sheathing directly applied or 6-0-0 cc purlins, BOT CHORD 2x4 SPF No.2(flat) except end verticals. WEBS 2x4 SPF No.2(flat) BOT CHORD Rigid ceiling directly applied or 6-0-0 oc bracing. REACTIONS. (Ib/size) 13=213/0-2-4,10=222610-3-8 Max Uplift 13=172(LC 4) Max Grav 13=460(LC 3),10=2226(LC 1) FORCES. (Ib)-Max.Comp,lMax.Ten -All forces 250(lb)or less except when shown. TOP CHORD 1-13=-26712.8-9=-B92I0,2-3=-73.7/1180,3-4=-73711180,4-5=-737/1180,5-6=0/3325, 6-7=013323 BOT CHORD 12-13=-4841641,11-12=-1180!737,10-11=-2248!28,9-10=-1871/0 WEBS 6-10=-30112,2-13=-7211544,5.1 0=-1 87410,2-12=-782/149,5-11=011496,4-11=-334!0, 7-9=0/2060,7-10=-181410 NOTES- 1)Unbalanced floor live loads have been considered for this design, 2)Provide mechanical connection(by others)of truss to bearing plate at joint(s)13 3)n/a 4)This truss has been designed for a moving concentrated load of 250.0Ib live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 5)Recommend 2x6 strongbacks,on edge,spaced at lM-0 oc and fastened to each truss with 3-10d(0.131"X 3")nails. Strongbacks to be attached to walls at their outer ends or restrained by other means 6)CAUTION,Do not erect truss backwards LOAD CASE(S) Standard 1)Dead+Floor Live(balanced).Lumber Increase=1.00,Plate Increase=1.00 GJ- Uniform Loads(plf) _ � Vert 9-13=-17,1-8=-87 r ixrlcc Concentrated Loads(ib) rcW � Vert'8=-800 (� P��w��t::�.1, t +•mlo) fig.0800 iN ARPSs1GN��. July 24,2019 ®WARNING-Verify design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE Mll•7473 rev 10/03/2015 BEFORE USE r ! Oa:{;1 valid fc=use a�ly vett MRa}xpcan Os fir 71da dosJn is tas5ed cdiy upon pummatcra�hovm,and l5 for on InOMOUDOUNTM cami+on0nl,not a[nrs;.myslam pofsrausa,lhalrulidinlyd[is70rrnr,mug;4,ilfffylhaapcillwbJdyofdaiilOnpir3rnutfii8 r;17ptopanylA>:tapatattclhfaAesipnkita!!zilolti 4l Mf1ei lntlfdfnpOb:ltlta Einar=+lGb7"�"V'lndHr^f�rrc^lhi�'4s.�n�3rfllasrhia!¢vLpvrGSfindfmchmdllAhmtHEtnw.Illy.,f�Jd;1IriMllnnfpomrynildlmnnaOROltamdrl0 h ddfiia fei{u4ad fa O1Dlritity d 10 proven!co4apsavith porlajblp"peroanni iNm and propprty o0mngo.Fon genre!Auidarxn ragarz';.e fnlat-1913n,a!y-tary0.da6gery,ormttlonond(ifadrtq of huaav:find truss?yatanta,Ica ANS(RPI1 Quality Cdfafl5,DSB.a9 and[1051 t1u11dIPp Component I Chest Swid,N Ridge Rd Snfaty inlurmnt{on avo9tlLLia irom 7n+ca Pf,1fa ln:tYiulp,218 N,Lae.Spaat;SzlN©312,7daxandria,YA=231.1. _��_�--�i ChesteAleld,NO 63017 Y ' i Job - russ-- - Truss Typ— Oty Ply t6b'Rel'ordi ineyard View Sulldin l D 2nd Floor 137921918 597OF3 F29 Floor Supported Gable 1 1 isrLgip«aual) - ard Tra96ornponent Corp.; --EAST HAVEN'CF011512 8.020 s Aug 11 2017 MiTek Indusbtas,Ii Wed Jtil 24 16:39!59 2029"Page 1 IDalcllRDAhI EUvQ7I?kiBgAvyTytntiiD ba zsOOduFUca_{7yhOd9SpR8Ggd0nmX5K1YDS6yuoLE 0-N8 I Scale-1:26.6 1 41 2 42 3 43 4 44 5 45 6 46 7 47 8 46 9 49 10 50 11 51 12 52 13 28:ikP' �e a. -z ;,sv:^'«_�._1n�'s x e',P'.•''�'•i..S'_`/i'i w'.t`X•.e:£`i w"v �`s...i'1:°r' /;s�l't -'n'�'c'v-;�� _ >r-:.-. "' a<._-;',•. 27 29 26 30 25 31 24 23 32 22 33 21 34 20 35_ 19 36 18 37 17 38 16 39 15 4D 14 3x6 FP= 3x3 = MI6-1.6 LOADING (psf) SPACING- 2-0-0 CSI. DEFL. In (foc) f/defl L/d PLATES GRIP TCLL 400 Plate Grip DOL 1.00 TC 0.18 Vert(LL) n/a n/a 999 MT20 197/144 TCDL 12.0 LumberDOL 1.00 BC 0.19 Vert(CT) n/a n/a 999 BCLL 0.0 Rep Stress Incr YES WB 0.03 Horz(CT) 0,00 14 n/a n/a BCDL 10.0 Code IBC2015/TPI2014 Matrix-S Weight:56 lb FT=20%F,1I%E LUMBER- - BRACING- - - TOP CHORD 2x4 SPF No.2(flat) TOP CHORD Structural wood sheathing directly applied or 6-0-0 oc purlins, CHORD 2x4 SPF No,2(flat) except end verticals is 2x4 SPF No.2(flat) BOT CHORD Rigid ceiling directly applied or 6-M oc bracing. IERS 2x4 SPF No.2(flat) REACTIONS. All bearings 16-1-6, (lb)- Max Grav All reactions 250 Ib or less at{oint(s)except 27=276(LC 40),14=276(LC 52),26=309(LC 41),25=309(LC 42),24=309(LC 43),22=3D9(LC 44),21=309(LC 45),20=309(LC 46),19=309(LC 47),18=309(LC 48), 17=309(LC 49),16=308(LC 50),15=311(LC 51) FORCES. (lb)-Max.CompJMax Ten.-All forces 250(lb)or less except when shown. TOP CHORD 1-27=-263/10,13-14=-259/12 WEBS 2-26=-280/0,3-25=-279/0,4-24=-279/0,5-22=-279/0,6-21=-279/0,7-20=-279/0, B-19=-27910,9-18=-279/0,10-17=-279/0,11-16=279/0,12-15---280/0 NOTES- 1)All plates are 1,5x3 MT20 unless otherwise indicated, 2)Gable requires continuous bottom chord bearing. 3)Truss to be fully sheathed from one face or securely braced against lateral movement(i.e.diagonal web). 4)Gable studs spaced at 14-0 oc. '5)This truss has been designed for a moving concentrated load of 250.Olb live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 6)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 oc and fastened to each truss with 3-10d(0.131"X 3")nails, Strongbacks to be attached to walls at their outer ends or restrained by other means._ 7)CAUTION,Do not erect truss backwards. OF NS 0. w to I EMU July 24,2019 WARNING-Verity design parameters and READ NOTES ON THIS AND INCLUDED MtTEK REFERENCE PAGE MII.7473 rev.10/03/2015 BEFORE USE rs y DaJgn vafd'tM 15a only Il>t4#nr cannuucc�Ttda'delFgn a hacsd only utroA n rromatarxshovn.and t9 (pest)(ndivrdunl hum.g wmponep4 not n Ima3 aystmm.Bofaro uG4 iho hu0dtnq ileyp�rmugt ytvrty too applirzdul4ty ordomgn parnmeinrt and�apmly fircoriramia thy.datfgn into 1Ro'oa�erau tllnldll}u'Cdsf®p.(itacJng f9ltl`uJllCd l4 fa{S#L•Valltt ,rrlp'ot{I{diylduaf ll'USS KMiS LndraYChard'IhenlMSm eftly.Addlrtlh3l tampCraryanr�pafm0lWY5t bracing Mel( it otviniya tequirod tot ntut:ildy and,fdr:event ca'fnp:a Veth,pa ptRe parEonaf Injury and pioperty damage,For general guidance regardmg the intuicmlan.statag%dell%aty,et&timn;urd ktata:vul uus�snnd ouStS)-31vgtm,ice ANSIrTPl1 Quality Criteria,DSB-69 and 8CS1 Budding Component _ 16023 Swmgley Ridge Rd Snfatq Inlormntltm'a3allilhia ttom TNrs Pi6fe ipi&ittuta,S18 ft.tee_Slraol.Saktn 312,Alexandda,VA 22314, Chesterfield,MO 63617 -.3 sties — Tniss Type Qty PN Vile grd;View Building D 2rfd;Flcxa' - ---137921919 35970F3 F30N Floor 6 1 Univarsat Cotapanent'Gurj1; EAST HAVEN"CT 06512 8.010 s Aug 11 2017 MiTek Industrles,IoD.-Wed Jul 24 16 40'01 2019 Page 1' ID.ndl RDAhLEUYQ7PkiBgAvyTyugda-Xz61G3PuotkKw7HLoRgfXEWODeD5FcdOIL1 KW4yuoLC 2-6-D 3-1 Scale=1 1,5x3 II 3x6 = 1.5x3 II 44 =44 = 3x6 FP= 1,5x3 11 3x6 = 1;5x3 II 1 21 2 22 3 23 4 5 24 6 7 25 8 26 9 f __• --- 17 15 14 18 13 12 19 11 20 4x4 =' 3x8 MT18H FP = 1x4 11 3x8 = 4x4 =, 3x8 1x4 ll -- -- -- - - _�._------- - -- ._.. - - - -16.0.1 ,_- -.. •- - -_._t_------ -- - - - - Plate (X 1'3� 'I4 O=1-B,Edge� I5;1.8.Edge� iEEO a,fl-1.6 ) DEFL. in (loc Ildefl Ltd ! PLATES GRIP LOADING (psf) SPACING- 1-8-0 CSI; TCLL 40 0 Plate Grip DOL 1.00 TC 0,47 Vert(LL) -0.34 10-11 >565 360 MT20 197/144 TCLL 12.0 Lumber DOL 100BC 0,53 Vert(CT) -0.43 10-11 >447 240 MT18H 244/190 BCLL 0.0 Rep Stress Incr YES WB 0.31 Horz(CT) 0-03 10 n1a n/a Weight 70 Ib FT=20%F,11%E BCDL 10.0 Code IBC2015ITP12014 Matnx-S - ^— --- - -- _- BRACING- LUMBER- thing directly applied or,6 0-0 oc purlins, - TOP CHORD 2x4 SPF No.2(fiat) TOP CHORD Structural wood Shea BOT CHORD 2x4 SP 2B511F 2.3E(flat) except end verticals WEBS 2x4 SPF No.2(flat) BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing REACTIONS. (Ib/size) 10=824/0-2-4.16=824/0-2-4 FORCES. (Ib)-Max Comp./Max.Ten.-All forces 250(lb)or less except when shown. TOP CHORD 1-16=-27010,9-10=-27010,2-3=-213810,3-4=-213810,4-5---240810,5-7=-213810,7 B=-213810 BOT CHORD 15-16=011303,13-16=0/2408,12-13=012408,11-12=0/2408,10-11=0/1303 WEBS 2-16=-1479/0,2-15=0/948,3-15=30210,4-15=430/166,8-1 0=1 47 910,8-11=0/948,7-11=302/0.5-11=430/168 NOTES- 1)Unbalanced floor live loads have been considered for this design. 2)All plates are MT20 plates unless otherwise indicated_ 3)Provide mechanical connection(by others)of truss to bearing plate at joint(s)10,16., 4)This truss has been designed for a moving concentrated load of 250.Olb live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 5)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 oc and fastened to each truss with 3-1 Od(0.131"X 3")nails. Strongbacks to be attached to walls at their outer ends or restrained by other means. Lu tu Fess July 24,2019 + A WARNING-Verify design parameters and READ NDTES ON THIS AND'INCLUDED MITEK REFERENCE PAGE MI1-7473 rev.1010312015 BEFORE USE I ~ n mmotnrasho+6 diddd is SIX,an lvl$flildo i bm1din Cort mionen%not, �* t'd4`"..1-0tt t77d`d;{ArVfU Only N1,Ih MiTek3lcamlua`ars,?14h eoispit,is llaSrd iQ7lIY f+e mvusaayaioin,,:ttufdioaau:lfiahvitcn6ifaa)�rurmuat ntyIncrappSiyphifdyufdonlpnpammmtamx+ndpvepmtyfncarWumle_')war, sld'inlnShQuyaralcing t1UIIdI0pd08fpd,tlta�nplRlllculydfsfnptd70ttttnic61111p1�intll4ldutilt4{5s_awftiatfdlatt9kotd"MOmbLrsfifol�:•�lldltidrialtampatary4rtdp0iNW10nthrecing It 'i9 niwfly$+mluUdd 101 sl0tliiltyd711d t9 p10VOtd eoAopao with pd9sl�Ta pRrcanOf lnjuryand props�d54�p`t aF$fgenCArenUa,IDSB•9 and SCSI Building component t 16023 Swingiey Ridge Rd fdE,Ii fi fon,ai57mgc:doL'vaty',b+i Iii:t'✓no+`3 Gr:L's� ub U». syE.Cstit.SSe hJ Chesterfield,MO 63017 a5drdiylnfomiafron aVRitallotiam7russ'Aiotctcsllule;21814:'L�&VC01,`Sa!k7312,Alexandna,VA22314. � _¢ �mm�� Job Truss Truss Type Qty PIy Vineyard View Building D 2nd'Floor - - 137921920 ,35970F3 F31 FLOOR 3 1 4 Job Reference(opttonail Universal Component Corp„ EAST ryAVW CT-06512 1.010 s Aug 11 2017 MITek Industries,-Inc.Wed-Jul 24 10:40.02 2019 Page i- I D:ndi RDAhLEUvo7PkiBgAvyTyugda-79f5UPQWnAsBX9rXM8Mu4S3YL2a4_dYz7nt3RyuoLB 2-6-0 I 1� 1-6_ 14 0-N6 Scale=1.27.7 - 2x4.11 15x3 11 4x4 = 1.50 11 1.50 II 4x8 = 3x3 II 4x12 = 1,5x3 = 1 21 2 22 3 23 4 24 5 25 6 26 7 27 8 16 - -- �--;---- - - _ _ 17 1g 17 14 18 1312 -- -- -- 19 - 11 - --'-__ 20 9 c 4x6 11 4x6 11 3x6 FP= 3x6 FP= 6x10 = 6x$ _ 6x6 = I - - 71,7.8 - - - - X11,8.0_ 16.4•Td - -- "t -11.7.8,_ Plate.OHSefs(XA) 8f '4-1=8 Ed e L 12:4:-6 Edget,[14:0-3 O,Ed e - - _ - -- ---- -- - - LOADING (psf) SPACING- 1-8-0 CSI- DEFL. in (loc) I/deft Ud PLATES GRIP TCLL 40,0 Plate Grip DOL 1.00 TC 0.58 Vert(LL) -0.16 14-15 >879 360 r MT20 197/144 TCDL 12.0 Lumber DOL 1 00 BC 0.49 Vert(CT) -0.21 14-15 >648 240 BCLL 0-0 Rep Stress Incr NO WS 0.58 Horz(CT) -0 01 10 n/a n/a BCDL 10.0 Code IBC2015/TPI2014 Matrix-S Weight.81 Ib FT=20%F,11%E LUMBER. BRACING- -- )CHORD 2x4 SPF 210OF 1 AE(flat) TOP CHORD Structural wood sheathing directly applied or 6-0-0 oc purlins, f CHORD 2x4 SPF No,2(flat) except end verticals. 9S 2x4 SPF No.2(flat) BOT CHORD Rigid ceiling directly applied or 6-0-0 cc bracing, REACTIONS. (Ib/size) 15=217/0-2-4,10=2218/0-3-8 Max Uplift 15=167(LC 4) Max Grav 15=462(LC 3),10=2218(LC 1) FORCES. (lb)-Max.Comp./Max Ten.-All forces 250(lb)or less except when shown, TOP CHORD 1-15=-267/2,8-9=-892/0,2-3=-743/1161,3-4=-74311161,4-5=-74311161,5-6=013288, 6-7=013286 BOT CHORD 14-15=-4751644,12-14=-1161(743,10-12=-2218/38,9-10=-187010 WEBS 6-10=-300/4,2-15=-724/534,5-10=-186410,2-14=-771/153,5-12=0/1485,4-12=-332/0, 7-9=0/2058,7-10=-1784/0 NOTES- 1)Unbalanced floor live loads have been considered for this design. 2)Provide mechanical connection(by others)of truss to bearing plate at joint(s)15. 3)n/a 4)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 5)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 cc and fastened to each truss with 3-10d(0 131"X 3")nails. Strongbacks to be attached to walls at their outer ends or restrained by other means 6)CAUTION,Do not erect truss backwards ()F-NE LOAD CASE(S) Standard 4 GAR y0- 1)Dead+Floor Live(balanced):Lumber Increase=1,00,Plate Increase=1,00 CO %y+ Uniform Loads(plf) Vert'9-15=-17,1-8=-87 * 4 {7 Concentrated Loads(lb) r € .,1 - , [[ Vert 6=-800 ('y ; , t,) w ,�' �_,may ► 1L 7: .etotu�Z'`7 lf►��a �O-D04�1C? SSId � July 24,2019 ®� ,AWARNING-Vernfy design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE Mll-7473 rev.1010312015 BEFORE USE Oaa:en vnt:d farusa anly vAtli MiTa4arlrtcr¢ar•,:,fhladtjdpn It taasad duty upc±n¢artimolcre shovm,and Is frx nn itidtviilaill tiuitdinp campa?ant,nnt,. �i s{Iua1r b ateri�$U'C*U ua0,4hri tiUllra¢p dcnlpnetrrua!retf!'y^flip d¢PIt it' ddelgn¢ararnaUers Dir¢property foewwwmo thWeelij$n Into lug evwall Sui dI g dRshJu,Braafi p indiwtbd Ie to amcknttiuet tn>t otitid viduni in sweb a,rdrpr e3wtd jnamher dnty.'alddlraanaf lompmury znd pcm antnti bra tnQ 'tf' rIG�C' It Tit v8yg 1C{llt•1d 1ai w,ltjlAy alrl W(rj.t'anlcIXls¢se,valil7 oSYaY c l dr%9+d tr Fyry and ptaputyd jmage.Fay gnharai guidance rapnrdihO lha,_ fntutciit(Sq,a[araga,ddlivary,'macliot%ajld bY(�trlybt irtrS$60 Ojid Uuss 6y91an:y;eao 'AN611TPI{gii`Q18y,Cdtedar 0$8.33 and SCSI So 16023 16029 swingley Ridge Rd SAtCty'IntetlltnlfOn a5'alin l0 flom7nlss Plush tgatllule,218N.l:ac4ve,, sia h312,%Uexars17 VA2Z31dc Chesterfield,MO 63017 Jtlb runs - Truss Type '" i]ty Ply Vineyiird Vlew Building D Qnd Flcar 137921921 4 3rragF3. F32 Floor.5upported Gable 1 r 1 .Job R;ternnCc(aLitiorlaq_ - Universal Component Corp., -FAST HAVEN CT 06512 `11,010 s Aug 11 2017 MiTek In_dUstdcS.Inc:,Wed out 24 16.40:042019-'Pagel,' ID ndIRDAhLEUvt]7NlBgAvyTyugda-xYnsv5RmJo6vnT7wTZON9tB 7rLBSOmrRJG 7JyuoL9 aNe Scale=1 YY1 J-`41 T�2 42 3 43 4 44 5 46 6 46 7 47 4Y8 4B 9 49 10 50 11 51 12 52 13 — ° --- - )t - — j- -- 28 4 qy 7,k I i a t r __. `r� f,r'.., `,N`.._ r"z}'#`✓?a �;1,a`.>'�`.'��_s�c:i�sa'y"s.i„�.."+ fir •.�-�.---,}=�'•{^:ti`„�;a.,._. ,��,',2'.l5rw=�.:ir,-t ^, .'n,x",r;,`=s= >`-I-'=-�si�' �--ate f'ia`Y—• ��+6t�awLKZ� ,-..s __ 27 29 26 30 25 31 24 23 32 22 33 21 34 ^20 35 19 38 18 37 17 38 16 39 15 40 14 3X3 = 3x6 FP= LOADING'(psf) SPACING- 2-0-0 CSI. _ DEFL, In (loo) Udell L/d PLATES GRIP - TCLL 40.0 Plate Grip DOL 1.00 TC 0,18 Vert(LL) n/a n/a 999 MT20 197/144 TGDL VertCT 12,0 Lumber DOL 1,00 BC 0:19 Vert(CT) n/a We 999 BCLL 0.0 Rep Stress Incr YES WB 0.03 Horz(CT) 0.00 14 n/a n/a Weight 56 lb _FT=20%F,11%E BCDL 10.0 Code ISC2015/TPI2014 Matrix-S LUNIIBER- BRACING- TOP CHORD Structural wood sheathing directly applied or 6-0-0 oc purlins, TOP CHORD 2x4 SPF No.2(ffat) BOT CHORD 2x4 SPF No2(flat) except end verticals, WEBS 2x4 SPF Nor2(flat) BOT CHORD Rigid ceiling directly applied or 6-0-0 oc bracing; OTHERS 2x4 SPF No,2(flat) REACTIONS. All bearings 16-0-14. (Ib)- Max Grav 4)24=309(LC 43),22e309(LCn44))21 309(LC 45).20 309(LC 46)(19=309(LC 407)•18 4309(LC 48).LC 17=309(LC 49),16=308(LC 50),15=310(LC 51) FORCES. (Ib)-Max,Comp./Max Ten.-All forces 250(lb)or less except when shown. TOP CHORD 1-2i=-263/10.13-14=-259/14 WEBS 2-26=-280/0,3-25=-279/0,4-24=-279/0,5-22=-279/0,6-21=-279/0,7-20=-279/0, B-19=-27910,9-18=-27910,10-17=-27910,11-16=-279/0,12-15=-280/0 NOTES- 1)All plates are 1.50 MT20 unless otherwise indicated. 2)Gable requires continuous bottom chord bearing, 3)Truss to be fully sheathed from one face or securely braced against lateral movement(i.e.diagonal web). 4)Gable studs spaced at 1-4-0 oc 5)This truss has been designed for a moving concentrated load of 250 Olb live located at-all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 6)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 oc and fastened to each truss with 3-1 Od(0.131"X 3")nails. Strongbacks to be attached to walls at their outer ends or restrained by other means. - 7)CAUTION,Do not erect truss backwards pF;NE�" ,wy � f w S1 July 24,2019 ®WARNING-Verily design parameters and READ NOTESbN THIS AND INCLUDED MITEK REFERENCE PAGE M11.7473 rev.1010312015 BEFORE USE ` y( lq y g parinnl,cwt- UuAtpnvM tfaru$dotki W1 MiTaKRs?eon}/aei ,TtdsOulignt�bnsdlbnfY�P ,Oartirnamm,�t:avyi.nnd}a)nrnnfi�dnntua4,41r; ion+ ntrussrryrolmn,BefdrreUSA;Ybabifit�npdo>dgnurhiu3i'vorifythanpri11c4Ullitypfdah)9My,1rnh9nl�+raatidpr0piutyiriColror�ll}�`prdia gn7ndul(ipm0rptt,,, ,��,, 't�rir.+r}B�laa}fln,5ra'*Jn0'4WlnnlmtlakrtNavnntbucLnRotInd(vfdUbltnrs3waft�ntllor;ehardmemborgohly:AddHinnal! nrtd>;Cmmgantbr€isY.yt tsx�hvyporegtmadtarntnldyb+rdtopinunrRocdlatria~mi,pacfblripu!uarinitnjuFrymjdpmpatyaem[n3a.Fnroantfluaiontaregffiding>fm, 16023 faLiicn8an,sipmpsriordlvdi.ceCttton'andadnpS+tiuf5aawmii+0dsdjlLtarna„0flA' I�S68tttS'{IQunliyGnrorlaiQsti60nndflGsl,ButlrBComponnnt ChesterfieldlM 6130174 'Satnyi tntormmlon'-nVnitnAldGnrtj7rese Wato tr�Wy4.29618,Loo 5treel;Sid10 312 A9uacrrTdrin;�'A�d14,,- ----- - - -- - --- - - -P� - - —-`- - Jab Truss Truss Type pryPIy Vtt_teyafd ViewSuliJing D 2nd Floor — - 137921922 ' 3597dF3' F33 FLOOR 9 1 I -_ - ob Referenco(optional) Universal Component Corp., 'EAST HAVEN CT 06512 8.010 s Aug 11 2Ol t- ITek hldaWies,16c Wed-Jul 24 16'40.05 2019.-PaUe'1 ID.ndi RDAhLEUvQ7PkiBgAvyTyugda-QkLE6RSO45EmOda61 Gvci4h4EFbNBQ?_fz?XfmyuoLB - 2.6'9 -=i I t-l3.2 Scale=1:20-4 1x3 II 4x4 = 1x3 It 1x3 II '44 = 1x3 II 1 14 2 15 3 16 4 17 5 18 6 1� 11 9 12 a 46 II 13 -7 46 11 46 11 46 11 121•0.2 - - -- —— - - 12-02- - -- — - �late Offsets(x Yt'-_ (8:0.3.O,EdgeL19:0-3+0,Edge) - LOADING (psf) SPACING- 1-8-0 CSI. DEFL. in ([cc) I/deft Lid PLATES GRIP TCLL 40.0 Plate Grip DOL 1.00 TC 0,47 Vert(LL) -018 7-8 >810 360 MT20 197/144 TCDL 12.0 Lumber DOL 1.00 BC 045 i Vert(CT) -0.21 7-8 >673 240 BCLL OA Rep Stress Incr YES WB 0.22 Horz(CT) 0.01 7 n/a n/a BCDL 10.0 Code ISC2015/TP12014 Matrix-S Weight:59 lb FT=20%F,11%E LUMBER- BRACING- - �CHORD 2x4 SPF No.2(flat) TOP CHORD Structural wood sheathing directly applied or 6-0-0 cc purlins, f CHORD 2x4 SPF No.2(flat) except end verticals, ---BS 2x4 SPF No.2(flat) BOT CHORD Rigid ceiling directly applied or 10-0-0 cc bracing. REACTIONS. (Ib/size) 10=614/0-4-6,7=614/Mechanical FORCES. (lb)-Max CompJMax.Ten,-All forces 250(lb)or less except when shown. TOP CHORD 1-10=-27010,6-7=-270/0,2-3=-1400/0,3-4=-1400/0,4-5=-1400/0 BOTCHORD 9-10=0/954,8-9=0/1400,7-8=01954 WEBS 5-7=1072/0,2-10=-1072/0,5-8=0/546,2-9=0/546 NOTES- 1)Unbalanced floor live loads have been considered for this design 2)Refer to girder(s)for truss to truss connections, 3)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 4)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 cc and fastened to each truss with 3-10d(0 131"X 3")nails, Strongbacks to be attached to wails at their outer ends or restrained by other means. � -pF NSy �� °•06`OQg� p��'�SS�ar�P July 24,2019 ®WARNING-I/Wry design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE M11-7473 rev 10/0312015 BEFORE USE r I DOW(in varfd foruao ahly-with MiT010cannrittors.1W5(1asign Is bpsed ootyuponpnfnraet ra et a c11i and to for an Ind Iduat bultdfirycampunanl,nol, a Was pyrsant.eaforon",iheWiftoatfounaf,nial%6tdytitoapicabrayOdu6ignpPom(tors)Ind pccpasty_tniorpwatvMin dotlgnInto tNuevbran MOW 6uild;ngda,Epn:Btacing Indicated falb protoai bu:Jctin�bf indv;dpn!t-rass wMh anelor r8ard mnmtmrc�n�y.AdJittgnal teinpatory arld pcmmnnnl @mrJnp 1 V�(Tet6.I iF af�,ayatogrnrat)16r atnblldyand toon3vantaoilnmvuilh pa�sltSe[ mnnl fr uiyand jx pfP lydaninga.Pw(ianvfW Quldance reaoidhu Iho tabncaUon:t6kti,drAvey Wudian and Gros np ofuuaser=nntl suss ayatania,San Af{5ATPN Qunlity Crltorta,DSB-69 an-d BCStp4 illdlnp Component 16023 Swingley Ridge Rd Safoty,lil(omuttlon avettabtatromTfussPlata)notltutx718N.L 5ttoEl,S_uilc3t2.Na_xnadria,-VA22$14. } Chesterfietd,Mo63017 job - -- _-- " ruse" Truss Type' -Qty Pty Vlrieyald Vlew BUl(tting'0 2nd Floor 137921923 3597OF3 F34 Floor '3 t� 1 _Jab Reference Universal Component Co'rp:,' EAST HAVEN CT 06512 8,010 s Aug 11 2017 MITnk tnd6sUles lnc,Wed Jul-2-4 18:4006 2019 Page 1 I D,ndiRDAhLEU VQ7PkrB gAvyTyugd a-tiwOcKnTO rPM d O n 91b_QrEI DFSfwFwsr7udl4CCyuoL7 2-8-0-�I ami scale=1:2 1 5x9 II 4x6 1.5x3 I I 4x4 = 4x4 = 3x6 FP= 1.5x3 II 4x6 t-- 1.5 3 II 1 21 2 22 3 23 4 24 5 6 7 25' 8 25 9 - 9 j y r 17 15 14 13 18 12 19 11 20 44= 3x8 3x8 MT18H FP = 1x4 II 1x4 II 3x6 = 44 = Ptate Oltsets 4:0.1.8,Ed e" 5:0.1+8;Ed e" 10:Eda 16:£d�e 0.1 LOADING (psf) _ SPACING- 1-8-0 CSI. DEFL. in (loo) I/deft Ud PLATES GRIP TCLL • 40.0 Plate Grip DOL 1.00 TC 0.50 Vert(LL) -0.34 15-16 >500 360 MT20 1971144 - TCDL 12.0 Lumber DOL 100 BC 0.54 zi Vert(CT) -0.43 15-16 >457 240 f; MT18H 244/190 BCLL 0.0 Rep Stress Incr YES WB 0,32 Horz(CT) 0.03 10 n/a n/a ; BCDL 10.0 Code IBC2015ffPi2014 Matrix-S — Weight 71 Ib FT=209oF,11%E LUMBER- BRACING- TOP CHORD Structural wood sheathing directly applied or 6-0-0 oc purlins, TOP CHORD 2x4 SPF No.2(flat) except end verticals. BOT CHORD 2x4 SP 285OF 2.3E(flat) WEBS 2x4 SPF No.2(flat) BOT CHORD Rigid ceding directly applied or 10-0-0 oc bracing.- REACTIONS. (Ib/size) 10=947/0-2-4,16=64710-4-6 FORCES. (lb)-Max Comp./Max.Ten.-All forces 250(Ib)or less except when shown. TOP CHORD 1-16=-270/0,9-10=-270/0,2-3=-2223/0,3-4=-2223/0,4-5=-2532/0,5-7=-2223/0,7-8=-222310 BOT CHORD 15-16=0/1345,13-15=012532,12-13=012532,11-12=0/2532,10-11=0/1345 WEBS 2-i6=-152610,2-16=01997,3-15=-307/0,4-15=-4951152,8-10=-1526/0,8-11=0/997,7-11`1=-30710,5-11=495/152 NOTES. 1)Unbalanced floor live loads have been considered for this design, 2)All plates are MT20 plates unless otherwise indicated._ 3)Provide mechanical connection(by others)of truss to bearing plate at joint(s)10. 4)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads, 5)Recommend 2x6 strongbacks,on edge,spaced at 10.0-0 oc and fastened to each truss with 3-10d(0.131"X 3")nails, Strongbacks to be attached to walls at their outer ends or restrained by other means. ACV NES �0.'084�� July 24,2019 USE- WARNING parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE M11+7473 rev 1OM312015 BEFORE prspay,,tdicsuanarilywlUtMtrn1t14Copnrcraitdatlnak{In#anasnd"ohtyupmtpararrmlaroWhmvrt,s7nd.l¢ta(trnicjF+iAunitiuldingcvmQancni,n '. M1 pdgrSayatym:aefarntwo,thcbVddat pdesscfnerrtHiotYntlrylhaap�tinhlisynrdnul6nAltnmt:twaa+pdtnufituiylnrnrparaln"q$iifoaypt'Il+to.,<;�:nl .Mi��k buitdiidacttjn.•lSrung In�fl�ltnA)sto pravent'ttu+ 1l r9 ot;ntll�dltnnfbuss ww nndlor cf nrd maaliicrs only.,Add iIle nnl tn{npo sty,cuW pulFaa9nal toc'rnp Is cstwpyp Yngaved lnr sthhll�y and to pravdnt ebaopra t+iEh pannlLl�palaannl ln)Gnyalnd prat{t rtpda,nkEln.gym Ile -a rop:ad a8 g4n <P..iStienibn.9ilYnrf'o:iti3lVb:j.,rc+aetlznf�tidw:zn�:6�fU:I,x`Ssa$J$ aiw:nT0.rfru A�St1t�Quutlty-Cdterlg'NQS%9g0gslAC5tSplldingComponant Ches3errild9rMO613D1Rd SafogjtnrotmatIan,avnllaUFnirotnTfifss,f'_+atelnapNWy�iaN l&e$tro1-N IN �l3,iyucjitta,vn223la., - Job ruse — russ Type -" city (iy Ynsyard View Bull dmg D 2nd Floor 137921924 , 359701`3 F35 FLOOR p 1 Joh Reference roirtlottal) Universal Component Corp., EAST HAVEN CT 11+1512 S.D10 s Aug ai 2017 MITek Industries,lnc.'Wed Jul 24J6140:03 2019 PAgeA 1D�ti dIRD/}!11 EUvO7PkiBgAvgTyvt�da,-rjJ 1 NkTVH,f`10dKF4 Jhi(?SJKjIbDTsOdmxt�M xcBGSyuoL5 I 2-6-0 , 0-11-14 Scale 112"' 1x3 II 3x6 = 1x3 II 3x3 = 1x3 II 3x6 = 1x3 II 1 17 2 18 3 19 4 20 5 21 6 22 7 t 13 11 14 10 15 94x6 II 16 NI 46 II 6x6 - 3x6 II 46 II I - - 14-1-6 - -- - - Plate Offserse{XYJ -- LOADING (psf) SPACING- 1-8-0 CSI. DEFL. fi (loc) I/defi Ud PLATES GRIP TCLL 40,0 Plate Grip DOL 1.00 TC .0.49 Vert(LL) -0.15 8-9 >999 360 MT20 1971144 TCDL 12 0 Lumber DOL 1 00 BC 043 Vert(CT) -0.19 8-9 >891 240 BCLL 0 0 Rep Stress Incr YES WB 027 Horz(CT) 0.02 8 nla n/a BCDL 10.0 Code IBC2015/rP12014 Matr&-S Weight.70 Ib FT=20%F,11%E LUMBER- ^ ' -- - BRACING- 'CHORD 2x4 SPF No2(flat) TOP CHORD Structural wood sheathing directly applied or 6-0-0 oc purims, 'CHORD 2x4 SPF No.2(flat) except end verticals vV�dS 2x4 SPF No 2(flat) BOT CHORD Rigid ceiling directly applied or 10-M ocbracing.- REACTIONS. (Ib/size) 12=723104-6,8=72310-2-4 FORCES. (Ib)-Max;CompJMax Ten.-All forces 250(lb)or less except when shown. TOP CHORD 1-12=-27010,7-8=-270/0,2-3=1 84510,3-4=-1845/0,4-5=-1860/0,5-6=-1860/0 BOT CHORD 11-12=0/1165,10-11=011860,9-10=011860,&9=0/1179 WEBS 2-12=-1309/0,2-11=0/764,3-11=-305/0,4-11=-262/279,6-8=-1325/0,6-9=0/765,5-9=-251144 NOTES- 1)Unbalanced floor live loads have been considered for this design 2)Provide mechanical connection(by others)of truss to bearing plate at joint(s)B. 3)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 4)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 oc and fastened to each truss with 3-10d(C.13i"X 3")nails. Strongbacks to be attached to walls at their outer ends or restrained by other means. o`F NE /. ,t fA , 1U 0•-090T 7fi� - A�QFESStO��; July 24,2019 ®WARNING-Vardy design parameters and READ NOTES ON THIS AND INCLUDED M1TEK REFERENCE PAGE MU-7673 rev.1MV2015 BEFORE USE r. 4eilnn"ntd-rnr,usocatlyWilltitilnk�cmnat ars Thi'tlaJgn;bfincednrfly0ponr0lbMctnraSNWArandItfatanlndlYkillEteuiidngLnmpt6natU,not' IIIc ' �quss'Sy�ram-L�Dfnr6ittlri;thoDu06-6pnllgttnTmi:P.tvenryU+oepppcpb4ityotdes>gn,p>i[;+mot¢rsand{sopailylnaxitt:o+c+�,Ihfcd95`•aflinlq.t��COYCt�+l9. i _ tuUdfppddvtOn,brad ifno:catedlstAW ventfrutkria,nlindvldudhus3tvrbardfyrctia�mnmOotGopddl6opaltrmporary0ridparm0ntinrbiadng ��e,k Ieoh4oysreaslrndlarttdiallity,pndtoptovmilcohapsauilh'param0nporsannll61uryitndruoP4nydamagr FergararolspldancaldgnMtitgtheT 1A'a+tcnaon,stpwge,daGve_ry,ore•:tir:n'oiW tNaCliilf ell. I.T. 6yalolrin,a -- 'IWSIrrPli'Quotity Criiaria;OSBEa end rdC316dltdtnll Component ,I 16023 Swingley Ridge Rd Snfotylntorination nvnlahi¢fromTmss(+IstolpaGtOto,xf6N.RdeSlreat Suito512,A1^xMddi,V/�223t4. Chesterfield,MO 63017 A—D 2nd Floor Ineyard,YfOW130ild Ag D 2nd Floor toss Truss Type at Ply- �T � Job y " W 137921925 35L F36 �Floor Supported Gable Job Qarehia-6-1 ek �&010 'Aug 1�,l 2011,MfTek J�dupqlo 8661 jtiwVVedJ6l2416:40; 2019 Universal Component Corp ffA N CT 06512 Scale 1.5X3 11 0 1 30 2. 31 3 32 4 33 5 34 6 35 7 36 37 9 38 1 T 9 -M22 - 11 20 21 19 22 18 23 17 24 16- 26 15 ------26 14 27 3 28 12 29 1x4 II LOADING (psf) SPACING- 2-0-0 CSI. DEFL. in (loc) Vdefi Lid PLATES GRIP TCLL 40.0 Plate Grip DOL 1.00 TC 0,18 Vert(LL) r9a n1a 999 MT20 1971144 TCDL IZO Lumber DOL 1.00 BC 019 Vert(CT) n1a n1a 999 BCLL 0.0 Rep Stress Incr YES WB 003 Horz(CT) 000 11 n1a n/a Weight:42 lb FT=20%F,11%E BCDL 10.0 Code IBC2015/TP12014 Matrix-S BRACING- LUMBER- TOP CHORD Structural wood sheathing directly applied or 6-0-0 Do purlins, TOPCHORD 2x4 SPF No.2(flat) except end verticals. BOT 2x4 SPF No2(flat) WEBS 2x4 SPF No,2(flat) BOT CHORD Rigid ceiling directly applied or 6-0-0 oc bracing. OTHERS 2x4 SPF No-2(flat) REACTIONS. All bearings 11-11-6 (lb)- Max Uplift All uplift 100 lb or less atloint(s)11 MaxGrav, All reactions 250 lb or less at joints)except 20=275(LC 31),11=274(LC 40),19=310(LC 32),18=308(LC 33),17=309(LC 34),16=309(LC 35),15=309(LC 36),14--309(LC 37),13=309(LC 38),12=309(LC 39) FORCES. (lb)-Max Comp./Max.Ten.-All forces 250(lb)or less except when shown. TOP CHORD 1-20=-263110,10-11=-262112 WEBS 2-19=-28010.3-18=-279/0,4-17=279/0,5-16=-279/0,6-15=-279/0,7-14=-279/0, 8-13=-27910,9-12=279/0 NOTES- 1)All plates are 1x3 MT20 unless otherwise indicated, 2)Gable requires continuous bottom chord bearing. 3)Truss to be fully sheathed from one face or securely braced against lateral movement(I e,diagonal web), 4)Gable studs spaced at 1-4-0 oc. 5)Provide mechanical connection' (by others)of truss to bearing plate capable of withstanding 100 lb uplift at joint(s)11. 01 6)This truss has been designed for a moving concentrated load of 250.,Olb live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any Other live loads. 7)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 oc and fastened to each truss with 3-10d(0,131"X 3")nails. Strongbacks to be attached to walls at their outer ends or restrained by other means. OF N.EIy My 24,2919 A WARNING-Verify design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE MII-7473 rev.101031ZD15 BEFORE USE pwim fuss - — Truss Type Qty Ply Vineyard View 6udtiing D 2nd Flgpr' 137921926 35970F3 F37 Floor Supported Gable 1 1 = Job R^fefence"(anaf - - - — - - Unlversel Component Corp EAST14AVENN CT 06512--- 8,010's Mg 11,-201l7.Mrrdkdnd6triP4,lrfa„Wed Jul 24'16:40:10 2019 Prage r lD:ri11RDAfrI EtiviYlPtdl9n,Av�Iputjda tni87881ti9fliot2VOT3ggVnNAt775GNEs&F!(IFJIGajruaL3 1 1x3 II 9 2 1x3 II 10 31.5x3 It Scale=110.3 t' 1„ ,a i f I l l e 7 i ' ,� �: v,:r-/rfix�r-.:�,�,x�.�Y� :�h .�rv�„v,t;,=��r-.-,r�-F.r>�,{,"wr;�•r�r��, .,"k'h '.°.v*^`.Srx'".,i\x'"�`"iy, ,^:si" .h.<°` r R'`'y,y,�`k''•`'"'°'`" '";.;C�:`'',1, ` T.r.i'`'.f. cam+ '�� ''�•,,.`+ r`4'" '..•-�.k_J.�]._> ___.�.Y 6 7 5 81 4 10 11 10 11 U4 11 2-9-2 - 2-9-2 LOADING (psf) SPACING- 2-0-0 CSI: DEFL. in (Jac) Pdefl L/d PLATES GRIP TCLL 40.0 Plate Grip DOL 1.00 TC 0.20 Vert(LL) n/a n/a 999 MT20 197/144 TCDL 12.0 Lumber DOL 1,00 BC 0,21 Vert(CT) n/a n/a 999 BCLL 0,0 Rep Stress Incr YES WB 0,03 Horz(CT) 000, 4 n/a n/a BCDL 10A Code IBC2015/TP12014 Matrix-S Weight 11 Ib FT 20%F,11%E LUMBER. BRACING- TOP CHORD 2x4 SPF No 2(flat) TOP CHORD Structural wood sheathing directly applied or 2-9-2 oc purlins, ,r CHORD 2x4 SPF No2(flat) except end verticals. BS 2x4 SPF No,2(flat) BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing _IERS 2x4 SPF No,2(flat) REACTIONS. (Ib/size) 6=7i/2-9-2,4=77/2-9-2,5=179/2-9-2 Max Grav 6=275(LC 10),4=277(LC 12),5=314(LC 11) FORCES_ (lb)-Max"Comp/Max.Ten -All forces 250(lb)or less except when shown-v TOP CHORD 1-6=-263/5,3-4=-264/0 WEBS 2-5=282/0 NOTES- 1)Gable requires continuous bottom chord bearing. 2)Truss to be fully sheathed from one face or securely braced against lateral movement(t a diagonal web), 3)Gable studs spaced at 1-4-0 oc 4)This truss has been designed for a moving concentrated load of 250,01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent With any other live loads. 5)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 cc and fastened to each truss with 3-1 Od(0.131"X 3")nails. Strongbacks to be attached to walls at their outer ends or restrained by other means of: NE r rr r )n T; •i. � C1 r W Z)10 - 0 .0800C� ti July 24,2019 ®WARNING-Verify design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE MII-7473 rev.10/03/2015 BEFORE USE. a Oeff!GnvwbdJaruceonty%AltTldsdaeipoIsbasedrmlyupon parcmalumsuawn}andi3,fgrpnInujvidualhIIM0 txirnpOsrael,riot a tiuss aystrmf,136{rrnasp,tfia tx111aing dds gnergiust'vanf Itro apWlp�s�hty dl das��jn psrarnntajx d10,1144 pluiyilistirparebl piis dogipn t Rt itltn ovonW b t,00g dnsllSn.erdrina itikicafed it to prevent t�cidjdg of Inai}QW1 bus5lveb aim-2rehofd mombein a lv.AddillwlaI larnllardiy aiuf penranenl'oi4dn0, 1iIt'fLA is nheoygfo4tnl' forslnilifilYaniliA{ravaolcaisP*ovnihtnssrblriPe 4!raligury,pidpropartydarpage Fergedrr:il6ulddrrror09in ftglltlr_ - ftttinunlfon';'Ciotapa,dallvcry,er`uutian'oiud brisri�g attrusscs ni>3 hu]sia�slums,sod -ANSlRPlt,qunitly GCitafla;458.5 end RdSl Building Component 16023 S%V69tuy 8420 R4 finfatylpfonaatlan"ovaltnt t6lrem,Tru s Pinta Insf luto,21S hl,Luo Sitccl,Sultn 31.',Alt xa�dria,VA`^.2314, Clt�fernald.MO 830f7 Sy owls Numbering ziystem A General Safety r4otes PLATE LOCATION AND ORIENTATION 6-4-8 dimensions shown in ft-in-sixteenths Failure to Follow Could Cause Property ` , 4_1 8j4' Center plate on joint unless x,y not to scale Damage or Personal In offsets are indicated. (Drawings � ma Injury j ry Dimensions are in ft-in-sixteenths Apply plates to both sides of truss l 2 3 1, Additional stability bracing for truss system,e.g. and fully embed teeth TOP CHORDS diagonal or X-bracing,is always required. See BCSI. 2, Truss bracing must be designed by an engineer.For rr wide truss spacing,individual lateral braces themselves �� i16 WEBS S�. 4 may require bracing,or alternative Tor I fY r bracing should be considered. TA a: 0 3 Never exceed the design loading shown and never U o U stack materials on inadequately braced trusses. a O p 4 , Provide copies of this truss design to the building Crx c6_7d designer,erection supervisor,property owner and For 4 x 2 orientation,locate BOTTOM CHORDS all other interested parties. plates 0- 'hu"from outside edge of truss. 8 7 6 5 j 5. Cut members to bear tightly against each other. 6. Place plates on each face of truss at each This symbol indicates the JOINTS ARE GENERALLY NUMBEREDILETTERED CLOCKWISE joint and embed fully Knots and wane at joint required direction of slots in AROUND THE TRUSS STARTING AT THE JOINT FARTHEST TO locations are regulated by ANSlfrPI 1. connector plates. THE LEFT. 7 Design assumes trusses will be suitably protected from CHORDS AND WEBS ARE IDENTIFIED BY END JOINT the environment in accord with ANSIlfPI 1. `Plate location details available In MiTek 20120 NUMBERSILETTERS. 8. Unless otherwise noted,moisture content of lumber software Or upon request. shall not exceed 19%at time of fabrication, PRODUCT CODE APPROVALS 9 Unless expressly noted,this design is not applicable for PLATE SIZE use with fire retardant,preservative treated,or green lumber. ICC-ES Reports- The first dimension is the plate 10,Camber is a non-structural consideration and is the 4 X „4 width measured perpendicular ESR-1311,ESR-1352, ESR1988 responsibility of truss fabricator General practice is to to slots.Second dimension is ER-3907, ESR-2362,ESR-1397,ESR-3282 camber for dead load deflection. the length parallel to slots 11.Plate type,size,orientation and location dimensions indicated are minimum plating requirements. LATERAL BRACING LOCATION 12.Lumber used shall be of the species and size,and in all respects,equal to or better than that Trusses are designed for wind loads In the plane of the specified. Indicated by symbol shown and/or ' by text in the bracing section of the truss unless Otherwise Shown. 13 Top chords must be sheathed or purlins provided at output Use T or I bracing spacing indicated on design, if indicated. Lumber design values are in accordance with ANSI/TPI 1 14.Bottom chords require lateral bracing at 10 ft.spacing, section 6.3 These truss designs rely on lumber values or less,if no ceiling is Installed,unless otherwise noted. BEARING established by others. 15,Connections not shown are the responsibility of others. Indicates location where bearings 16.Do not cut or alter truss member or plate without prior (supports)occur. Icons vary but ©2012 MiTek®All Rights Reserved approval of an engineer. reaction section indicates joint number where bearings occur. 17 Install and load vertically unless Indicated otherwise. Min size shown is for crushingonly. ®®,R 18.Use of green or treated lumber may pose unacceptable environmental,health or performance risks Consult with i project engineer before use. Industry Standards: ANSI/TPI1: National Design Specification for Metal 19 Review all portions of this design(front,back,words 9 P and pictures)before use.Reviewing pictures alone Plate Connected Wood Truss Construction, is not sufficient. DSB-89: Design Standard for Bracing. ei ka BCSI: Building Component Safety Information, 20.Design assumes manufacture in accordance withGuide to Good Practice for Handling, ANSI(fPl 1 Quality Criteria. Installing'&Bracing of Metal Plate Connected Wood Trusses. MiTek Engineenng Reference Sheet-M167473 rev. 10/03/2015 MiTek - - M!Tek USA, Inc. 16023 Swingley Ridge Rd Chesteifield;MO 63017 " 314-434-1200 Re: 35970133 BUILDING D ROOF VINEYARD VIEW The truss drawing(s)referenced below have been prepared by MiTek USA,Inc. under my direct supervision based on the parameters provided by Universal Component Corporation. Pages or sheets covered by this seal: 137938909 thru I37938960 My license renewal date for the state of New York is May 31,2021. 'C of Ne J0- A. 0 CO (c.cUJ, ��.09 49� U ' July 26,2019 Johnson,Andrew IMPORTANT NOTE:The seal on these truss component designs is a certification that the engineer named is licensed in the jurisdiction(s)identified and that the designs comply,with ANSIrrPj 1. These designs 66 based upon p5ramelers shown fe.g.,loads,supports,dimensions,shapes and dessgn codes),.vJ�Jch were given to MITek-or TRENCO. Any project specific information included is for MITek's or TRENCO's•cvs.f merx fil6 Werenr�purpose.gnly,and was not taken Into account in the 00fiaratibrl of these designs. ,MITek orTRENCd has lint ihdependenlly veriii6d the applicability-of the•design parameters or the designs for-any paificular building: Before use, the building designershouid'verify applicability of.design paremeters.and'properly in drpgrate these qe igns-lnto ihc.overall'building design per ANSVTPI 1;Chapter 2. Jobcuss — russSYpa- Qty Ply -- FjU_1L01NG,V,•ROOF VINEYARD VIEW 137938909 3597OR3 G01 Common Girdar 2 job - -- Universal Component C&T.," —-EAST HAVEN CT06612 8.010 s Aug 11 2017-MTek Industries,Inc, Thu Jul 25 23:14:57 21719 Pagu 1 IDuHB1G9iAM9 WQEtKnavHVNyuWBg -ydXYOIoEFtg_FPNMZ1afFM4BDgLAANIZH6T7hfyuNSy 10• 3-7-11 7-7-14' 10-14.1 _ r_ 145.12 10 >&7.11 3-75 3.7-3 3-7-11 0104 4x6 11 Scale=1.50.6 a 12. �!' ` 13 12,00 123x6 -- jj' 3x6 O a' 3 5 14 27_ 7 9 _ _ o 1 �. 16 17 10 T 1i8 19 20 9 21 22 8 ~~-231 15 4x6 4x6 = HUS26 2x4 II 5x8 = 20 11 HUS26 HUS26 HUS26 HUS26 HUS26 HUS26 37-it 7-2.14 10-10-1 1 14-5-12-_ 373- d 3.7-3 37=fi - Plate Offsets.(a:Y)w.- [2.0.0-0,(3-0-41,16:0.0-0,1)-g-41- - LOADING (psf) SPACING- 2-0-0 CSI. DEFL in (loc) I/deft Ud PLATES GRIP TCLL(roof) 300 Plate Grip DOL 1.15 TC 0.20 Vert(LL) -0.05 9-10 >999 240 MT20 197/144 Snow(PflPg) 38,5/50.0 Lumber DOL 1.15 BC 054 Vert(CT) -0.07 9-10 >999 180 BCDL 10.0 Rep Stress Incr NO WB 0.55 Horz(CT) 0.02 6 n/a n/a BCDL 10,0 BC0.0 Cade IBC2015(TPI2014 Matrix-S Weight:145 Ib FT=20% - - LUMBER- - - - - BRACING- P CHORD 2x4 SPF No,2 TOP CHORD Structural wood sheathing directly applied or 6-0-0 oc purlins., T CHORD 2x6 SPF Not BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing= 'BS 2x3 SPF No.2 REACTIONS. (Ib/size) 2=406210-5-8,6=352110-5-8 Max Horz 2=182(LC 47) Max Uplift 2=233(LC 10),6=-214(LC 10) FORCES. (lb)-Max,ComplMax.Ten.-All forces 250(lb)or less except when shown, TOP CHORD 2-3=-3896/215,3-4=26271227,4-5=-26271227,5-6=-3898/219 BOT CHORD 2-10=-107/2521,9-10=-107/2521,8-9=-53/2522,6-8=-53/2522 WEBS 4-9=246/3192,5-9=-1104/145,5-8=-48/1538,3-9=-1102/141,3-10=-42/1535 NOTES- 1)2-ply truss to be connected together with 1 Od(0.131"x3")nails as follows: Top chords connected as follows.2x4-1 row at 0-9-0 oc. Bottom chords connected as folfows•2x6-2 rows staggered at 0-6-0 oc. Webs connected as follows'2x3-1 row at 0-9-0 oc. 2)All loads are considered equally applied to all plies,except if noted as front(F)or back(B)face in the LOAD CASE(S)section-Ply to ply connections have been provided to distribute only loads noted as(F)or(B),unless otherwise Indicated, 3)Unbalanced roof live loads have been considered for this design,_ 4)Wind:ASCE 7-10;Vuit=130mph(3-second gust)Vasd=103mph;TCDL=6.Opsf;BCDL=6 Opsf,h=25ft;B=45ft;L=24ft,eave=oft;Cat. ll;Exp B;enclosed;MWFRS(directional),cantilever left and right exposed;end vertical left and right exposed;Lumber DOL=1,60 plate grip DOL=1.60 5)TCLL:ASCE 7-10;Pr-30 0 psf(roof live load:Lumber DOL=1.15 Plate DOL=1.15);Pg=50.0 psf(ground snow);Pf=38,5 psf(flat roof snow Lumber DOL=1 A 5 Plate DOL=1,15);Category 11,Exp B;Partially Exp.;Ct=1.1 ,� r'Y • 6)This truss has been designed for greater of min roof live load of 12,0 psf or 1.00 times flat roof load of 38,5 psf on overhangs non-concurrent with other live loads. 7)This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads. B) This truss has been designed for a live load of 20.Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide will fit between the bottom chord and any other members. 9)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT at lt(s)2 and 6.This connection is for ` � uplift only and does not consider lateral forces 111 i I U 10)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along Z qtu>a the Top Chord and Bottom Chord,nonconcurrent with any other live loads, .4 ,N 11)Use Simpson Strong-Tie HUS26(14-1 Od Girder,4-10d Truss,Single Ply Girder)or equivalent spaced at 2-0-0 oc max.starting at 6R 0994'53 0-6-8 from the left end to 12-6-8 to connect truss(es)to back face of bottom chord. iQ'' ")Fill all nail holes where hanger is in contact with lumber.-_ �p8$SIOL� iAD CASE(S) Standard July 26,2019 ®WARNING-Verity design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE Mll-7473 rev.10/07/205 BEFORE USE ticargavalldImu-culyw101!/-cfewac 161:crc.ThfsdeaiguluWsddohlyuDrnDoramclerc:Oovn,nndd�,rarsnindMluN6uGffnyampenont not; } �e n at us V" eofor, uw,mb btnld6 duet incr mast'vnnty paa 4p}eireahi; ty nt duglyn pari n iu&as 7 prriprA+}I Inisivporote Ih4u'dokpn Lda rile mrose 1 } 1r�91dinp'+lel3pn,Elr c(nufndirniadtgtapicvanttiur�+rsgidandtti�daurtn,eaHnitid'nlr«chudmomurly.nddil?orNloamp ,yQndprsrmanbntfxatln8' i ��®t� a oA3ayr rtgtra Por ginhlt+;ypnd,lv_pruvanl conep,v frith peep�'Waporcannt lnyury grid propertydammta rra pe+seira Ov'4.mu rtgdtd�r+0 tfen. - •f317ictf48tt:8tdrAllU,QCIIVHry.erdC4oa'and brntlng d iiv: S and no,4 S,yatdri',e,&80 AKSOfPl1 Quality Ciltarta.DSB•69 and aC51 eulfding Component 16023 Sw,ngley Ridge Rd Soraty grforiniNlon'hwfln4tq frn+ri T[usa[late tn8tiprt0,',00 10 N4en,5unnt:5u r a 312,Rte dr(n,VA223tR j Chesterfield,MO 63017 job - - russ - - TfussType Qty ly BUILDING D ROOF VINEYARD VIEW 1379389091 3597OR3 IG01 Common Girder 2 2 Job Reference optlonall - UmJersal"Component Corp„ EAST HAVEN CT 06512 f 8.010 s Aug 1 i 2017,WTek Industries,liar.Thu Jul 25 23 14 57 2019 AsQu 2 ID:uH81G91AM9 WQEtKnavHVNyuWBg-ydXYOioEFtg FPIvMZIafFM480gLxWIZH6T7hfyuNSy LOAD CASE(S) Standard 1)Dead+Snow(balanced)-Lumber Increase=1.15,Plate Increase=1.15 Uniform Loads(pit) Vert*1-4=-97,4-7=-97,2-6=-20 Concentrated Loads(Ib) Vert.8=-817(B)15=-824(B)17=-817(B)18=-817(B)20=-817(B)21=-817(B)23=-817(B) WARNING-Ver+Py design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE Mir-7473 rev.10/03/2015 BEFORE USE Ugs3yn yalld for me only%%hth 111TrSk�Er=lnactem Tih.da>I�n lg bnaal ally upon pnrantalorc shown,and is tar ari lndignlual bultding rAmpanani,nal {Mil�r -n tnt2n syeflm,Before uaa,Ibu"bullrllnp NpYL�M r mU t vludy,uul trpliriunGbty,vfgr:algn pat:finelv3 nDd t+rRr vIH btt p orate dus da.-Io Inla Rru 0vwoll. I�ePk uultdug'der4gn arJdngtndle6todisL®µrovcnlbaeldng,orindlvidunl��saw�hnndtarchaldriaambprson�y: Addienaltampamry,vkdpnrmtrnantbrectn0 is trtwraya raqutrud rar r,lall'ly ono to o anleoUapsc dd paxdW.n rimmnl inlury,and propcity damaga.For gmleral 2urdslica mp dmg Iba fntananr n,2uplfla.dallvo y,oreW 3n Diad b(Odng of vuSses tai J liuw syslwa9't. AHSMP11,f]ualiry Crfrari0;"RSB-00 and HCSI Bollding Component 16023 Swmgley Ridge Rd 'ScIaLy Inform talon n+;TSfahln tnNn'+nr5s ij3nl71n.'.LIW1D,2t8N_Lte.SiragLSuits'31�,J4fH�And-'(n.VR 22`31'l� Cfieatetfiald,M063D17 r Joh . russ - - Tnts-'7`11o: - - my Ply 113UILOJING D ROOF VINEYARD VIE4y 137938910, 35970R3 G02 .Comtrton Girder 1 3 ,lob Reference o 'Dna1 _Universal Component Corp.,` CASTHAVEX CF 0851.2 8 010 s Aug 112017 MITek Industries.Ipe Thu JUI 25 23 15.02 2019 Pagel ID uH81G9iAM9 f QEtYtravY.6+FryJ;"11;g fbKR3t2N4P:,ytflltS5i11F.�ISr20F6C}jff2}puMtufJSS a 34n &4-42 12.51 2084 16-T-0 2 25-2-1 29.8-t1 $4-1-14- 38.7-13-___ 43-d••t ).� •L3=10 { 4..-1_z - 4 -_4 rz a-1-z 4s:ss t:s is 4-5-15 —) 4-5-15 Scale=1.72 6 3.75 112 5x8 11 30 7 31 4x6 �'t 5x6 - 4x4 � 48 29 .,ic%/,'.' e- �``^+„r,..:. 32 46 4 48 33 48 10x10 4x34 27 1 i 10 4x4 4x8 11 4x8 2 2 ' // 34 4x4 zz 1 / • � � 1 35 0 d I - 3637 38 39 40 41 42 43 44 45 46 21 47 48 49 50 5152 53 17 54 5556 57 58 59 60 61 6i� o 24 23 22 20 19 18 16 15 14 10x10 II 4x4 II 4x4 = 4x4 = 8x14 MT18H WB = 8x8 = HUS26 5x6 =HUS26 46 = 4x4 = 2x4 II 6x14 = HUS26 HUS26 HUS26 HUS26 HUS26 HUS26 HUS26 HUS26 HUS26 HUS26 HUS26 7x10 MT18H = HUS26 HUS26 HUS26 HUS26 HUS26 HUS26 HUS26 HUS26 _ I _8� 12 t i—�-6.7-0_--- 20 •2 - 25-2-t 2t 2955 214.1-14- _- ----38--7--134.3 10 t -4438.4 -3-10ia-1. St-2 11•Z4 b44555 Plat Offsets LY)-- ..1:3.4-2,Q-2-uj,'12:0-4-3:0.5-n_[21:a2j7:0.4_81 74_ { - LOADING (psf) SPACING- 2-0-0 CSI. DEFL in (loc) I/defl Ud PLATES GRIP TCLL(roof) 30.0 Plate Grip DOL 1,15 TC 0,61 Vert(LL) -0.58 16-18 >900 240 MT20 197/144 Snow(Pf/Pg) 38.5/50 0 Lumber DOL 1.15 BC 082 Vert(CT) -0,86 16-18 >603 180 MT1 BH 197/144 TCLL 10 0 Rep Stress Incr NO WB 0.79 Horz(CT) 0,26 13 n/a n/a BCLL 0 0 Code IBC2015[TP12014 Matrix-S Weight-773 Ib FT=20% BCDL 10-0 LUMBER- - BRACING- ' �P CHORD 2x6 SPF No,2'Except' TOP CHORD Structural wood sheathing directly applied or 4-10-14 or purlins. 1-4,10-13 2x6 SPF 2100F 1,8E BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing IT CHORD 2x6 SPF 210OF 1 BE WEBS 2x4 SPF No.2 OTHERS 2x4 SPF No.2 SLIDER Left 2x6 SPF No.2 4-5-6 REACTIONS. (Ib/size) 1=10421/Mechanical,13=10895/0-5-8 Max Harz 1=76(LC74) Max Uplift 1=794(LC 12),13=-B16(LC 12) FORCES. (lb)-Max CompJMax.Ten,-All forces 250(lb)or less except when shown, TOP CHORD 1-2=-21388/1668,2-3=22419/1836,3-5=-21726/1860,5-6=-19738/1785, 6-7=-1735311640.7-8=-17365/1640.8-9=-20880/-1900,9-11=-24376/2088. 11-12=-2743112214,12-13=-28272/2169 BOT CHORD 1-24=-1454/19064.23-24=1454/19064,22-23=-1667/21392,20-22=-1652/20696, 19-20=-1544/18783,18-19=-1659119873,16-18=-187B/23220,15-16=-2042/26182, 14-15=-2003/26436,13-14=-2003126436 WEBS 2-24=-2611376,2-23=-240/2626,3-23=-951332.3-22=-923124,5-22=-75/2352, 5-20=-3035/165,6-20=-240/3817,6-19=-4251/305,7-19=-885/9689,8-19=-5721/472, 8-18=-36615096,9-18=-47751308,9-16=-194/3887,11-16---35771199,11-15=-62/2302, 12-15=-374/23,12-14=37/1568 NOTES- 1)3-ply truss to be connected together with 10d(0-131"x3•')nails as follows. OIF NESj_ Top chords connected as follows:2x6-2 rows staggered at 0-4-0 or.. r Bottom chords connected as follows`2x6-2 rows staggered at 0-7-0 Do. ��W JO&�s Webs connPrtrd as follows,2x4-1 row at 0-9-0 oc: Ir. 2)All loads are considered equally applied to all plies,except if noted as front(F)or back(B)face In the LOAD CASE(S)section,Ply toy?'" �x ply connections have been provided to distribute only loads noted as(F)or(B),unless otherwise indicated. 3)Unbalanced roof live loads have been considered for this design.. 4)Wind:ASCE 7-10,VuIt=130mph(3-second gust)Vasd=103mph;TCDL=6.0psf,BCDL=6Apsf;h=25ft-,B=45ft;L=24ft;eave=5ft;Cat, d a i• 11,Exp B;enclosed,M WFRS(directional),cantilever left and right exposed;end vertical left and right exposed;Lumber DOL=1.60 (f1 24 �- plate grip DOL=1.60 y `�' 'tfgrttf 5)TCLL•ASCE17-10,Pr=30.0 psf(roof live load.Lumber DOL=1,15 Plate DOL=1,15),Pg=50,0 psf(ground snow),Pf=38 5 psf(flat N� N 4, 3• �' roof Sri ow,Lumber DOL=1,15 Plate DOL=1 15),Category,11;Exp B,Partially Exp.;Ct=1 1 �?Ag 09943 6)Unbalanced snow loads have been considered for this design. "All plates are MT20 plates unless otherwise Indicated S1 This truss has been designed for a 10,0 psf bottom chord live load nonconcurrent with any other live loads ` This truss has been designed for a live load of 20.Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide July 26,2019 ��i tl ,p �i;at�"f<mtnmrs;nr�aiict.an nrlid�7ritdr_rrf}ers-- --- --- - --- - -- trtrs fi ®WARNING-Verily design parameters and READ NOTES ON THIS AND INCLUDED M1TEK REFERENCE PAGE Mll•7473 rev.10/03/2015 BEFORE USE t ❑asiprSwUdlctriCeantyral;hlN+TOtQ,6wgt0clan?offde4d1%"rodotfiyuponlitisuutti� raie sho ,artal5fortinindividualby�lidmgtamlmerit,riot, �* nUusg'b/Marr.`8afuratfoo;thahitlldmgdodgmrriursfvoiiy-the nppl1cafsllily,ofdasipnpnmmotoigpndprnpeg1ncorporntnthfador4nlnlatlok6wo01 °6ulidino ds:Jan.6mr�ip lad:�iau 1610 piavdnl hireklln0 afGidhdd6al ta+ss web icndlaehard me+aEoM e+rly,Adaitt(attaifemparpry`and pa:ma�eul6rorinq ��•r�t�( la ulways mquhcd ferrlairlhty and to jiv ftnt coiiapse xilh pasvitfij fiafeoaai,.fmy arta prariciry damagtL_For eunaral oufdaact ArOardnft 1F0 farxieallon,Momg%dailvery,niociloir And 0it9rip of tru55e:T4d Ire i 5ypleirm See' AN91ffP11 QuaUly COWIN DS"il and QCtil 4ulldtng component 16023 Smngley Ridge Rd -Safoty Infonnatlon a4hilabte from Truss-PWW lnaamio,21B N.1.60Sraet.Suite 312.&6nn4da,VA 22314. - - Chesterfield,MO 53017 Job ITTIUSS rD6s ryt�8, Qty Ply BUILDINGD,ROOF-VINEY,ARDVIEW 137938910 3597083 G02 C_amli;on Glyde:, 1 3toptianal) -- _t Up1versa1 Coplp"aril�p4h•. EAST HAVEN CT 06512 8,010 s Aug 11 2017 f>,AlTek itxlusltiuS,Inc.Thu Jul 25 23:1502 2019 Rage 2 ID•uH81G91AM9 WOEtKnavHVNyuWBg-JbKR3OsN4PIHLAit96dIMJ3rZOT6cgiROBuMtyuNSt NOTES- 10)Refer to girder(s)for truss to truss connections. 11)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 794 Ib uplift at joint 1 '12)Two RT5 USP connectors recommended to connect truss to bearing walls due to UPLIFT at jt(s)13.This connection is for uplift only and does not consider lateral forces ,13)This truss has been designed for a moving concentrated load of 250.011D live located at all mid panels and at all panel points along the Top Chord and Bottom Chord, nonconcurrent with any other live loads. 14)Use Simpson Strong-Tie HUS26('14-IOd Girder,4-10d Tluss,Slide Ply Gil del)ut eyuivdlent spaced at 2-0.0 oc max starting at 1-5-0 from the left end to 41 6 0 to connect truss(es)to back face of bottom chord, 16)Fill'all hall Niles win 1"I laiiyei ib ii-fwntact with lumber LOAD CASE(S) Standard 1)Dead+Snow(balanced),Lumber Increase=1.15,Plate Increase=1,15 Uniform Loads(plf) Vert 1-7=-97,7-13=-97.1-13=-20 Concentrated Loads(lb) Vert:18=-803(8)16=-817(B)17=-803(8)36=-662(B)38=-662(B)39=-662(8)41=-662(B)42=-662(8)44=-811(8)45=-803(8)47=-803(B)48=-803(6)50=803(8) 51=-803(8)53=-803(8)54=-817(8)56=-817(B)57=-817(B)59=-817(6)60=-817(8)62=-817(8) ®WARNING-Verily design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE M11-7473 rev 10103/2015 BEFORE USE. Design Vnlid for ane onlyhglh lf�oliD r4fr0t0choru-Thra deslgn la based entyupon Pammal: idum"n,and Iii ffA.-M Ilid;•ldual kiindirip compatient,not h Iraita WAiPrr adiWCi Vtie,itis tiu,tdinll 4aslfinef,M61 L'ei8y Dui uppDcabjtty of deoipn'pommotoin rind propatly fowp u iia thivdodgn lnlo the awrall hopdIng'&w4i HiadollQid'ieillndiOctprovoplbuodjng,afmoividunlIvVZtveband/orcMMm¢mbensditty.Addltlon:ilI&nJ10Alyntidpetp:nnl:tithrecing IWIT k- ls iltwnys rrrgwied for ntabdtty and le evtsftl CCdijtllS Willi 1 to parte=01 injury and property damage For genetol jiMance regarding the latnlc8ildn,storage,delivery,erection and bracing of trusses and truss systems•sea ANSIrrPl1 quality Cdtedni DSB•69 and Best Building Component 16023 Swmgley Ridge Rd -salelyinformetian available from Truss Plate Institute,218 N.Lee Street,Sulle 312,Mexandna,VA 22314. Chesterfield,MO 63017 Job Truss _ nrssTyprr - "" Qty Ply BUILDING D ROOF VINEYARD VIEW 137938911 3597083 G03 GnInmo11-Girder, 1 y Job Reference o honal__._ __ _ ... __.- .-. _ Universal Component Corp.,, EAST HAVEN CT 06512 - B.WO s Aug 112017 MiTek Industries,Inc.,Thu Jul 25 23 15 04 2019 Page 1 ID uH81G9iAM9_5"✓QEtKnayHl'NyuWBy FzSCU6tdoOY?aJt:GGXfDP.h8EQgAN4eLbulg?RIyuNST C-10.9, 2-2-93.8-t1 7.2.14 10.9•1 _ - -_ _ _145.12 15-•4-4.- t10 8 2-2-8 _., 1 6� 3-6-3 3-6.3 4x4 I I Scale=1:49.9 4 12 k 12.00 12 11• 1x4 / 5 5x6 /Z / ! 3 13 10 6 9 15 8 16 � � o 4x8 // 4xB 4x14 II 4x8 = Special 2-2-8 4•1012 'i•2-74 9-7-0 2-F�} 2�2 2.4.2 _ --- PIotL C7ffsets X(,_��=_;2.[.—Q-�rg�ls.i3:at�i2;a•2•a�.[6:0�•14.a-2,a��- -- - - - - LOADING (psf) SPACING- 2-0-0 CSI, DEFL. in (loc) I/deft L/d PLATES GRIP TCLL(roof) 30.0 Plate Grip DOL 1.15 TC 0,39 Vert(LL) -0.05 B-9 >999 240 MT20 197/144 Snow(Pt/Pg) 38,5/50.0 Lumber DOL 1.15 BC 0.71 Vert(CT) -0A8 8-9 X999 180 TCbL 1010 Rep Stress Incr NO WB 0.72 Horz(CT) 0.01 6 n/a nia aCLL L 10.0 Code IBC20i5/TPI2014 Matrix-S Weight.268 lb FT=20% LUMBER- BRACING- P CHORD 2x4 SPF No,2 TOP CHORD Structural wood sheathing ditecily applied or 6-0-0 oc purlins, T CHORD 2x8 DF No,2 BOT CHORD Rigid telling directly applied or 10-0-0 oc bracing. BS 2X4 SPF No.2 PLY-TO-PLY CONNECTION REQUIRES THAT AN APPROVED WEDGE FACE MOUNT HANGER(SPECIFIED BY OTHERS)IS REQUIRED AT Left 2x4 SP No.3 JOINT 9 FOR LOAD REPORTED IN NOTES.FACE MOUNT HANGER SHALL BE ATTACHED WITH A MINIMUM OF 025'x 4 5°SCREWS OR OTHER FASTENERS THAT PENETRATES ALL PLIES,PER HANGER REACTIONS. (Ib/size) 2=9860/0-5-8.6=2396/0-5-8 MANUFACTURER SPECIFICATIONS. Max Horz 2=182(LC 9) Max Uplift 2=-761(LC 10),6=182(1_C 10) FORCES. (lb)-Max.Comp IMax.,Ten.-All forces 250(lb)or less except when shown. TOP CHORD 2-3=-11203/828,3-4=-27821249,4-5=27211266,5-6=-2963/230 BOT CHORD 2-9=-539/7227,8-9=-53917227,6-B=-57/1891 WEBS 3-9=68418810,4-8=-270/3256,3-8=-5949/558 NOTES- 1)n/a 2)3-ply truss to be connected together with 10d(0.131"x3")nails as follows, Top chords connected as follows 2x4-1 row at 0-7-0 oc. Bottom chords connected as follows,2x8-4 rows staggered at 0-0-0 Co. Webs connected as follows:2x4-1 row at 0-9-0 oc- 3)All loads are considered equally applied to all plies,except If noted as front(F)or back(B)face in the LOAD CASE(S)section.Ply to ply connections have been provided to distribute only loads noted as(F)or(B),unless otherwise indicated 4)Unbalanced roof live loads have been considered for this design. 5)Wind:ASCE 7-10,Vult=130mph(3-second gust)Vasd=103mph;TCDL=6..Opsf,BCDL=6.Opsf;h=25ft;B=45ft;L=24ft;eave=oft,Cat. aF NEln. II,Exp B;enclosed,MWFRS(directional);cantilever left and right exposed;end vertical left and right exposed;Lumber DOL=1 60 �V plate grip DOL=1.60 C�� (G1j1� jo 0. 6)TCLL.ASCE 7-10;Pr-30.0 psf(roof live load:Lumber DOL=1,15 Plate DOL=1,15),Pg=50,0 psf(ground snow);Pf=38,5 psf(flat , roof snow;Lumber DOL=115 Plate DOL=1.15);Category Il;Exp B;Partially Exp;Ct=1 1 7)This truss has been designed for greater of min roof live load of 12.0 psf or 1.00 times flat roof load of 38.5 psf on overhangs * ' non-concurrent with other live loads. (' Ir 8)This truss has been designed for a 10.0 psf bottom chord live load non concurrent with any other live loads. 9)`This truss has been designed for a live load of 20 Opsf on the bottom chord In all areas where a rectangle 3-6-0 tall by 2-0-0 wide 4`T Lu will fit between the bottom chord and any other members 10)Two RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT at jt(s)2.This connection is for uplift only and does not consider lateral forces. 11)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT at jt(s)6.This connection is for uplift only and does not consider lateral forces OPESti14�' )This truss has been designed for a moving concentrated load of250.01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. July 26,2019 ALWARNINd-Verify design parameters and READ NOTES ON THIS ANO INCLUDED AIITEK REFERENCE PAGE Mll-7473 ret,1010312015 BEFORE USE btia{pn-inilit forusb 6idyui0i amn Is 60W snly'd;ion parameters snbwn,pnAiii for naln"ual IcilAOlnp cnmtmnent.not is truss syiifom:antero unz.'Uio building dni0nnr must vdnf/the opphcahWty or deslUn psmmotius and tRupat y hictwi itUus dnslori Inlorho wwoll 'tA1lhVrpdesrpe 9hr�tnq'kMicnMlflatoprnvafdbnckfnpotlirdluk7unthuss�vebandrordrbtdmembeisonly,Addilladallemewalyarid Porma"AllirO �� cing, ek*- In slwny5 required for siabitily.ond to provr:nf Calloit8n.W(h passlb!o panonp)injury and property damage,Fra pent:raf purdincu ro9anllnd IhA- taGtlb llun,6 QNIge 46i"' 16023'uratllotr and biaefnp of trusses and VUS syatams,cuo.-- ANSIftPit Qunllty Crliedo,0$H 58 and OCSt 9ui{d(ng Camponant 16023 Swingley Ridge Rd So[ety fnfanbYulan nvnllabfa'0mxi7nrss t?Iuto lnahllli�r 218 N�LecSliu:f.'&raiUf`3,12,N cnrtAria,•Vh,y1'_3t,i,,- Chesterfield,MO 63017 Job - Truss- Truss--Type Qty Ply BUILDING D ROOF VINEYARD VIEW 137938911 35970R3 G03 6mm-on Girdor 1 .lob Reference(ootlonall-- - Universal Component Corp,, EAST HAVEN CT 06512- ' 8.010 s Aug 11 2017 MITek Industries,Inc,Thir Jill 25 23:1504 2019 Page 2 ID:UH8IG91AM9 WQEtKnavHVNyuWBg-FZSCU6tdcOY7aUvFGXfDRk8EQgAN4eLbuig7RlyuNSr NOTES- 13)Hanger(s)or other connection device(s)shall be provided sufficient to support concentrated load(s)10401 Ib down and 814 Ib up at 2-2-8 on bottom chord,The design/selection of such connection device(s)Is the responsibility of others- LOAD CASE(S) Standard 1)Dead+Snow(balanced):Lumber Increase=1.15,Plate Increase=l 15 Uniform Loads(pif) Vert: 14=-97.4-7=-97,2-6=-20 Concentrated Loads(lb) Vert.9=10401(17) INN 1-1 1 WARNING-Verify design parameters and READ NOTES ON THIS AND INCLUDED MITEH REFERENCE PAGE Mll-7473 rev 1010312015 BEFORE USE D,sign Satld fix uocrmty w;tli hifTokFJrahnoctors.Tnh dez-Ogn NOW':ontyifpon pnmrnolen;shown,and in Im an Indnidrral twi3ding corrpannnl,not �• A iruta systom 8atam S tA,0to bit ldn p'do dgnw mugt,+gnfy the nprkle lirirdy of doilgn liatamoinrs bint topowly bletNparafn gW do•gn lento the worell- �` 'Wildthg �/�design stating lndicet?d Fa lapmynnl ti-ucldlnlj of lndrvldunl bliss web andrpr chard tnWnhers mt)._AddhidnAi lampwnry vr:l pcmranard txacing !V!)y•OW J - 4 gWy0 raquired for Alutu'idy Ano to of(T`.sl VA11 0 With pt'slawe pernnnl Injury and pt«"pOrty rlJlllr3gfl.FR'-tJelibr QSriridnrt?r iCQD!{1 rSg ilrn- tOr_Trstku,,nimpAi ;faty�rv,r3reiti�n nn+I 11`rnt3na of Sri1>.~400'niW hrees-hrslems,Uea ANSIlTPH aiaiuiyCmeda,059419 4nd,0C5f Building Component 1623 hewIngMlO 63017ay Ridge Rd Cra Sajotyinlormntlon nYndobinjomTnrss;Ptntotitiiurio; 9iSN:9eeStfofl'S+iIfL9l giimafalna'Vs1:?3t4.- �he eld, Jobµ russ Truss Type aty Ply BUILDING D ROOF VINEYARD VIEW 3597OR3 G04 COMMON GIRDER 1 137938912 3.-Jolo-Reference/optional _ Universal Component Ccfp,, EASTti,VEht'GT06512 8,010 s Aug 11 2017 MTek Industries,Inc,Thu Jt1125 23:15:09 2019 Pagel tD7uH�fG6fAM9_4if4�ft!navFYVtdwbd8g= 5�ftt) i38nszkm�ts�K2,Rfriy6zyuf�Srr� 44.7 9'2-6 13-8.4 18.2.3 -=.22-a-a_.__` -. 27-2.1'. 31-6-0 -36-i-44,SrnQZS3tthF�34E— 40:7:13__, 45.4 4-8-7 4-5-15 _ r 515 $5 15 4-5-15 4-5-15 A-5.16 A S•i5' 4-5 15` -- —4—&7 Scale=1.79,8 3,75;12 6x8 it 28 7 29 .., 5x6 "'-""^--,_ 5x6 5x64x6 y a� � ,,M._. .m. 30 . ,.,4xzz ` bx6 4x4 4 �': 10 4x4 5 . ` r 4x4 26 % 31 4x4 HUS26 2 �`,. - T - 12 32 13 w. 0 33 34 35 36 37 38 39 21 40 41 42 43 44 45 46 47 17 48 49 so 51 52 53 54 55 24 23 22 20 19 18 16 15 14 5x12 MT18H = 2x4 11 HUS26 4x4 =HUS26 700 MT18H = HUS26 8x8 = HUS26 5x6 =HUS26 4x6 = 04 = 2x4 II 7x10 MT18H = HUS26 HUS26 HUS26 4x6 = 5x8 = HUS26 HUS26 7x10 MT18H = HUS26 HUS26 HUS26 HUS26 HUS26 HUS26 HUS26 HUS26 HUS26 HUS26 HUS26 l—4-8-7 9-2-6 a .TBS f �18_2--3- - _ 22-8-2 --27-24 --- _ . ,. _ 4544 4.8-7- 1515 ,islsieOffsets X YX Y LOADING (psf) SPACING- 2-0-0 CSI., DEFL. In (loc) Ildefi L/d T PLATES GRIP TCLL(roof) 300 Plate Grip DOL 1.15 TC 0.93 Vert(LL) 469 20-22 >783 240 MT20 197/144 Snow(Pf/Pg) 38.5/50 0 Lumber DOL 1.15 BC 0.88 Vert(CT) -1.03 20-22 >525 180 MT18H 197/144 TCDL 100 Rep Stress incr NO WB 0.87 Horz(CT) 0,31 13 n/a n/a BCLL 0,0 Code IBC2015frP12014 Matrix-S Weight:777 ib FT=20% LUMBER- BRACING- - " ?CHORD 2x6 SPF 21 OOF 1.8E*Except* TOP CHORD Structural wood sheathing directly applied or 3-2-15 oc purlins. 1-4:2x6 DF No 2 HOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing 'r CHORD 2x6 SPF 2100F 1.8E WEBS 2x4 SPF No.2 REACTIONS. (Ib/size) 1=11679/0-5-8,13=1 144310-5-8 Max Horz 1=76(LC 73) 'Max Uplift 1=-885(LC 12),13=-882(LC 12) FORCES (lb)-Max.Comp./Max-Ten--All forces 250(lb)or less except when shown, TOP CHORD 1-2=-29717/2338,2-3=-28955/2401,3-5=-26045/2293,5-6=-2263012111, 6-7=19155/1856,7-8=-19155/1856,B-9=-22627/2111,9-11=-2610912297, 11-12=-29113/2416,12-13=-29793/2353 BOT CHORD 1-24=-2162/27797,23-24=2162/27797,22-23=-2220/27637,20-22=-2073124809, 19-20=-1859/21540,18-19=-1859121537,16-18=-2077124871,15-16=2236/27788, 14-15=-2175/27861,13-14=-2175/27861 WEBS 7-19=-1004110683,8-19=-56591461,8-18=-38115079,9-18=-47821307,9-16=-19113865, 11=16=-3521/192,11-15=-5612241,12-15=-310/108,12-14=-3611544,6-19=56651461, 6-20=-38215083,5-20=-4690/301,5-22=-18713786.3-22=-3414/178,3-23=-45/2164, 2-23=-342148,2-24=-36/1562 NOTES- 1)3-ply truss to be connected together with 10d(0.131"x3")nails as follows: Top chords connected as follows,2x6-2 rows staggered at 0.4-0 oc, Bottom chords connected as follows.2x6-2 rows staggered at 0-5-0 oc ' Webs connected as follows:2x4-1 row at 0-9-0 oc. 2)All loads are considered equally applied to all plies,except if noted as front(F)or back(B)face in the LOAD CASE(S)section.Ply to Zip ply connections have been provided to distribute only loads noted as(F)or(B),unless otherwise indicated, 3)Unbalanced roof live loads have been considered for this design. 4)Wind.ASCE 7-10;Vult=130mph(3-second gust)Vasd=103mph,TCDL=6,Opsf;BCDL=6.Opsf,h=25ft;B=45ft;L=24ft;eave=6ft;Cat. 11;Exp B;enclosed;MWFRS(directional);cantilever left and right exposed,end vertical left and right exposed,Lumber DOL=1,_60 ;r plate grip DOL=1.60 5)TCLL'ASCE 7-10;Pr--30,D psf(roof live load:Lumber DOL=1,15 Plate DOL--I,.15),Pg=50',0 psf(ground snow),Pf=38 5 psf(flat Ti9' 2 roof snow Lumber DOL=1 15 Plate DOL=1 15),Category II;Exp B;Partially Exp.,,Ct=1.1 6)Unbalanced snow loads have been considered for this design _ ,�O �' 7)All plates are MT20 plates unless otherwise indicated. 06 '00994 -09943 . � 8)This truss has been designed for a 10,0 psf bottom chord live load nonconcurrent with any other live loads, 9)'This truss has been designed for a live load of 20.Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide ��Eggilo vill fit between the bottom chord and any other members. Two RTS USP connectors recommended to connect truss to bearing walls due to UPLIFT at jt(s)1 and 13i This connection is for July 26,2019 ®WARNING-Verify design parameters and READ NOTES ON THIS AND INCLUDED MITEKREFERENCEPAGE Mil-7473 rev;f6/0712016 BEFORE USE t gn est i for use a ay q ith MiTet 0 f'�11pt cttxs.'This d�gn ts, s tf only upon 1i4nli0eErrtt*t uv n p 1G liar 11n trid&rhituzit wading Coaiil#nkenL not x trvas syt ttar.aefonx otic,the bwidWp derHlls�rrnttsfvontt the ppplr`rai�hty or dein paramet4rc 41111 pm{m+t/inwrmia rHiad`aetgnrntp the a+sial/ hu?isffny'tti.`Glgn. BraatngicMicaledislaj:resrCtltNfcHl[egad+tdividUp)truss webandIordigr4alarp4limanty,'J((ShclfOnpi-trim{t t}ryMrdposfntriumlbracing '�'� ' is always required for stability and to prevent collapse wdh possible personal injury and property damage For general guidance regarding the - fbbll tlon;,5tvrii}�o;CdllvariJ,ereclion and bracing of trusses and truss systems,see ANSIirPit Quality Criteria.DS8.80 and BCSI Building Component 16023 Swingley Ridge Rd .$alatpinfontt$tionr:,vai100 from Truss Plate Institute,218 N Lee Street,Suite 312,Alexandria,VA 22314. Chesterfield,MO 63017 t Job russ Truss Type Qty - -Ply BUIhUING D`RDRF VtNEYARA VIEW - 137936912 36970R3 G04 COMMON GIRDER 1 3 -_--- — --- -Job RLteriCe,faPtien -m Urpiv[p at C.isrripotteni Carp„ EAST HAVEN CT 06512 6,010 s d,irg 112017 nrl a 9t1dUSlfiBs,Inc Thu Jul 25-23-15:092019 Page 2 ID:uH61G9iAM9 WQEtKnavHVNyuWBg-cxG5XpxmQZBHhFoD34FOenszkrmisBK2_Nm6zyuNSm NOTES- 11)This truss has been designed for a moving concentrated Iliad of 250 01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord, nonconcurrent with any other live loads. 12)Use Simpson Strong-Tie HUS26(14-10d Girder,4-10d Truss,Single Ply Girder)or equivalent spaced at 2-0-0 oc max starting at 1-5-0 from the left end to 43.5-0 to connect truss(es)to front face of bottom chord 13)Fill all nail holes where hanger is in contact with lumber. LOAD CASE(S) Standard -s "1)De6d+8ituw(bdlditeed)"LuinLeTln%iease=l.1G,Pliti�Increase■1:15 Uniform Loads(pif) Vert:1-7=-97,7-13=-97,1-13=-20 Concentrated Loads(lb) Vert 18=-803(F)16=-817(F)22=-803(F)23=-803(F)17=-803(F)33=-B01(F)35=-803(F)36=-803(F)38=803(F)39=-603(F)40=-803(F)41=-803(F)42=-803(F) 44=-803(F)45=-603(F)47=-803(F)48=-817(F)50=817(F)51=-817(F)53=-B17(F)54=-817(F)56=-817(F) t ®WARNING-Verify design parameters and READ NOTES ON THISAND INCLUDED MITEK REFERENCE PAGE Mff-7473 rev,1010312Df5 BEFORE USE Doclgn yplid for use wily rt; Job Truss -Truss Type Qly Ply BUILDING D ROOF VINEYARD VIEW 1 37 9313 9 1 3 5970R3 JOI Jack-Closed 1 1 I _ _____ Job Reference tiagonall _ Universal Component Corp., EAST-HAVEN CT 06512 8.010 s Aug 112017 MITek Industries,Itic:'TftuJbl25 2315.10 2019 Page 1 !D•uH8l�91AM9_WQEtKnavHVNyuWBg-47pTk9yOBsJ81PMPdnm11h70HbFNSU W4TGe7JePyuNSI 1.510 - 1-6-15 1=S f0 Scale=1.10,5 2x4 11 4 3 -_- 6,66 12 t 2 1' 6 3x6 If -9-- - 1x4 115 1-5-1 Plate Offsets - LOADING (psf) SPACING- 2-0-0 CSI. DEFL. In (loc) I/deo Ud PLATES GRIP TCLL(roof) 30.0 Plate Grip DOL 1 15 TC 029 Vert(LL) -0,00 6-7 >999 240 MT20 197/144 Snow(Pt/Pg) 36 5!50.0 Lumber DOL 1.15 BC 0.09 Vert(CT) -0.00 6-7 >999 180 BCDL 10.0 Rep Stress Incr YES WB 0.00 Horz(CT) -000 5 n/a n/a BCLL 0.0 Code ISC2015/TP12014 Matrix-S Weight.7lb FT 20% BCDL 1U.� LUMBER- BRACING- --' CHORD 2x4 SPF No,2 TOP CHORD Structural wood sheathing directly applied or 1-5-10 cc purflns, F CHORD 2x4 SPF No.2 except end verticals, BS 2x4 SPF Not*Except` BOT CHORD Rigid ceiling directly applied or 6-0-0 cc bracing. 3-6 2x3 SPF No,2 REACTIONS. (Iblsize) 7=35410-8-13,5=-32/Mechanical Max Harz 7=59(LC 15) Max Uplift 7=-93(LC 16),5=-84(LC 20) Max Grav 7=356(LC 21),5=212(LC 34) FORCES. (lb)-Max,Camp./Max Ten.-All forces 250(lb)or less except when shown. TOP CHORD 2-7=-3151161 NOTES. 1)Wind,ASCE 7-10;Vult=130mph(3-second gust)Vasd=103mph;TCDL=6,Opsf;BCDL=6.0psf;h=25ft;B=45ft;L=24ft;eave=4ft-,Cat. Il;Exp B,enclosed,MWFRS(directional)and C-C Corner(3)zone;cantilever left and right exposed;end vertical left and right exposed;C-C for members and forces✓3,MWFRS for reactions shown;Lumber DOL=1.60 plate grip DOL=1.60 2)TCLL•ASCE 7-10;Pr=30.0 psf(roof live load:Lumber DOL=1,15 Plate DOL=1.15),Pg=50 0 psf(ground snow),Pf=38 5 psf(flat roof snow-Lumber DOL=1,15 Plate DOL=1 15);Category Il;Exp B;Partially Exp.;C1=1.1 3)Unbalanced snow loads have been considered for this design. 4)This truss has been designed for greater of min roof live load of 12,0 psf or 1,00 times Oat roof load of 38.5 psf on overhangs non-concurrent with other live loads. 5)This truss has been designed for a 10,0 psf bottom chord live load nonconcurrent with any other live loads 6)*This truss has been designed for a live load of 20.Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide voll fit between the bottom chord and any other members, 7)Refer to glyder(s)for truss to truss connections. - 8)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 93 lb uplift at joint 7--- 9)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT at jt(s)5.This connection is for uplift only and does not consider lateral forces. J O° 10)This truss has been designed for a moving concentrated load of 250.01b live located at ail mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads, I— 1 a v CC U 0994. S614��: July 26,2019 A WARNING-Verify design parameters and READ NOTES ON THIS AND INCLUDED MiTEK REFERENCE PAGE MII.7473 rev.10/03/2015 BEFOREUSE. 'OdsJgnvalidlartr.aonlywlifMITn's'1�aRf7nCR1R1SThin'r~-++sign)rsbgsad tY,uponparametiirnstlawn,iodi6,inranIadli/,dwif'�-dfldlrtpcompart(int,not I abha5system.f3bfretaumthOOiilid{IrjdeJgnetmuitven�s•(he:fl1rXc3fdGtyordesignpersmstared6bpniparfyl6ebt'horn!athia'derlpninto O(e-averall Welk,tiulidfng dmtaq.Bra'cin`g lodlc`rfiad(a lopmtnnf btRkting ar,ndi•,ldunitNsa SSEb and70.'ehard maiphara orlty,Addllforial temporary and panfimiahl bracing Mitek" `isiW"V inquired far,4bibillly and tD(N 4 nt oallap've villi Is^a4iWii t°CtSarthlinjury and property damage For general guldarice regarding the fabncallon,storage,delivery•erection and bracing of trusses and truss systems,see ANSUTP11 Quality Cflloda,BSB-89 and BCSI Building Component 16023 Swingley Ridge Rd Safety Information available from Truss Plate Institute,218 N Lee Street,Suite 312,Alexandria,VA 22314 Chesterfield,NO 63017 Qty T Ply BUILDING D ROOF VINEYARD VIEW Job -- - - fuss -- -- Truss Type - 137938914 3597OR3 M01 Monopltch Supported Gable 4 1 Job Reference o tionall- — UNYersal Component Carp EAST HAVEN CT 08512 8.010 s Aug 112017 MITek Industries,Inc.'Tfiu Jul 25 23:15:112019 Page 1 ID uHBIG91AM9_WQEtKnavHVNyuWB9-YKNryVyDyAR?wyxbAVHsDCxPiffDDxJdVlstBryuNSk 5•E-12 '5r8!} 5-6-12 0.1.8 Scale=1 3x6 1110 3��4" 3,00 12 7 B � 1� `� �,,,,,,,�"'"''�'- .O'er•�'-'�� o 1 _ z' _w q'`err;+... {,f<¢aA',;,�a,�.;i,�,`. �,',r:' .'.'�,:-"rd.'-r3'�..yar`u�s, '2:♦ r,;• _r`�<` ;' ' i; ,`% aa<' `"'•<•',"iJ+l :;,-."�' :u .mr^`�y, ,S .;. R.T -'n,>,'.r`.r•J,.".. _`:.i 11 6 12 5 4x4 3x6 11 1x4 I I LOADING (psf) SPACING- 2-0-0 CSI. DEFL. in (loc) Udefl L/d PLATES GRIP TCLL(roof) 30-0 Plate Grip DOL 1 15 TC 0.45 Vert(LL) 0.00 3 Ink 120 MT20 1971144 Snow(Pf/Pg) 38.5/50.0 Lumber DOL 1 15 BC 0.37 Vert(CT) 0.00 3 n/r 120 TCDL 10.0 ` Rep Stress fncr YES WB 0.13 HOrz(CT) 0,00 5 n/a W& BCLL 00 Code IBC2015frP12014 Matrix-S Weight:15 Ib FT=20% SCDL LUMBER- BRACING- TOP CHORD 2x4 SPF No.2 TOP CHORD Structural wood sheathing directly applied or 5-6-12 oc purlins, BOT CHORD 2x4 SPF No.2 except end verticals. WEBS 2x3 SPF No.2 BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing. OTHERS 2x3 SPF No.2 REACTIONS. (Ib/size) 1=22115-2-4,5=351/5-2-4,6=79216-2-4 Max Harz 1=56(LC 13) Max Uplift 1=9(LC 12),5=416(LC 37),6=-66(LC 12) Max Grav 1=325(LC 35),5=124(LC 40),6=851(LC 21) FORCES. (lb)-Max Comp./Max Ten.-All forces 250(lb)or less except when shown. TOP CHORD 3-5=-240/332 WEBS 2-6=-7111454 NOTES- 1)Wind:ASCE 7-10;Vult=130mph(3-second gust)Vasd=103mph;TCDL=6.Opsf;BCDL=6.Opsf;h=25ft;B=45ft,L=24ft;eave=2ft;Cat. 11;Exp B,enclosed;MWFRS(directional)and C-C Comer(3)0-0-D to 3-0-0,Exterior(2)3-0-0 to 5-B4 zone;cantilever left and right exposed;end vertical left and right exposed;C-C for members and forces&MWFRS for reactions shown;Lumber DOL=1.60 plate gnp DOL=1.60 2)Truss designed for wind loads in the plane of the truss only. For studs exposed to wind(normal to the face),see Standard Industry Gable End Details as applicable,or consult qualified building designer as per ANSI1TPI 1. 3)TCLL•ASCE 7-10;Pr=30.0 psf(roof live load:Lumber DOL=1 t15 Plate DOL=1 15);Pg=50,0 psf(ground snow);Pf=38.5 psf(flat roof snow'Lumber DOL=1.15 Plate DOL=1.15);Category 11;Exp B,Partially Exp.;Ct=1 1 4)Unbalanced snow loads have been considered for this design: 5)Gable studs spaced at 2-0-0 oc- 6) �� 6)This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads 7)'This truss has been designed for a live load of 20.Opsf on the bottom chord to all areas where a rectangle 3-6-0 tall by 2-0-0 wide .�� - IV J00 will fit between the bottom chord and any other members. 8)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 9 Ib uplift at joint 1,416 Ib uplift at joint 5 and 66 Ib uplift at joint 6 SC { -k 9)Non Standard bearing condition, Review required. 10)This truss has been designed fora moving concentrated load Of 250 Olb live located at all mid panels and at all panel points along �LL the Top Chord and Bottom Chord,nonconcurrent with any other live loads, cSI�QA 0.0 ��FES5I�NA July 26,2019 ®WARNING-Verify design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCEPAGE MII.7473 rev.10/03/2015 BEFORE USE i Da3f4n vnnd lar aria unlywtir tkToVo ceaulactom-mft 00,110 in triad caly,upon porainoin G"Jrowm,arid;,rm0n indeu{dunl Aurdnp eompunitnl,not i a kitsa aYstnm,t30far0 uG9.pia bvu{ng dnr pnofnwo{�orih tho tp{tlit3h}ftly nt r}Ocr6tl ib«held s Brij prap&;y incwpotWe thV lids ail Int the Moran, 4 "�k txillun0 Grslpn,8. ^-llrlp lnd'ra{ad tb in irrovcnl EoiWJnp al[ndrvldu0l Uuc;B wqb nndlnr ehdr0 ntiCntbtrsan7y fddd:crit!Inmpemry and pnrm40anl�hraop4 ["wayaroquuadforatahdiiyam{toprmonlcvtl*ov%ltn{pot elmraonniinPl��Atloropo±tydamegn.rr{rmraainvdani munfdfnprnu, 'µ16023 Swingley Ridge Rd ✓ - M Intuisntfun,susinra,cdnvrry n1W1ori and bin'cn9 01;irises and truzo,sy4 e".not, ANa1rFmi Quntiiy Criteria,DSH-89 and 801 Building Component Salo{y Information Wallablotrom Tnis&r'1Rto irlsuu:k9,2t8{,1.Loo 5peo4Suito 3r2;At�atnndriu,VA 2231§t Chesterfield,M063017 Job Truss Truss Type ]Qty ply BUILDING D ROOF VINEYARD-VIEW 137938915 95970R3 M02 Monopltch 25 1 --- - - ob Reference Donal Universal Component Corp., EAST HAVEN CT 06512 8,010 s Aug 11 2017 Mfrek Industries„Inc Thu JUI25 23:1$;12 2019 Pagel ID uH81G9iAM9_WOEtKnavHVNyuWBg-OWxD9rzflUZsYNVokCo5mQUV12w1yQZmkycQllyuNSj 5:a`-1Q Scale=1.12,6 2 3 1k 3 00 12 7 5 8 46 11 8 4 4x4 = 1x4 11 0-4.8 - - - ------ - -- _ 5-2'4 -- Plale Offsets CK Y) LOADING (psf) SPACING- 2-0-0 CSI, DEFL. in (loc) I/deft L/d PLATES GRIP TCLL(root) 30.0 Plate Grip DOL 1 15 TC 0.80 Vert(LL) -0.18 1-4 >360 240 MT20 197/144 Snow(PflPg) 38.5/50.0 Lumber DOL 1 15 BC 066 VertCT -022 1-4 >285 180 BCDL 10.0 Rep Stress Incr YES WB 0.00 Horz(CT) 0,00 4 n/a n/a BCLL 0,0 Code IBC2015/TP12014 Matrix-S Weight:15 Ib FT=20% ,BCDL_ -10 LUMBER. BRACING- _ - - -- --— Tna CHORD 2x4 SPF No.2 TOP CHORD Structural wood sheathing directly applied or 5-6-12 oc purlins, F CHORD 2x4 SPF No,2 except end verticals BS 2x3 SPF No,2 BOT CHORD Rigid telling directly applied or 10-0-0 oc bracing, vvtDGE Left,2x4 SPF No 2 REACTIONS_ (ib/size) 4=331/Mechanical,1=308/04-8 Max Horz 1=56(LC 13) Max Uplift 4=27(LC 12),1=-17(LC 12) Max Grav 4=361(LC 21),1=355(LC 34) FORCES. (lb)-Max.Comp./Max.Ten.-All forces 250(lb)or less except when shown. TOP CHORD 2-4=308/132 NOTES- 1)Wind.ASCE 7-10;Vult=130mph(3-second gust)Vasd=103mph,TCDL=6.Opsf;BCDL=6 Opsf;h=25ft,9=45ft,L=24ft,eave=4ft,Cat_ II;Exp B;enclosed;MWFRS(directlonal)and C-C Exterlor(2)0-24 to 3-2-4,Interior(1)3-2-4 to 5-8-4 zone;cantilever left and right exposed;end vertical left and right exposed;C-C for members and forces&MWFRS for reactions shown,Lumber DOL=1.60 plate grip DOL=1.60 2)TCLL•ASCE 7-10;Pr=30 0 psf(roof live load-Lumber DOL=1.15 Plate DOL=1.15);Pg=50 0 psf(ground snow),Pf=38 5 psf(flat roof snow.Lumber DOL=1 15 Plate DOL=1.15),Category ll,Exp B;Partially Exp.;Ct=1 1 3)Unbalanced snow loads have been considered for this design. 4)This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads. 5)'This truss has been designed for a live load of 20.Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide will fit between the bottom chord and any other members. y�! aF NEl•V 6)Refer to girder(s)for truss to truss connections. 7)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 27 Ib uplift at joint 4;_ �Q+ �q( J0 Q B)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT at jt(s)1.This connection is for uplift onlyand does not consider lateral forces, 9)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along l! the Top Chord and Bottom Chord,nonconcurrent with any other live loads. .G ' Tit .r ' �fi't'�p��• a99A��.,. ��, . July 26,2019 A WARNING•Verify design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE 11,111.7473 reK 10103/2015 6EFORE USE [€ ) Design valid for use only with MiTeM connectors,This design Is based only upon parameters shown,and is for an individual budding component,not a truss system.Before use,the building designer must verify the applicability of design parameters and property incorporate this design Into the overall p�;g t”, building design Bracing indicated is to prevent buckling of Individual truss web and/or chord members only.Additional temporary and permanent bracing lVll!p. ' is always required for stability and to prevent collapse with possible personal injury and property damage.For general guidance regarding the _ fabrication,storage,delivery.erection and bracing of trusses and truss systems,see ANSIRPit Dualtty Criteria,DSB•89 and BCSI Building Component 16023 swingley Ridge Rd Safaty Information available from Truss Plate Institute,218 N Lee Street,Suite 312,Alexandria,VA 22314. Chesterfield,MO 83017 Job`` '_ - russ - russTypQ - - -- - Qty P{y BUILDINGD FloVINEYARDVIEW =137938916 95970R3 01 Common 14 1 oti'Rslrsranes a Ilorritq, Unlvetsnl Component Corp.,' EAST HAVEN CT 06512 `" •8;010 5 Y911 2017 rJjTWInd'ustdes,Inc-Thu Jul 25 2a1514 2019 Pnge;1 vF5panOgAsdgZrrZorsbtQ5Q3BF5XnAyuNSh ID:uH81G9iAM9 WQEtKnavHVNyuWBg-yu3_aX7 Olt 0.8 f T X20=&2_ ' 7-5-14 -- -°I 7 51436-7=14, -7�I$ '' ? - 8-9-14S•9-14 Scale=1' ' 3,75 12 -mi v<„ _ w u.•._ 26' n .6. 4x4 _ 6x12 25 ^,_ Z7 28 3x10 45f 7, 829 23-24. ' 30 4x4 " 4x4 3 9 3x8 Zz 6x8 MT18H% 22 - 10 3x8 21- _ 31 12 Ir; 37 32 33 19 17 34� 16 w 35 1614 36 19 6x12 = y0 19 5x8 MT18H = 4x8 4x4 = 2x4 11 5x8 MT18H 11 8x8 = 4x4 = 5x12 MT18H = 7.0.6 13-104 20•$2. 28-2-0 357-14 ------ - 4344 - "6=9-14 4•x14•. PI`ate Offsets fX Y)=_Cl 0-3 0 0�2 0) 15:01?.=d:0.3 011:0 4 055.3. 19;O: S,Ed e; LOADING (psf) DEFL. in loc I/deft L/d PLATES GRIP TOLL(roof) 30.0 SPACING- 2-0-0 CSI. ( ) Snow(Pf/Pg) 38,5150.0 Plate Grip DOL 1,15 TC 0,97 Vert(LL) -050 13-14 >999 240 M720 1971144 Lumber DOL 1.15 BC 0.70 Vert(CT) -0.78 13-14 >666 180 MT18H 197/144 TCDL 10.0 Rep Stress Incr YES WB 1.00 I Horz(CT) 0,25 11 n/a n/a BCLL 0,0 Code IBC2015lfP12014 Mamx-SWeight:195 Ib FT=20%BCDL 10.0 BER- _ BRACING- LUM UMCHORD 2x4 SP 2700E 2.2E'Except' TOP CHORD Structural wood sheathing directly applied, except end verticals: TOP5x4 2x4 SPF 2100E 1.8E BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing ' BOT CHORD 2x4 SPF 210OF 1.8E WEBS 1 Row at midpt 4-16.7-16 WEBS 2x4 SPF No.2*Except' _2-19.2x4 SPF 2100F 1.8E SLIDER Right 2x6 SPF No,2 3-11-14 REACTIONS. (Ib/size) 20=2627/0-5-8,11=261210-5-8 Max Horz 20=-100(LC 14) Max Uplift 20=-137(LC 161,11=-132(LC 16) FORCES. (lb)-Max,Comp./Max-Ten.-All forces 250(lb)or less except when shown,- TOP CHORD 2-3=50521343.i-4=-4864/377,4-6=-3986/363,6-7=-40031363,7-9=-5348/402„ 9-11=-6327/416,2-20=25471273 BOT CHORD 19-20=-411447.18-19=25514724.16-18=-22714553,14-16=25215018,13-14=-32915868, 11-13=-329/5868 WEBS 3-19=3061124,3-18=-324/108,4-18=0/379,4-16=1425/115,6-16=-5911696, 7-16=1884/147,7-114=01495,9-14=905187,9-13=0/394,2-19=-22714323 NOTES- 1)Unbalanced roof live loads'have been considered for this design. 2)Wind"ASCE 7-10,•Vult7-130mph(3-second gust)Vasd=103mph;TCDL=6.Opsf:BCDL--6,Opsf;h=25ft;B=45ft;L=24ft;eave=5ft;Cat, II;Exp B:enclosed;MWFRS(directional)and C-C Exterlor(2)-0-10-6 to 2-1-8,Interior(1)2-14to 20-B-2,Exterior(2)20-8-2 to 23-8-2 _ zone;cantilever left and right exposed,end vertical left and right exposed;C-C for members and forces&MWFRS for reactions � shown;Lumber DOL=1.60 plate grip D0L=1 60 l �� Y:, 3)TCLL•ASCF 7-10;Pr=30,0 psf(mnf live load:Lumber DOL=1.15 Plate DOL=1.15);P9=50.0 psf(ground snow);Pf=38:5 psf(flat �y roof snow:Lumber DOL=1.15 Plate DOL=1.15);Category II;Exp B;Partially Exp;Ct=1 1 4)Unbalanced snow loads have been considered fof this design: 5)This truss has been designed for greater of min roof live load of 12.0 psf or 1.00 times flat roof load'of 38,5 psf on overhangs •' non-concurrent with other live loads. 6)All plates are MT20 plates unless otherwise indicated. 7)This truss has been designed for a 10.0 psf bottom chord live load boncoticurrent with any other live loads. X v 6)"This truss has been designed for a live load of 20.0psf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide , will fit between the bottom chord and any other members. 9)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT atlt(s)20 and 11.This connection is for .,^'•tip`; - 3rd y uplift only and does not consider lateral forces 10)This truss has been designed`for a moving concentrated load of 250.0Ib live located at all mid panels and at all panel points along R�FF$Sti�NA the Top Chord and Bottom Chord,nonconcurrent with any other live,loads. July 26;2019 AWARNING-Verify design parameters and READ NOTES ON TNJS AND•INCLUDED MI7EK REFERENCE PAGE Mll•7473 rev.,90103/2075 BEFORE USE. •Pe5Ij�7t vnFtli❑ruse vnry�Sith M�Tekz�7Conntic'ars;if'Us�tlaa(pn�s,bnsed only upt»7 pata�Setg~„M+nts,tend r1:for m>.�liduht tauitd'mg compoflnaf:nor �'4 t7Ugsa5yyssttt��n Beforauepthebuildul9dossgnermuW'vwdyrheapplf5obitilyofdoWBnparam�im6ani;{+ropivty'iRw!Drir.'Sr+ti�Sd IFltOnlntath®tiiBrAli- Ctddll%Ccsi9n arar�ii0rrdicaledbrtnlxevnnlbocstingofl?iividual'Uusswebmtdtaenadn+emhoniDaly-`/wdlr&switom11 Pararyand pv�r+mnonibr'ncing ��(� "is ahvays regtured,lor 9tabTiy and to pievenl collapse with'possible per"spnal intury'pntl•prgpoatydfam24tr, Fd?01trFAt61 ptlEdritii5 re ardiR Urtr-, - •- fabnradon,bSdrygir,defivery,erecbon and bracing of Uussas and Uuss systems,sae' ANSfRPJ1,gdellf#1Cclibrle,•a58 98and>�SC818nitillnfl.Component 16023 SvAngley Ridge Rd Safety Infatrnntinn avatlable Uam Truss Plate Instdule,218 N Lee Sireel,Suite 312,Alexandria,VA 22314, - _ Chesterfield,MO 53017 Joh cuss Tru-':,r =_- - -- ply - Ply --©Ui10WGd;ROt3f VINEYARD VIEW— - 137938917 35970R3 01GE Canm'tan Supported Gable 6 1 ' Job Reference(on Balsa!)' (JHt*gal'CorlpplterltCorp„ EAST HAVEN,CT 065128.O106AL!)':11'2447'MtTek,industrfes-Inc�- huJu12523,15:162O,S9Pap©•1- ID.uHBIG9!AM9_WCtE(KnavHVNy6 Bg-vHBic?CO9n1310KgZz2t2wGeLGgQGuS4MtZaes3yuNSf .7-2_14 __. - _ - 74 5112 PI-4 1 ,----. -- -7.2:14 4x4 = Scale 114'=1' 6 s 6 N\ 7 12.00 i2 ; 21 _ 24 i 4 II 20, 25 19 3. 9 "j l 26 2 + > r ,` - 11 - ;.rz__ I - ,rte`°u9-10 27 18 28 17 29 16 30 15 31 14 32 13 33 12 34 3x8 l 3x8 I i _Alf=5-12 Plate Offsets(X,Y)-= )2'Edlle,0"017-I10;Edga O-O=71_ LOADING (psf) SPACING- 2-0-0 CSI. DEFL. in (loc) d(deft Ud 'PLATES GRIP TCLL(roof) 30,0 Plate Grip DOL 1.15 TC 0,15 Vert(LL) 0,00 10 n/r 120 MT20 197/144 Snow(PNPB) 38 5/50.0Lumber DOL 1,15 BC 0:13 Vert(CT) -000 10 n/r 120 TCDL 10.0 Up Rep Stress Incr YES WB 0.22 Horz(CT) 0:00 10 n/a n1a BCOL 10.0 _ Code IBC2016[TP12014 Matrix-S Weight 66 lb FT=20% _. - --- __ ------- - --- LUMBER- BRACING- -M13 RACING- Tna CHORD 2x4 SPF No.2 TOP CHORD Structural wood sheathing directly applied or 6-0-0 oc purlins. 'CHORD 2x4 SPF No.2 BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing. iERS 2x3 SPF No.2 wtOGE Left:2x4 SPF No-,2,Right.2x4 SPF No,2 REACTIONS- All bearings 14-5-12. , (lb)- Max Horz 2=-182(LC 12) Max Uplift All uplift 100 lb or less at loint(s)2,10,16,17,18,14,13,12 Max Grav All reactions 250 Ib or less at joints)except 2=301(LC 40),10=301(LC 4B),15=311(LC 60),16=331(LC 59),17=333(LC 58),1 B=312(LC 57),14=331(LC 61),13=333(LC 62),12=312(LC 63) FORCES. (lb)-Max.CompJMaic.Ten.-All forces 250(Ib)or less except when shown. WEBS 5-16=-278/120,4-17=-2811135,3-1 8=-27011 34,7-14=278/120,8-13=2811135, 9-12=-270/134 NOTES. 1)Unbalanced roof live loads have been considered for this design, 2)Wind:ASCE 7-10;Vult=130mph(3-second gust)Vasd=103mph;TCDL=6.O- BCk 7,Opsf,'h=26ft:B=45ft:L-24ft;itaG@=2ft:Cat. 11;Exp B;enclosed;MWFRS(directional)and C-C Comer(3)-0-10-8 to 2=t-8;Exteriarf2i211-8 to 7-2.14;Comer(3],7-2-1a.to 10-2-14 zone;cantilever left and right exposed;end vertical left and right7cpos®d;G C faPmemtrtir5 etld fotCes$MWFRS for reactions shown;Lumber DOL=1,60 plate grip DOL=1.60 , 3)Truss designed for wind loads in the plane of the truss only.-For studs exposed to wind(normal to the face),see Standard Industry h, Gable End Details as applicable,or consult qualified bulldtng designer as per ANS(rrPi 1. QF-NIF 4)TCLL:ASCE 7-10;Pr-30,0 psf(roof live load:Lumber DOL--I.15 Plate DOL--1.15);Pg=50.0 psf(ground snow);Pf=38.5 psf(flat ,t�j roof snow:Lumber DOL=1.15 Plate DOL=1.15);CategoryII;Exp B;Partially Exp,Ct=1.1 �` jQ_ Q 5)'This truss has been designed for greater of min roof live load of 12,0 psf or 1.00 times flat roof load of 38.5 psf on overhangs Q� non-concurrent with other live-loads. 6)All plates are 1x4 MT20 unless otherwise indicated, _ 7)Gable requires continuous bottom chord bearing. 8)Gable studs spaced at 2-0-0 oc- I ' 9)This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other Ilvedoads, 10).This truss has been designed for a live load of 20.Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by'2-0-0 wide ` Z i . will fit between the bottom chord and any other members- 11) embers11) Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift at joint(s)2,10,16,17,18, 14,13,12, A - 12)This truss has been designed for a moving concentrated load of 250.Olb live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. July 26,2 ii) ®WARNING-Verify design paramelers and READ NO TES ON tHIS AND INCLUDED UITEK REFERENCEPAGE M11-7473 rev,10103/20f5BEFORE USE. s �; 11rspnyslld'fw,ula0 ntytvllti,biT$[c «i ntrgoiriftJtd¢di�ni;bne�dcnlytgwntwrum�tujs�ilow�iAtiuifi<'(�,pn'ijtditilileal'uuilairgp'egtt+iial7i>l;nsl: n tn+ts Gyblitm.8arpcnbnu,tli9l+Widlnp rYatInar!najst•snri�t N�o ovpltr'afaYtty drrfeSt�n paiehiatois find pt3pm�y trisaptra[a tnisife5l9n into tlur a!ara!1 t RV o4itll -f �ar16D23SwingleyRldgeRd �Slofarriiffiir111 ay;lil0bfdhaP4€Tt1rs's►+dnloUtuJpte. f$'N,LheSlraAI;Y,Jltd�t?3 A[Cz4ndrH1`!VA'2231.f: - p Cheslerfield,MO63017 Sob Truss russ Type Oty Ply 13UILUINU D ROOF VINEYARD VIEW 537938918 35970133 02 Common 2 ! 1 Job Reference a Sicnat_)_______ -_ Universal Component Corp., UZT,HAVE�N CT 08512 - 6.010 s Aug 11 2017 MiTek Industries,IrW,'TUU'Jul 25 23'15 17 2019 Page 1 ID:uH61G91AM9_WOEtKnavHVNyuWBg-NTk6CY1nY0B9eTPIXr iOHTTBUV3dsdfMVtDJBOVyuNSe 114$ 37-11 r 7.2.14�,j_ 16.10-1 _I '14.5-12 Met St 0.16•$ 3.7-11 3-7.3 -3 7.3 3.7-11 �16c9 Scale=1 4x4 = 4 11 12 � - 12.00 12 1x4 \\ 10 .13 1x4 3 5 d � f// -�1, •y 14 67 15 8 163xB\I 3x8 II 3xB = 7-2-14 - 7-2.14 ---- 7-2-14 - Plata Offsets(X-Y)- MEdge,0-1,7)r 1619d- LOADING 6:EdLOADING (psf) SPACING- 2-0-0 CSI. DEFL. in (loc) I/deft Ltd PLATES GRIP TCLL(roof) 300 Plate Grip DOL 1.15 TC 0.31 Vert(LL) -0,24 2-8 >705 240 MT20 197/144 Snow(Pf/Pg) 38.5/50.0 Lumber DOL 115 BC 0,68 Vert(CT) -029 2-8 >572 18D TCDL 10.0 Rep Stress Incr YES WB 0.16 Horz(CT) 0.01 6 n/a n/a BCLL 0.0 Code IBC2015ITP12014 Matrix-S Weight 591b FT 20% BCDL LUMBER- BRACING- TOP CHORD 2x4 SPF No.2 TOP CHORD Structural wood sheathing directly applied or 5 11-9 oc purlins BOT CHORD 2x4 SPF No,2 BOT CHORD Rigid ceding directly applied or 10-0-0 oc bracing., WEBS 2x3 SPF No.2 WEDGE Left-2x6 SPF No 2,Right 2x6 SPF N0.2 REACTIONS. (ib/size) 2=927/0-5-8,6=927/0-5-8 Max Horz 2=-182(LC 12) Max Uplift 2=-69(LC 14),6=-69(LC 14) FORCES. (lb)-Max.CompJMax Ten -All forces 250(lb)or less except when shown• TOP CHORD 2-3=-9261114,3-4=-696/153,4-5=-696/153,5-6=-928/114 BOT CHORD 2-8=-14/557,6-8=0/537 WEBS 4-8=-111/465 NOTES- 1)Unbalanced roof live loads have been considered for this design, 2)Wind-ASCE 7-10;Vult=130mph(3-second gust)Vasd=103mph;TCDL=6.Opsf,BCDL=6.Opsf,h=25ft,6=45ft,L=24ft;eave=oft;Cat Il;Exp B;enclosed;MWFRS(directional)and C-C Exterior(2)-0-10-8 to 2-1-8,Interior(1)2-1-8 to 7-2-14,Extenor(2)7-2-14 to 10-2-14 zone;cantilever left and right exposed;end vertical left and Tight exposed,C-C for members and forces&MWFRS for reactions shown;Lumber DOL=1.60 plate gnp DOL=1.60 3)TOLL-ASCE 7-10,Pr=30.0 psf(roof live load,Lumber DOL=1.15 Plate DOL=1_15),Pg=50 0 psf(ground snow),Pf=38.5 psf(flat roof snow Lumber DOL=1.15 Plate DOL=1,15);Category 11;Exp B;Partially Exp;Ct=1.1 4)This truss has been designed for greater of min roof live load of 12.0 psf or 1 00 times flat roof load of 38,5 psf on overhangs Q F N,EI j non-concurrent with other live loads FF 5)This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads .�V cc) Y� 6)"This truss has been designed for a live load of 20.Opsf on the bottom chord in all areas where a rectangle 3.6-0 tall by 2-0-0 wide �Q` ¢� f11�� will fit between the bottom chord and any other members. 7)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT at jt(s)2 and 6.1 his connection is for * �� uplift only and does not consider lateral forces. B)This truss has been designed for a moving concentrated load of 250 Olb live located at all mid panels and at all panel points along r' ' i ) -,Y the Top Chord and Bottom Chord,nonconcurrent with any other live loads, tA�O 0-0994IN A�QFE`SSpNpv July 26,2019 ®WARNING.Verify design parameters and READ NOTES ON THIS AND INCLUDED MIrEK REFERENCE PAGE MIJ-7473 rev.1010312015 BEFORE USE, D a gR 4i9rQfQf a",GC ,H,6"r Aoff . pnn.:mpr mm�rn nP e11?YT..ar 1+9 fGr MIAdW:linl i�l�f yp L54}�4vWRi}nGl 2 �'' a Uuss Aystnrn.8efoto uSu 1114 bulld'_,•p deslpiinr must voilfy lli i oPrdieau(Ilcy b(ifobtfl:pyramotore and Pic"jij Ineorpora:a thin di tIyA tine lila ov rill f A��T��t twitdlnp 9031911,Brcing indiea;6dls to firo%•dn1 blxkrtT of tndMdanl truss A,4b nn9tor dr� m d maborL only,Additional hmp=,y and pemmnJft irmeleip !V i 191iPA7yfi regnireefi for situ Iffy,and to�9vmil wililiw P fto,srtso P M injury grid ovitti y damaga.Fo Sloncrol pukfur ca ttft`t�rdtng the rnicic{itton,91b7otje,dativdry,droctkndmdbuicing61itussosantlI'M"90trirssee APdSIfiP,ftgyoSltyComdo,f7SB8Jand 13CSJBuilding component 16023SwmgleyRidge Rd Sofoty'tdformvtlg0 slrsllnblu frynTrurs plain,Intlttuto,21$N,'Lea Vir•e1,-Sn(lo 312,P4airo driai VA22314. - _j Chesterfield,MO 63017 Jab Truss Tints Type - - - - - - Qty - Pty- BUILDING D ROOF VINEYARD VIE' - 137938919 35971IR31 T02CE Contmon Supported Gable 1 1 _ `Joti'Raierance'u�riatsal} __ _ , Uhiversc=l Camponent,Coin„ EAST HAVEN CT 96,512 6 10 s Aug i i 2017 nriiTek indu'siiieg and"iiia Jot 2v 2�13'25 2018 Page', ID.uH81G9iAM9 1NQE1iCgdvplVNyuLtiBg•AODBuH?ofTC04i014RXJu9Vt%kli&VDLI jTFCgTyt[f�SW -0-10-A -- - - 22.-6.2'' - 45.4-1 = -- d6.2-t2 0-10-8: - 22 6-2-- -- - - '► 22-8-2 U-1F�f Scale=1.76A 3.75 t2 5x6 = ` 14 63 15-64-16 -64=.16 W 3x6 S 60 13 62 1 65 17 11 12 61 y. �_1i 66 18 3x6 67 M 19 g f t + 2021 57 � 22 '1 70 23 56 7 71 24 55 6 3x6 53 54 5 72 25 73 26 3x6 c. 4 ,-i!''•=� ��__-� �„� t` ._-...��. -lit-a-----Ii ' ►: x€ ' �..�._..`3.�.�! ____il_._.,��►, ( , 29 374 of 28 0 t s.d..,.�.i ...1_ s1_.�-.--11__^•___rt -.t{.. .va,1._-.,.�.t�------ r L i- I 1?�._.cs-----�-rt.�..=.:r=y,-�_ �, 75 52 76 51 77 50 78 49 79 46 60 47 81 46 45 44 62 43 83 42 84 41 65 40 86 39 87 38 37 36 8B 35 89 34 ,$0,33 91 32 92 31 93 30 94 4x6 II 4x6 II 3x6 = 3x6 = f - -- - - - 45-4-4 j Plat•,Offsets-fX,Y}- ',(2:0-3=7.01-71;12810-327.0-1-7j'_ 1_04EAG (psf) SPACING- 2-0-0 CSI. DEFL. in (loc) I/deft L/d PLATES GRIP TCLL(roof) 30.0 Plate Grip DOL 1 15 TC 019 Vert(LL) 000 28 n/r120 MT20 197/144 Snow(Pf/Pg) 38.5150.0 Lumber DOL 1.15 BC 0.18 Vert(CT) 000 28 n/r 120 TCDL 10.0 Rep Stress]nor YES WB 0.35 Horz(CT) 0.00 28 n/a n/a SCLL 0.0 BCDL< _ 10.0 Code IBC2015/TPI2014 Matnx-S Weight:177 Ib FT=20% LUMBER- _ - _ BRACING- 'CHORD 2x4 SPF No.2 TOP CHORD Structural wood sheathing directly applied or 6-0-0 oc purims. f CHORD 2x4 SPF No.2 BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing. iERS 2x3 SPF No 2 SLIDER Left 2x3 SPF No.2 1-6-3,Right 2x3 SPF No.2 1-6-3 REACTIONS. All bearings 454-4 (lb)- Max Horz 2=77(1_C 14) Max Uplift All uplift 100 Ib or less at joint(s)2,42,43,44,46,47,48,49,50, 51,52,40,39,38,36,35,34,33,32,31,30,26 Max Grav All reacttons 250 Ib or less atjoint(s)except 2=318(LC 58),41=323(LC 113),42=341(LC 21),43=330(LC 111),44=330(LC 110),46=330(LC 109), 47=330(LC 108),48=330(LC 107),49=330(LC 106),50=332(LC 105),51=323(LC 104),52=354(LC 103),40=341(LC 22),39=330(LC 115),38=330(LC 116), 36=330(LC 117),35=330(LC 118),34=330(LC 119),33=330(LC 120),32=332(LC 121),31=323(LC 122),30=354(LC 123),28=318(LC 80) FORCES. (lb)-Max Comp/Max.Ten -All forces 250(lb)or less except when shown. WEBS 1541=258/0,1442=-301/117,13-43=-280/78,12-44=-284/69,11-46=-279/70, 9-47=-274/70,8-48=-276/70,7-49=-278/69,6-50=-281/73,5-51=-280/62, 4-52=-298/121,16-40=301/117,17-39=-280!78,18-38=-284/69,19-36=-279/70, 21-35=-274170,22-34=276170,23-33=-278/69,24-32=-281/73,25-31=-280/62, 26-30=-298/121 NOTES- 1)Unbalanced roof live loads have been considered for this design, 4F NS� 2)Wind-ASCE 7-10,Vult=130mph(3-second gust)Vasd=103mph;TCD/=6,0psf;BCDL=6.Opsf,h=25ft,B=45ft;L=24ft,eave=2ft;Cat 11;Exp B;enclosed,MWFRS(directional)and C-C Corner(3)-0-10-8 to 2-1-8,Extenor(2)2-1-8 to 22-8-2,Corner(3)22-8-2 to 25-8-2 Q� 1j� d01y, zone;cantilever left and right Pxposed;end vertical left and right eliposed,C-C for members and forces&MWFRS for reactions shown,Lumber DOL=1.60 plate grip DOL=1 60 41- 3)Truss designed for wind loads in the plane of the truss only..For studs exposed to wind(normal to the face),see Standard Industry Gable End Details as applicable,or consult qualified budding designer as per ANSI/TPI 1. 4)TCLL:ASCE 7-10;Pr=30.0 psf(roof live load'Lumber DOL=1,15 Plate DOL=1.15);Pg=50.0 psf(ground snow);Pf=38.5 psi(flat Sy roof snow Lumber DOL=1,15 Plate DOL=1 15);Category 11;Exp B;Partially Exp.;Ct=1,1 CSL 5)Unbalanced snow loads have been considered for this design. 6)This truss has been designed for greater of min roof live load of 12.0 psf or 100 times flat roof load of 38.5 psf on overhangs 3,�, .,� non-concurrent with other live loads. ��j. 09643 �! 7)All plates are 2x4 MT20 unless otherwise indicated R1 Gable requires continuous bottom chord bearing. O� v `N 'able studs spaced at 2-0-0 oc, Thistruss has been designed for a 10A psf bottom chord live load nonconcurrent,with any other live loads. July 26;2019 "Am --- t ®WARNING-Verify design parameters and READ NOTES ON THIS AND INCLUDED WTEK REFERENCE PAGE M11-7473 rev 10/03/1015 BEFORE USE 11( D,Wy t vadd lar use 4aly Wlk r&Onn'hl tM&elf ally a►itur pdumate o n1 m il,[aril h for do Individual baUdhig ec upononl,not' a Wnusysttrm:Uijrofn taco;Ufa Uedd(n0 desig0drmust.yerdtiro nppSlcatxptyof build"ingtl9sipn.9mnnalndgeatodt& daglgnpagrnec ,1d,i6oniomortapermanent Orn atentbrnhr bracing 6!�ndividunitrU.s%V64dnitard'+tMiTe't 'Is otenyti toyuimd f �io pfuviinl`c0!lopt►D wititpadfi6fo p4r?dopf injury and l?rnparty dnmoge,FnrflflgnarAt-gutOenCe}egafdlnqlhn ,tatutfialtGCl,afofaga,dali�olnLipty'�nVGG, ornWinnand 6maln 6ftrus�os And tiusssystd*.'.eue,. ANSIrIP11'Quallty'Criteria,050.89 im d BW Building component 16023 Swingley Ridge Rd Soloty tnloilnetten punlla Eotrn±it Ttriss Plate Indt1161a,218 R.Led,Slrodl.$dito RLAloxaidldn','VA 223Rd, -' =�Chlesterneld,MO 63017 Job Truss Truss Type Q!Y P{y BUILDING D,ROOF-VINEYARD VIEW 137938919 35p70R3 02GE Common Supported Gable 1 1 ob Releronce(op[Iormlf - - -- Universal Component Corp., EAST FIAVEN_CT 06512 8,010 s Aug-1,1 2017,M1Tek Industries,Inc.Thu Jul 25 23:15 27.7Ad9 Pago 22 " — ID uH81G91AM9_WQEtKnavHVNyuWBg-4PLuJz93B4SkrOAg6sZdtabCk5gwz7r AnkjIwyuNSU NOTES- 11)'This truss has been designed for a live load of 20 Opsf an the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide will fit between the bottom chord and ;any otitosmembers, 12) Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift at joint(s)2,42,43,44,46,47,4B,49,50,51,52,40,39,38,36, 35,34,33,32,31,30,28 13)This truss has been designed for a moving concentrated load of 250,0Ib live located at all mid panels and at all panel points along the Top Chord and Bottom Chord, nonconcurrent with any other live loads. AWARNING-verity design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE MI1-7413 rev,10/03/2015 BEFORE USE Dcsigh va[ut 1nr v e arit�v i[ti N7eV t�nnnilnr:Ths d tsl9n Is tianed'arly up6n pnramphus shown,find Is for an Indrlidunl nrn)aing annpannm,not ri Vuun sysianr More uto,tiro truitd r g des gnat must vod Aho app[WC lily of doagin param0inrt amt I rn}mtfy rncmperalp th s dosWI pAi o tha ni bra rulldGtpd>"Ipn�BcrictnplmllCatbdlsloprovenlliurkotag�!�iWty{dNalVusa�veDaniirarahntdinambnraonty 1Wdlllnnnl!enipnrarynrHlWrmnnnnlhradng .M1Te�(' 9g ulwaya requited to 3tnhlllty And iri Pr+�t taflpnao%wih persibip Personal injury and Nope ty doms4o,For-geneml,0uidnno reUkrtling!Ito- . fpkirlpitasy otomga,dtlivri rrettrgr raid Wotirg M-I=san And tlusg syafierna,auc ANSITIi I Quality CAIndS,08849 and OCSI Building Component 16023 Swingley Ridge Rd &a(atyrnlmnfn6on avail talramT"Mspiniolnatitutn;,2teA,;Loo,Briant.supo$f2,-Ngxnriddn,Vl,223a�S. - Chesterfield, Job' Truss Truss Type Qty Ply BUILDING D ROOF VINEYARD VIEW 3597OR3 T03 Common 2 1 137938920' 11 Job Reference-o tional- Universal Component Corp„ EAST HAVEN,CTp85J2 ,$,010 s Aug�11 2017 MTek Industries,Inc, Thu Jul 25 23.15:28,2019 Pagel " IMUHMGB AMS WQEtKna4HVMvUWB9-YbvGWJAhy0abTAktgZ4sP08MjVN7tdr7PRUGHMyuNST 3-7-11 __ 7-2-14 ._ _ _ tQ•1l7•Y _ 14-5-12 _ 5»ti4 -T-3.7-11 37-3 ° 3-7-0 3.7=11 4x4 Scale=1.49,9 J 12 00 12 11_ y 12 1x4 \\ 10 \\* 13 1x4 92 A. 14 6 J' \ - 6 9 IT d -- - - _ o 15 7 16 3x8 I I 3x8 1 3x8 = _ 7.214 _ -- Plats,Offsets(X;Y} f1.Edi♦e 0-0.71,15.Edgo;0-0-7f - LOADING (psf) SPACING- 2-0-0 CSI. DEFL. In (loc) I/deli L/d PLATES GRIP TCLL(roof) 300 Plate Grip DOL 1 15 TC 0,31 Vert(LL) -025 1-7 >674 240 MT20 197/144 TCDL Snow(Pf(Pg) 38,5/50.0 0.0 Lumber DOL 1.15 BC 070 Vert(CT) -0.31 1-7 >544 180 BCLL 10.0 Rep Stress Incr YES WB 0.17 Horz(CT) 001 5 n/a n/a BCDL - 1010 Code IBC2015/TPI2014 Matrix-S Weight:58 lb FT 20% LUMBER- BRACING- -- - ---.__ TnP CHORD 2x4 SPF No 2 TOP CHORD Structural wood sheathing directly applied or 5-11-3 oc purlins, .CHORD 2x4 SPF No.2 BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing. 3S 2x3 SPF No.2 vvr=JGE Left,2x6 SPF No.2,Right,2x6 SPF No,2 REACTIONS. (Ib/size) 5=932/0-5-8,1=816/0-5-8 Max Horz 1=-178(LC 12) Max Uplift 5=-71(LC 14),1=-32(LC 14) FORCES. (lb)-Max Comp,/Max.Ten.-All forces 250 Ob)or less except when shown. TOP CHORD 1-2=-911/122,2-3=-704/163,3-4=-702/154,4-5=-934/115 BOT CHORD 1-7=-16/568,5-7=0/541 WEBS 3-7=-125/472 NOTES- 1)Unbalanced roof live loads have been considered for this design. 2)Wind:ASCE 7-10;Vult=130mph(3-second gust)Vasd=103mph;TCDL=6.Opsf;BCDL=6.Opsf;h=25ft;B=45ft;L=24ft;eave=oft;Cat Il;Exp B;enclosed;MWFRS(directional)and C-C Exterior(2)0-2-12 to 3-2-12,Interior(1)3-2-12 to 7-2-14,Exterior(2)7-2-14 to 10-2-14 zone;cantilever left and right exposed,end vertical left and right exposed;C-C for members and forces&MWFRS for reactions shown;Lumber DOL=1 60 plate grip DOL=1.60 3)TCLL•ASCE 7-10;Pr=30 0 psf(roof live load:Lumber DOL=1.15 Plate DOL=1.15);Pg=50.0 psf(ground snow),Pf=38 5 psf(flat roof snow:Lumber DOL=1.15 Plate DOL=1.15);Category II;Exp B;Partially Exp;Ct=1,1 4)This truss has been designed for greater of min roof live load of 12.0 psf or 1;00 times flat roof load of 38 5 psf on overhangs non-concurrent with other live loads. 5)This truss has been designed for a 10.0 psf bottom chord live load non concurrent with any other live loads., 6).This truss has been designed for a live load of 20.Opsf on the bottom chord In all areas where a rectangle 3-6-0 tall by 2-0-0 wide �� 1j11 .jQ%?r will fit between the bottom chord and any other members. 7)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT atjt(s)5 and 1 This connection is for uplift only and does not consider lateral forces `4 8)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along fa the Top Chord and Bottom Chord,nonconcurrent with any other live loads, r v 9 _PESSI Oo July 26,2019 ®WARNING-Verify design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGELIX7473 rev.10102/2015 BEFORE USE g Darfgn valkt for use only with MfToW.c 1ppaQof0:,11i's ditaitgi Is bppedarily upon parametOm 1Down,and is for an individual building component,not n OUL6 Sywtlan Befo p urn.the vCOrglig Qoalgnryrmu¢verify the apptichblity of design p9lrnriialera dnd properly incorporate this design into the overall WOW/� bulidinOQesIgn Bractn0 lridicafud'ttj tooraYot bvoring'of lrcirvidual lturs web and/or chord members only,Additional temporary and permanent bracing IVC�I�i 11,• is always required for stability and to prevent collapse with possible personal Injury and property damage,For geneiat guidance regarding the �ve Oi fabrication,storage,delivery,erection and bracing of trusses and truss systems,see ANSIRPI1 Quality Criterlin DSB-69 and BCSI Building Component 16023 Swingiey Ridge Rd Safety Information available from Truss Plate Institute,218 N Lee Street,Suite 312,Alexandria,VA 22314 Chesterfield,MO 63017 - -- -= - - - -- `- -Qty Ply BUILQING D ROOF=,V1!�EYARD V1BW Job Truss - Truss Type i 137938921 597oR3 03GE Common Supported Gable 1 1 , Job Reference o tional - UnlversalComponentCotp., EAST HAVEN CT 06512 :aAlgsAtij11,12017'A�MekIn. ustries,inc;'ThuJV12523:15:34,2U19 Pa+dot ID;u1d81G9iAh19_WGJEilivavftVNyutVlilg-NIGY444-i11�)ESYEKktiS(Ottj13Gi90P..vYCS17Ar1NxiyV{iyu .1 _ P O 1D 20-8-2 22-8-2 D•10•D Scale=1 3,75 12 5x6 = 1 61, 13 63 14 64,15 3x6 ... 11 12 X62 !- %.'i ) -;4y�16 66 17 3x6 9 6010�' '.�s's" , X67 18 21 58 8 59 19 2068 69 t 2270 ,l5� , fyt } 57 k_F ` )( FI 716 23 56 2472 54 55 7 4 � . 4 28 6 74734x 253 2 3 27 LI-�"--`ll-"_'®•!j¢g...._�+ls.-� 3x6 11 52 51 7ffD 76 49 77 48 78 47 79 46 80 45 81 44 43 42 82 41 83 40 84 39 85 38 86 37 36 35 87 34 88 33 89 32 90 31 91 30 92 29 93 3x6 = 3x6 = 43.4.4. ,I - - - _ - -- - - 43.4.4' - Plate OffsewX( Yr 1 LOADING (psf) SPACING- 2-0-0 CSI. DEFL. in (IOC) Udefl L/d PLATES GRIP TCLL(roof) 30.0 Plate Grip DOL 1,15 TC 0,20 Vert(LL) 0 00 27 n/r 120 MT20 197/144 Snow(Pf/Pg) 38.5!50.0 Lumber DOL 1 15 BC 0.18 Vert(CT) 0.00 27 n!r 120 TCDL 10,0 Rep Stress Incr YES WS 0.36 HOrz(CT) 0,00 27 n/a n!a BCLL 0.0 Code IBC20151TP12014 Matrix-S Weight:173 1b FT=20% BCDL _ .10.0 _ - LUMBER- BRACING- TOP CHORD Structural wood sheathing directly applied or 6-0-0 oc purlins, TOP CHORD 2x4 SPF No,2 except end verticals BOT CHORD 2x4 SPF Not WEBS 2X4 SPF No;2 BOT CHORD Rigid ceding directly applied or 6-0-0 oc bracing. OTHERS 2x3 SPF Not SLIDER Right 2x4 SPF No.21-6-3 REACTIONS. All bearings 43-44. (lb)- Max Horz 52=100(LC 14) Max Uplift All uplift 100 lb or less at joint(s)52,41,42,44,45,46,47,48.49, 50,51,39,38,37,35,34,33,32,31,30,29,27 Max Grav All reactions 250 Ib or less at joints)except 52=285(LC 81),40=326(LC 114),41=341(LC 21),42=330(LC 112),44=330(LC 111),45=330(LC 110), 46=330(LC 109),47=330(LC 108),4B=330(LC 107),49=329(LC 106),50=333(LC 105),51=304(LC 82),39=336(LC 22),38=330(LC 116),37=330(LC 117),35=330(LC 118),34=330(LC 119),33=330(LC 120),327--330(LC 121),31=332(LC 122), 30=323(LC 123),29=355(LC 124),27=316(LC 80) FORCES. (lb)-Max ComplMax Ten,-All forces 250(lb)or less except when shown TOP CHORD 2-52=-273/61,13-i4=-97/262,14-15=-971269 WEBS 1440=263/0,13-41=-301/117,12-42=-280/78,1144=-28 4/69,9-45=-279170, 8-46=-274(70,7-47=-276(70,6-48=-278/70,5-49=-280/69,4-50=-283/87, ,,-3,.2,,,117,,6-3,=-27,178,17-37=-281/69,18-35=-272/70,20-34=274!70, 21-33=-27680,22-32=278/69,23-31=281(/2,24-30=-280/63,25-29=-299/117 NOTES- 0� N_YY 1)Unbalanced roof live loads have been considered for this design_ 2)Wind ASCE 7-10;Vult=130mph(3-second gust)Vasd=103mph;TCDL=6.Opsf;BCDL=6.Opsf;h=25ft;B=45ft,L=24ft;eave=2ft;CaL ��vj J0, Q�� Il,Fxp fl,enclosed;MWFRS(directional)and C-C Comer(3)-0-10-8 to 2-1-8,Extertor(2)2-1-8 to 20-8-2,Corner(3)20-8-2 to 23-8-2 zone,cantilever left and right exposed,end vertical left and right exposed,C-C for members and forces&MWFRS for reactions shown;Lumber DOL=1.60 plate grip DOL=1 60 r (� 3)Truss designed forwind loads in the plane of the truss only. For studs exposed to wind(normal to the face),see Standard Industry Gable End Details as applicable,or consult qualified building designer as per ANSI1TPI 1. �- i,� 4)TCLL•ASCE 7-10;Pr=30 0 psf(roof live load,Lumber DOL=1.15 Plate DOL=1.15);Pg=50.0 psf(ground snow);Pf=38.5 psf(flat CB r�,�� roof snow-Lumber DOL=1.15Plate DOL=1,15);Categoryll;Exp B;Partially Exp.;Ct=1;,1 5)Unbalanced snow loads have'been considered for this design. 6)This truss has been designed for greater of min roof live load of 12.0 psf or 1 00 times flat roof load of 38.5 psf on overhangs 09943Y v� non-concurrent with other live loads., RQF ggf,Q�� 7)All plates are 2x4 MT20 unless otherwise indicated, 8),Gable requires continuous bottom chord bearing. July 26,2019 9)Gable studs spaced at 2-0-0 oc. . � mar• ®WARNING-Venfy deslgnparameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE M11.7473 rev.10/03/2015 BEFORE USE. i1esRlnYag:i,forll¢GOn1714111f+U•TelP9-Nrhnt•L101S•Ttk�� t11n�9t 5odaidjuf�npW8t 1l0ldf¢0OWn,Lddi;tot8nhtdlvrdntllwildill camponeelit1nok !j a cuss�yxlOfn.Bofa+o wo•IhobuiMng doslgn if,mustvnt hl Ih0 appiira4{tly,of des+9n onninotoruand pmpariy Inrorparaia Udli drtbpn info the mtat-11 ( 9��tC �uRdlnil�7 jn.13n¢tfyfl'�ipttd4;1nF:o'vatt'bticlttt,;c(tON!':duP.S u"'�"� td{o:rre rd`tri^-mh'em¢niy,N)dhr?naltairjl0rarrandt(-iman¢uiliaetnu i '1¢ahvhy;/r,¢gelUcd fcr,SlObllltyr and Ia,ptavCnCeri�lnp5e xidl pasSiblOp�avnal in}Ury and ptispany 4jOnipgO,FOr 80orml fp,idancp ra3nrUlnll Ihn t¢fvicntl¢n;.alOrar,O.C¢I'vmy,grectip»nm!lrfiao!i0 pf tu+'"'e;aiid Uvit7 syal¢roa+area . APtSUTPl1 Duhlity CrllaHa,D88.8a acid 9CStBuildhng Component € Cheslerlletd9lM0 6307 Rd _- 6¢t¢ty ln(Ortn¢II¢n uv011¢ulc fium't'ntsc PtnL lrGUtutO.?.I�N!Leo 8lra¢1;5g1I0 3T.,Nexaniinn,VA223T4: - € _ _ _ Job — -- rus`s - `- Truss Type - - - Qty "Pty` BUILDING D ROOF VINEYARD V_IEW 1 ' 137938921 5970R3 T03GE Common Supported Gable 1 1 - Universal Component Corp., --EAST HAVENCT 06512-- - 8.010 s Aug 112017 MITek IndGsfdas,Itis Ttru Jut;25 23:15:36 2019 Page 2 ID uH81G91AM9 WQEtKnavHVNyuWBg-J701B2Gl4raSQOMP8FEkkdT(kE4aCzlFhQhZvyuNSL a^TES. `This truss has been designed for a live load of 20.Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide will fit between the bottom chord and any other members. 12)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift at joint(s)52,41,42,44,45,46,47,48,49,50,51,39,38,37,35, 34,33,32,31,30,29,27: 13)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord, nonconcurrent with any other live loads N WARNING-verify design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PA GE MI1,7473 rev.1010312015 BEFORE USE. odi C)~f{yg vhT d ibr USo adly tivlth}ArTult�?ctiu acl6r.rhla'daslgp l�Emsesl t�Iyy,upon paramutmc Shown.dnd in for anESr�Qt ((Md'zl pu� t t al n 1ruRn»iatom,t3oferr),ttde,pro tivildnitt skrcip0or mest,xn8fy lhri.ppUwltltify,ai dntiyn Imiamatdis and,litapi:dy( pgV.n ihie duugnbd4 ihx rrJmull bulld¢SRdd'kin.Brnclpgbidihts�lsiap;oVonbbuck>ingaftn�(vldualhusNrobnntlroreFatdm6tn69r3aniy:jlddiGancjtampginN-s"parinanam{sckn0 ireI� iSolwnyf,ro4ulrCdtOrpt00iliynnd'tgpracgni,cciiaM 9v,�lhpaan$lopernonnt,IPjwy tn`d,propalty,dntrtu�U,F,predisert'gu�dnnc2�eydnllnnit% fatdcnittn.91o7 .dNlvary orWiipoanUWluing'ofttussrandaunn,apatumaaea ANSMtipllQllaiityClf[+�tia,t]Sa69andeC8lBUhdlnpCompnne�t 18023SHnngleyRidgoRd Saletylntarmollon'nvailatln'froMT[ussiri0lalnoUlu10,�1ttN,lCtrSitofl4$ddC31$ftaxnrdrl�;VA22l,W Chesterfield,MO 630117 Job _ cuss ;jru6sTygo Qty Ply BUILDING D ROOF VINEYARD VIEW 137938922 35970R3 04 Rent Special' 2 1 1 ;lob Reference(notional) Universal Component Corp„ EAST•,HAVEt4 CT•p85i2 8.010 s Aug 11 2017 MITek Industfles,Inc,-Mij'JU125 231.16'37 2019-Page V- ID uH81G91AM9_WOEtKnavHVNyuWBg-nKygPOHKg9fJ2YxblylzHhovK7RIJhkSUKAF6LyuNSK 7.2-t4 10-710.1,- _ 13.17.7 ]•3.5 52 3-7-11 3-7 7 r 3.7.3 # 33-1-1-1 0.16 tb Scale=1, 4x4 13 �. 14 12,00 12 � �� 1x412 ,/ L 154x4 2 ` 4 1x4 11 10 f" r'r 6x6 = 7 17 g 18 8 7 3x8 II 3x8 4x4 = = 3x6 II i 7-2-14 ( - 6.1`` Rlata pFfst s(X,Y1 fi'Edge 0 0 71 - LOADING (psf) SPACING- 2-0-0 CSI. DEFL. fn (loc) I/deft Ud PLATES GRIP TCLL(roof) 30,0 Plate Grip DOL 1 15 TC 0.31 Vert(LL) -027 1-9 >637 240 MT20 197/144 Snow(Pf/Pg) 38,5/50.0 Lumber DOL 1.15 BC 0.73 Vert(CT) -0 34 1-9 >502 180 TCDL 10.0 Rep Stress Incr YES WB 0.19 Horz(CT) 0.01 7 n/a n/a BCLL 0,0 Code IBC2015/TP12014 Matrix S Weight 561b FT=20% BCDL 10.0 — LUMBER- BRACING- TOP CHORD 2x4 SPF No,2 TOP CHORD Structural wood sheathing directly applied or 5-9-4 cc purlins, BOT CHORD 2x4 SPF Not except end verticals,and 2-0-0 oc purlins(6-0-0 max.) 5-6 WEBS 2x3 SPF Not BOT CHORD Rigid ceiling directly applied or 10-0-0 cc bracing WEDGE Left 2x4 SPF No,2 REACTIONS. (Ib/size) 7=837/Mechanical,1=837/Mechanical Max Horz 1=179(LC 13) Max Uplift 7=-35(LC 14),1=-35(LC 14) FORCES. (lb)-Max,Comp./Max.Ten.-All forces 250(lb)or less except when shown. TOP CHORD 1-2=944/127,2-3=-7301166.3-4=-7231153,4-5=9231119,6-7=305168 BOT CHORD 1-9=66/589,8-9=-47/585,7-8=-57/564 WEBS 2-9=2561156,3-9=-127/502,4-9=2561147,5-8=01450,5-7=-1095/94 NOTES- 1)Unbalanced roof live loads have been considered for this design 2)Wind,ASCE 7-10,Vult=130mph(3-second gust)Vasd=103mph;TCDL=6,Opsf;BCDL=6,Opsf,h=25ft;B=45ft,L=24ft;eave=oft;Cat, II;Exp B;enclosed,MWFRS(directional)and C-C Extenor(2)0-0-12 to 3-0-12,interior(l)3-0-12 to 7-2-14,Exterior(2)7-2-14 to 10-2-14,Intenor(1)13-11-1 to 14-4-B zone;cantilever left and right exposed.end vertical left and right exposed;C-C for members and forces&MWFRS for reactions shown;Lumber DOL=1 60 plate grip DOL=1 60 3)TCLL ASCE 7-10;Pr=30 0 psf(roof live load Lumber DOL=1 15 Plate DOL=1.15),Pg=50.0 psf(ground snow),Pf=38 5 psf(fiat roof snow:Lumber DOL=1.15 Plate DOL=1,15);Category Il,Exp B;Partially Exp.;Ct=1 1,Lu=50-0-0 4)Provide adequate drainage to prevent water ponding. 5)This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads. --of N E�'� 6)`This truss has been designed for a live load of 20.Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide 'Ci will fit between the bottom chord and any other members. J��lj�j O� 7)Refer to girder(s)for truss to truss connections.. 8)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift at joint(s)7,1. 9)This truss has been designed for a moving concentrated load of 250.O1b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads: _ cc 10)Graphical purlin representation does not depict the size or the orientation of the purlin along the top and/or bottom chord; �4 �•099+33+� PESS10� July 26,2019 gp ®WARNING,-Verity design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE 4(1.7473 rev.710/03/20715 BEFORE USE. I DG'nnyr,,au di4 Uaa arty,wt r.`.1+7c F utrcmrs?t;n doslttp l:f trt�1Y,h�r,34r zmety>�^h;vIn'and in fern 1'161 614ftl b1h0m�mmnbnenl.n;•t t, trass oyate"L alifatn esu;.tt*kwilaliin 6010nnr inud(varify 016-p ill6 lty'oretn Ign parim0wc'36d pr6tr otjyjacoiporilofhis ddabgn'Into tho 6V66 11 bollving doslan.Biacillb Intlknted ia7o proven!bucpl;ilS of tnadidunl t fuss cwb nrldrgr c)wd rtrGmn6or4 ot'Jy'Addlllorml iompomry And parmannn6bmdrig MITek' •is aM%aya,regtnmd fora:iOdy wut.10 uttriern c01111 so vrlliirk%?IJc,penwr511njury.atiti ti�;sydango.For llo6evol p1danm m8uidlA_g'tho k - fabuicallon,atotopo,dulluo I.cie dlon and txaclng 0111116,05 and Irm- lom0.see. -ANSIRPIt Quatlty Cdtarlp,BSB•£0 and BCSi Bu11dIn0 Component i 16023 Swmglay Ridge Rd SafotYtnfarmrition avolln tnlmmTNssps7teln^Iindo,278N,LaeSito9l,SIlia 312.AW:midiin,VA22314. `{ Chestadleld 4063017 - - Job russ Truss Type - Qly,- - IV__ ]PUILDINGD ROOF-VINEYARD VIEW-- 137938923 35970R; 04GE Common Supported Gable 1 1 Job Reference(optional) Universal Component Corp., EAST HAVEN CT 06512 -=" 8.010_s Aug 112017hliTek Industries;Inc.-Thu Jul 25 23:15:42`;0119-Paye 1 ',ID:uH81G9tAM9,WQEIKnavHVNyuWtgi8HInS kI cl3JpZUWk8_IJmgBHU WJFidotUn`lyr1NSF - -_- ;__- . _ _ _ - 2ff•8 2 4344 ( 20-&2 - - --- _-- ;1-•_- - - -_-_ 22-8-2 Scale=1 71.4 3.75 12 5x6 - K _ 3i G 64 10 6011 15 85 3x6 g - -= 16 8 59_ 16 66 17 7 58 5731It � I gf Z16;1 9 67 2 0 68 8 56 2es169 544 g i � 23 7i1 353 442 7252 2a 1, 2725 7326 »i1,� _ ,I�r�-.-11�. .I; I�.�at!' ..x-�!"-';-r=2�-.^.�...�1---•`--iZ -- '41:.�..d.<SIs-- it- -1 !� t+- _ _1f-_ �..�.. ,-•-.`+<� Id 51 50 749 75 48 76 47 77 46 78 45 79 44 80 43 42 41 81 40 82 39 83 38 84 37 85 36 35 34 86 33 87 32 88 31 89 30 90 29 91 28 92 3x6 II 3x6 = 3x6 = 434A _ 43.4-4 'Plate Offsets(X_ P6.,o-a-a 0=3-101 - LOADING (psf) SPACING- 2-0-0 CSI._ DEFL. in (loc) I/defl L/d PLATES GRIP TCLL(roof) 30.0 Plate Grip DOL 1 15 TC 0.20 Vert(LL) 0,00 26 n/r 120 MT20 1971144 Snow(Pf/Pg) 38.5150.0 Lumber DOL 1 15 BC 0.18 Vert(CT) 0 AO 26 n/r 120 TCDL 10.0 Rep Stress Incr YES WB 0.35 Horz(CT) 0.00 26 n1a n/a BCDL 100_•BCLIL 0.0 ; Code IBC20151TPi2014 Matrix-S Weight'171 Ib FT=20% IMBER- - - _ BRACING- IP CHORD 2x4 SPF No.2 TOP CHORD Structural wood sheathing directly applied or 6-0-0 oc purlins, ..JT CHORD 2x4 SPF No.2 except end verticals, WEBS 2x4 SPF No.2 BOT CHORD Rigid ceiling directly applied or 6-0-0 oc bracing- OTHERS 2x3 SPF No,2 SLIDER Right 2x4 SPF No.2 1-6-3 REACTIONS. All bearings 43-44 (lb)- Max Horz 51=-101(LC 14) i Max Uplift All uplift 100 Ib or less at Ioint(s)40,41,43,44,45,46,47,48,49, 50,38,37,36,34,33,32,31,30,29,28,26 except 51=-123(LC 82) Max Grav All reactions 250 Ib or less atjoint(s)51 except 39=325(LC 114), 40=341(LC 21),41=330(LC 112),43=330(LC 111),44=330(LC 110),45=330(LC 109),46=330(LC 108),47=330(LC 107),48=329(LC 106),49=333(LC 105), 50=320(LC 82),38=333(LC 22),37=330(LC 116),36=330(LC 117),34=330(LC 118), 33=330(LC 119),32=330(LC 120),31=330(LC 121),30=332(LC 122),29=323(LC 123),28=355(LC 124),26=317(LC 80) FORCES. (lb)-Max CompJMax,Ten,,-All forces 250(lb)or less except when shown. TOP'CHORD 12-13=-98/261,13-14=98/268 WEBS 13-39=-26210,12-40=-3011117,11-41=-280/78,943=-284/69,8-44=-279/70, 7-45=-274170,6-46=-276170,5-47=-279/70,4-48=-280169,3-49=-2841113, 2-50=-2611133,14-38=-293/117,15-37=-273/78,16-36=-280/69,17-34=-272170, 19-33=-27470,20-32=276/70,21-31=-278169,22-30=-281f72,23-29=-280/63, 24-28=298/117 OV NISNOTES- 1)Unbalanced roof live loads have been considered for this design. >�:o��W; Joys 'Q 2)Wind,ASCE'7-10;Vu1t=130mph(3-second Oust)Vasd=103mph;TCDL=6,Opsf;BCDL=5.Opsf,h=25ft;B=45ft;L=24ft'eave=2ft;Cat, II,Exp B;enclosed;MWFRS(directional)and C-C Corner(3)0-1-12 to 3-1-12,Exterior(2)3-1-12 to 20-8-2,Comer(3)20-8-2 to 23-8-2 zone,cantilever left and right exposed;end vertical left and right exposed;C-C for members and forces&MWFRS for reactions shown;Lumber DOL--1.60 plate grip DOL=1,60 CG 3)Truss designed for wind loads in the plane of the truss only, For studs exposed to wind(normal to the face),see Standard Industry e Gable End Details as applicable,or consult qualified building designer as per ANSIITPI 1. E� � _U 4)TCLL•ASCE 7-10;Pr=30.0 psf(roof live load-Lumber DOL=1.15 Plate DOL=1.15);Pg=50,0 psf(ground snow),Pf=38,5 psf(flat roof snow.Lumber DOL=1 15 Plate DOL=1.15);Category 11;Exp B;Partially Exp.;C1=1.10- 5)Unbalanced snow loads have been considered for this design: �A = �9g�3 ")This truss has been designed for greater of min roof live load of 12.0 psf or 1,00 times flat roof load of 38 5 psf 6n overhangs ` Q' non-concurrent with other live Toads- ° ssroN'. )All plates are 2x4 MT20 unless otherwise indicated. 8)Gable requires continuous bottom chord bearing July 26,2019 m ®WARNING•Verily dostgn parameters and READ NOTES ON THIS AND INCLUDED MITEI<REFERENCE PAGE M11.7473 rev.10/03/2e15 BEFORE USE � t5estgnvngdtaruseonly,vrih51i[n 7cnnriuellfrd7i11_dAi bItosudotlsyupuflpyr-6ttarizc nvn,�u�aLSfyJ,14tdvtduulbuddingenbtptHtun4not, 0btloq Gy6tilgl.86fain Ube;Iho btit(tlui9 dWt iidi;must darijy Iha'appftieLlldyo!dosl9a p&wthnlars and tx6pndy incrlrporaw 119s,45!gntn!4,1nu wornq` Wilding,dostgn,erlcn!tindfwtpdilrtopro-rcpllsurA!Inpgtittslfv!ddnittussxrtinzltllo eluxdtnejrtzGaorrly,+4ddtledAn!!emtt�ltUS+tu1d'parnannitl,finelhg, j ,t4ttITeiC j lyn�4tiyyrvquGOd'faictdbff!yandtupiavantCQlltlp^✓iv+l0tpclsttNa`paisnnolrtilury"ilntlpra(unydtaningq FCrgnprtmlguidntcnragardin9( (attries}kn„dgmgA:QRDoty,afvttlaitttndbrnungdtrtr;eoand�{ltts;y�i!un6.3pie• ANSiRPtl,rZunhtyCtttatltt,ty8�•69nnd18CMVoltditcompdnent 16023SwingleyRidge-Rd isnfolylhrartnodon Chesterfield,MO 63017 -- - --- --- Ply [UkiAUlNGD RO FMN VIEW Jab Truss Truss Type - Qty 137938923 35970R3 04GE Common Supported Gable 1 1 nb" Univemi'Compbnent Ctirp., --EAST HAVEN"CT 08512= 8,010 s Aug 11G2017 MITeK Industries,Inc, Thu Jul 25 23:15:4420119•Pa9e,2 ID.uHBIG91AM9_WQEtKnavHVNyuW Bg-4gtJtnMjBJbJNdzxcwNc3Ao5KyyySpzU5wM7rRyuNSD NOTES- 10)This truss has been designed for a 10.0 psi bottom chord live load nonconcurrent with any other live loads. 11)'This truss has been designed for a live load of 20 Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide will tit between the bottom chord and any other members. 12)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift atjolnt(s)40,41,43,44,45,46,47,48,49,50,38,37,36,34,33, 32,31,30,29,28,26 except at--lb)51=123. 13)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord, nonconcurrent with any other live loads__—_ o .._•.,.-_� _.w ., ®WARNING-Verfry design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE M11•7473 rev.10/03/2015 BEFORE USE ( s Ouiltin vMd ret uaa only wAoi G1f7ak31canneclars rite dgnlgn IS beaed'ahiyupoq 00ramatem nhovM;and is tat an lndjvldoal tm11f!1ng WnrpOTIP1.1101 IARM a 1nisssyr tom:�0tory uaa;Ino buildaxg dastgnar rquat+my the npplicatlBly of doal4p pommnture 11nd prapttty hirorpoeA Ink design Into lhs omrnll tultd(ntldalOn•Bra�nglpdU.ntadIstoprevardbi?sldlnp'ofUdivldudluxi4wabrindforeh'Ordn;Omharsonly.Add loholIiimpxmyendwmanombrarJnn t MOW Ts akwya ratiuired for alnbility and in prevent PoNipoo With p0as'b1a puniwvt Vlary rind!property damoge.,Eer gonaral-libldatiw feg"14MID Vitt I r a trinaUOn.alomtly,ddiivory,utuatin nlid W611i of iassea.,W trVo.yDtam'r,soe ArtSVTPVi,Qudiay Criteria,DSt.99 nod SCSI suililing Component p 16023 5Wngley Ridge Rd •sufatylnformnfiori"uvAiabloWm"I`mro,PlnWlnrklobe.z1aN;4e$$trep4'5uim319,Noxanddw,Vti223,i3, ( Chesterfield,MO63017 Job russ TnI5s7ypr�, —— - - --Rty- Ply BUILDING D ROOF VINEYARD VIEW i 137938924 3597OR3 05 of Special 2 1 iI Job_Reference(optional) l Universal Component Corp., EAST HAVEN CT 05512'-"—_ — — _ 8,010 s Aug 11201T'MITO Industries,Ina Thtl Jul 2523:16:45 20J9 Page-11 lb U1481[3ioM8 VJb>"lii av}VPSNfv`Bg-YsRl471 JLycjA?nyrb -i M91i866dJa660tyuN_SC 3?-11• Ir2.14 IQ•4Q?i' 13-3_-9, •f4-54' I - -3=7-11"- --' 3;7.g; ---- -'3-7-3 _—T—�✓_9�1-2=3� r 4x4 = Scale=149.7 3 12.00 12 13 14 I 1x4 12 15 1x4 Xi 2 j 4 16 4x4 = 10 �� 4x4 = 76 CP 18 9 19 .8 20 3x8 I I 7 3x8 = 1x4 11 44 = 7-2-14 1 -- ?-z-14 r t 0-12- %Plate Offsets(X Y}= -iT?:Etl OA• 5:0.2 0 0.3+1 --_, -" - LOADING (psf) SPACING- 2-0-0 CSI. DEFL. in (]cc) I/defl L/d PLATES GRIP TCLL(roof) 30,0 Plate Grip DOL 1.15 TC 0,31 ! Vert(LL) -0.26 1-9 >649 240 MT20 197/144 Snow(Pf/Pg) 38.5/50 0 Lumber DOL 1.15 BC 0,72 Vert(CT) -0.34 1-9 >507 180 D 10,0 Rep Stress Incr YES WB 0,33 Horz(CT) 0,01 7 n/a n/a BC LL L 100 Code IBC2015/TP12014 Matrix-S Weight.58 Ib FT=20% MBER- — - — —-- BRACING- P CHORD 2x4 SPF Not TOP CHORD Structural wood sheathing directly applied or 5-9-4 cc purlins, __T CHORD 2x4 SPF No,2 except end verticals,and 2-0-0 cc purlins(6-0-0 max.) 5.6. WEBS 2x3 SPF No.2 BOT CHORD Rigid ceiling directly applied or 10-0-0 cc bracing. WEDGE Left 2x4 SPF No.2 REACTIONS. (Ib/size) 7=837/Mechanical,1=837/Mechanical Max Horz 1=187(LC 13) Max Uplift 7=35(1_C 14),1=-34(LC 14) FORCES. (lb)-Max.Comp;/Max.Ten.-All forces 250(lb)or less except when shown. TOP CHORD 1-2=-945/128,2-3=-7311167,3-4=724/149,4-5=-866/115,5-6=-634/55,6-7=-830/77 BOT CHORD 1-9=-971589,B-9=-70/583 WEBS 2-9=-256/156,3-9=128/504,4-9=-2541143,5-8=678/124,6-8=-98/960 NOTES- 1) OTES-1)Unbalanced roof live loads have been considered for this design,, 2)Wind:ASCE 7-10;Vuit=130mph(3-second gust)Vasd=103mph,TCDL=6,0psf;BCDL=6,Opsf;h=25ft,B=45ft;L=24ft,eave=4ft;Cat. II,Exp B;enclosed,MWFRS(directional)and C-C Exterior(2)0-0-12 to 3-0-12,Interlor(1)3-0-12 to 7-2-14,Exterior(2)7-2-14 to 10-2-14,Interlor(1)13-3-9 to 14-4-8 zone,cantilever left and'right exposed;end vertical left and right exposed,C-C for members and forces&MWFRS for reactions shown;Lumber DOL=1.60 plate grip DOL=1.60 3)TCLL ASCE 7-10;Pr=30 0 psf(roof live load:Lumber DOL=1:15 Plate DOL=1,15);Pg=50.0 psf(ground snow);Pf=38.5 psf(flat roof snow Lumber DOL=1.15,Plate DOL=1,15);Category II;Exp B;Partially Exp.;Ct=1.1,Lu=50-0-0 4)Provide adequate drainage to prevent water ponding. 5)This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads, OF NEW 6)`This truss has been designed for a live load of 20 Opsf on the bottom chord In all areas where a rectangle 3-6-0 tall by 2-0-0 wide will fit between the bottom chord and any other members. �� w 40 Q� 7)Refer to girder(s)for truss to truss connections: B)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift atloint(s)7,1. 9)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. _ wJ c, 10)Graphical purlln representation does not depict the size or the orientation of the purlin along the top-and/or bottom chord. 1Ul ti July 26,2019 ®WARNING-Verify design Parameters and READ NOTES ON THIS AND INCLUDED A41TEK REFERENCE PAGE Mll-7473 rev,10/03/205 BEFORE USE. I Mnlgu valfd far 60 60Y d6lbn 1s 6=0 wily upon parametaro sht%%dnd id'lu all IndN1eAmi 4ulkiffna CJtrpwt001,not a buss eyafoir Bolmo uno"the bu ldnig'dasirnar,'rnusl vertfyU a ap{diWp(ilty of rlanlgn Pammntem and pmprity Inaxp ;�nifv drlxOn rata tllh vrrxall bVila 0 "llin.-Orselnp¢trticntnd Into preveg!nnrJdbsp n1 individual truss heD dpdtorrho it momboia oNy:Addlflonal ieulp-rate yiitl p�lmennhf W¢efrr9 M��( Is eiwdyP ra40l;ad for atob illy 0W tb pfo nj nose will poplibio Pcram ai inju y and proP^i ipmng t.Filrgr ncrnl puiddnge rognMiRq Ilia• (nl<lcotiarl piarxsu Uctt',dyfb a niS bruiliflptf tnisyes attid hu 3 eyatiKnn;sdd SlRP11,Gtrihtlly Gritorla,858 59 and BC918dIldinp Component 16023 Svnngley Ridge Rd Sainte Iritarmotlon'nvollablu trod Truss Piela h1awle;210 N;Loo.Sttet�.53d;c 312;Atoxruv!a,,'VA2;3t4: Chesterfield,MO 63017 Job cuss TruaeType Qty Ply BUILDING D ROOF-VINEYARDMEW 137938925 5970R3 06 Roof Special 2 1 Job Reference(ngliorie{ Unlveisnl Coinftailent Corp., EAST HAVEN C7 06512' 8,010,Adp 11x2017 t41fiek Induslries,;nc.Mlu`Jul 25 23:15:457019 rape'1 'ID:uH8id9iAMLWQE1KtiavHVNyuWBg-12141 T Ozkldx7KJLP'38buR'4"V?09nyErawlGyuNSB l 3-7-11 7.2-14 10-10-1 ', 17=H•2 ,'1,-5 t2 I 3-7-11-- 3-7-3 3.7.3 1-10-1 1-9.10 4x4 = Scala 11 3 1314 12,00 12 �* 1x4 \\ 12 15 1x4 2 4 111 16 1x4 II dd 5x6 = 10 ftff 6� -17 18 9 19 8 20 7 3x8 II 3xH 1x4 11 4x4 = = _ Z'Z 9d - I 12•H 2 14-5-12 I 7_2-14 - 55-0 1910 Plate Offsets-X�-,Yl`�1:Ed a 0•f) .. :0 2-1.0.3 0 - - LOADING (psf) SPACING- 2-0-0 CSI. DEFL. in (loc) Wall L/d PLATES GRIP TCLL(roof) 30.0 Plate Grip DOL 1 15 TC 0.31 Vert(LL) -026 1-9 >665 240 MT20 197/144 Snow(Pf/Pg) 38.5150 0 Lumber DOL 1.15 BC 0.72 Vert(CT) -033 1-9 >515 180 TCDL 10.0 Rep Stress Incr YES WB 0 21 Horz(CT) 0.01 7 n1a n/a BCLL 0,0 Code IBC2015/TPI2014 V Matrix-S Weight 59 Ib FT=20% -BCDL - 10 0 LUMBER- BRACING- TOP CHORD 2x4 SPF No.2 TOP CHORD Structural wood sheathing directly applied or 5-9-4 oc purlins, HOT CHORD 2x4 SPF No.2 except end verticals,and 2-0-0 oc purlins(6-0-0 max) 5-6 WEBS 2x3 SPF No.2 BOT CHORD Rigid ceiling directly applied or 10-0-0 cc bracing WEDGE Left'2x4 SPF No 2 REACTIONS. (Ib/size) 7=837/Mechanical,1=837/Mechanical Max Horz 1=195(LC 13) Max Uplift 7=-36(LC 14),1=-34(LC 14) FORCES. (lb)-Max CompJMax Ten,-All forces 250(lb)or less except when shown, TOP CHORD 1-2=-946/129,2-3=-731/168,3-4=-727/150,4-5=-837/115,6-7=-285128 BOT CHORD 1-9=-126/589,8-9=-91/586,7-8=-93/584 WEBS 2-9=-256/155,3-9=-1301508,4-9=-2591142,5-7=-9071112 NOTES- 1)Unbalanced roof live loads have been considered for this design 2)Wind ASCE 7-10,Vult=130mph(3-second gust)Vasd=103mph;TCDL=6.Opsf;BCDL=6„Opsf;h=25ft,B=45ft;L=24ft;eave=4ft,Cat, 11;Exp B,enclosed,MWFRS(directional)and C-C Exterior(2)0-0-12 to 3-0-12,Interlor(1)3-0-12 to 7-2-14,Exterior(2)7-2-14 to 10-2-14,Interior(1)12-8-2 to 14-4-8 zone;cantilever left and right exposed;end vertical left and right exposed;C-C for members and forces&MWFRS for reactions shown;Lumber DOL=1 60 plate grip DOL=1.60 3)TCLL-ASCE 7-10,Pr=30,0 psf(roof live load Lumber DOL=1.15 Plate DOL=1.15);Pg=50,0 psf(ground snow);Pf=38.5 psf(flat roof snow•Lumber DOL=1 15 Plate DOL=1 15);Category Il;Exp B,Partially Exp.;Ct=1.1,Lu=50-0-0 4)Provide adequate drainage to prevent water ponding. �! O� �EVV 5)This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads V 6)”This truss has been designed for a live load of 20.Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide will fit between the bottom chord and any other members, a�0/�AI 7)Refer to girder(s)for truss to truss cnnnections. 8)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift at joint(s)7,1. 9)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along a the Top Chord and Bottom Chord,nonconcurrent with any other live loads. j- 10) Graphical puriin representation does not depict the size or the orientation of the purlin along the top and/or bottom chord. 0, �o-0ggq.3 ti SOF July 26,2019 ®WARNING.-Verify design parameters and READ NOTES ON THIS AND INCLUDED MITEt REFERENCE PAGE MII-7473 rev YD/03!2015 BEFORE USE nill l3eaipn,vOldtmlln8oAIYv; 1?.1Eie:.c cannecror'.,71risCtsinnIsL•.n'sdtic��l,lip=i Punciet:'Es•'11"nKt.aM_la:taxon[ndN4d,_+nttwatt[ngdlmnLnunl{va .n inks uy6lem-anfar8 use,trio euild4�g'Wrslgnor imipt Verity the epplicabillty,el doslan pamimwit,rind propody inoorporato fills dnzlan W6 I' �,��. Badu q dnMpn.Brae ng Indiwtnd is to prrrlem 4icr lingp of IndlVllldill lroa3 W t 1Sn1U'et rs bnty.Addltlbaal Imporory 6ml pcmannnl bracing chard membe 1.J avVuys tcWuuvd torsl6hllgy and le-pieunnl coil6p9n viltn possihlb f>nr�pnolLtJory,and proporty dmm�ga,Pur,nonomi guidanco,rnpareiriq the tabntUU9R,pio?og�dolrveauryy ncbctian and 6mdna of Inr�szs nud lrusssya}um.^..s n ANSI11P11,Qu6illy critadu.D59-a9 and 6Csi_aididing Component 16023 Sxtngley Ridge Rd Salaly Informction aVnilUMn I+nn>Trv6s Plnlu Insatdto:2la t�/Is'o Shoot,Sciria 312,Alaxnn�fin,VA".23U1., 991 Chesterfield,MO 63017 Soli toss Truss Type " Qty---'-Ply 9UILDING t} ROOF VINEYARD VIEW I 137936926 35970133 07 Roo{Special 2 1 dab Ra&i<nai d itoiiail -- Universal Component-Cdrp.,, EAST HAVEN CT 065'12 - -- - - 8.010 s Aug-11 2017 tl4ftk Industries,Inc, Thu Jul 25.23:15;482019 Page 1 ID:uHeIG9iAM9_W QEtKnavHVNyuW Bg-zR6v9PEFX5IsEG/rmRYDOzn7ZBXOeg30YKK_GyuNSg 3-7-11 7.2-14' 10-10-1 ---- i 13.0-9, _-1475-12 -3-7-3 3-7-3- 1-2-9- 2-5:1 4x4-= Scale.//4'--l' 3 A, /13 14 12.00 121x4 O 1 15 / 1x4 / 2 4 11• f✓ 16 6x6 = 1x4 11 10 N-, _19 _ 9 20 8 21 7 3X6 I I 3x8 = 1x4 II 4x4 = 7.2�1A ,, 12-4�9 1•'rl2- 7-P-14-- --- -- - --4=9-12 - � - -2-5-3—1 Plat a-0-1 els{aYj� .'t1:Edpe,0.0-7j -- - - -_- - - LOADING (psf) SPACING- 2-0-0 CSI-, DEFL. in (loc) Ildefl Ud PLATES GRIP TCLL(roof) 30.0 Plate Grip DOL 1.15 f TO 0,31 Vert(LL) -025 1-9 >686 240 MT20 197/144 Snow(Pf/Pg) 38,5/50,0 iLumber DOL 1.15 BC 0.72 Vert(CT) -033 1-9 >521 180 TCDL 10.0 Rep Stress Incr YES WB 0.30 Horz(CT) 0,01 7 n/a n/a BCLL 0-0 BCDL. 10.0 Code IBC2015/TP12D14 Matrix-S Weight 60 Ib FT=20% MBER- -- - BRACING- P CHORD 2x4 SPF Not TOP CHORD Structural woad sheathing directly applied or 5-9-4 oc puffins, ovT CHORD 2x4 SPF No,2 except end verticals,and 2-0-0 cc purlins(6-0-0 max,)'5-6. WEBS 2x3 SPF Not BOT CHORD Rigid Calling directly applied or 10-0-0 cc bracing; WEDGE Left:2x4 SPF Not REACTIONS, (Ib/size) 7=837/Mechanical,1=837/Mechanical Max Horz 1=203(LC 13) Max Uplift 7=36(LC 14),1=-33(LC 14) FORCES. (lb)-Max CompJMax.Ten.-All forces 250(lb)or less except when shown. TOP CHORD 1-2=-945/130,2-3=-731/169,3-4=-727/151,4-5=-798/116,6-7=285132 BOT CHORD 1-9=-155/5BB,8-9=-108/590,7-B=-109/588 WEBS 2-9=-256/155,3-9=131/509,4-9=-267/142,5-8=20/259,5-7=-889/125 NOTES- 1)Unbalanced roof live loads have been Considered for this design. 2)Wind:ASCE 7-10;Vult=130mph(3-second gust)Vasd=103mph;TCDL=6 Opsf,BCDL=6 Opsf;h=25ft,B=45ft;L=24ft,eave=4ft,Cat. II;Exp B;enclosed;MWFRS'(directional)and C-C Extenor(2)0-0-12 to 3-0-12,Interior(1)3-0-12 to 7-2-14,Extertor(2)7-2-14 to 10-2-14,Intefior(1)12-0-9 to 14-4-8 zone;cantilever left and right exposed;end vertical left and right exposed;C-C for members and forces&MWFRS for roactlons shown,Lumber DOL=1.60 plate grip DOL=1.60 3)TCLL'ASCE 7-10;Pr-30:0°lief(roof live load:Lumber DOL=1 A 5 Plate DOL=1:15);Pg=50 0 psf(ground snow);Pf=38 5 psf(flat roof snow.Lumber DOL=1.15 Plate DOL=1 15),Category II;Exp B;Partially Exp,Ct=1.1,Lu=50-0-0 4)Provide adequate drainage to prevent water ponding. 5)This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads. do �E�V 6)"This truss has been designed for a live load of 20.Opsf on the bottom chord in all areas where a rectangle 3-6-0 tell by 2-0-0 wide ,�� will fit between the bottom chord and any other members. Q" �� •`{Qf1l 0 7)Refer to girder(s)for truss to truss connections. rn �O 8)Provide mechanical connection(by others)of truss to bearing plate Capable of withstanding 100 Ib uplift atjoint(s)7,1. *, �C�' _ ,0 9)This truss has been designed for a moving concentrated load of 250.0Ib live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 10)Graphical puriin representation does not depict the size or the orientation of the puriin along the top and/or bottom chord, �' e_ U1 `4p-0.099A33', q°�cssio��- July 26,2019 ®WARNING-Venfy design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE Mt1.7473 rev 10/0312015 BEFORE USE. i qel(p{VfidfarI7RVDpfyR:lllttt'edtCT3'COfi11+Y(Dti.Tll3d ill(Rtln9lldDlltyup*hpwaffieietgshov1n.andIstoninIndvictualbiiMngeoniPmlpnl:not ; a{ttius ayalerri.8urom ueo.ilia building do&jner,mmI4 onfy,tbD DDltllaptlultyDl Cosign pmumotam and Iuop dyfparperolalH{f do gn'Iii1G mu ova+aU bUtdlap,An.^.jyn ifroaitpPndi=todYgtnrrrq DntLlnWlfttgvftnd!vfduDltnrsnyV h¢ridkuchatdmeinheraanly.,AddlucnAticmtxraryaadt rdGnonlbr3dnp' MiTe , !.11 1 amquimdfira Lilly nnd16pf&ealEN14146wlgt'obsstefD,pairmialk*;oampropwtydumfiga ForOonaml�ujdhdcp'rogn+dn0lha (ahr{p{lgn,Alai ago,duily— emckionand bmcingoffruaiaiant)Ilussaydtvril$,lion' A1151Rp11qunlltyCtltara-,WEI-69and BC81Building Component t Ifi023,5vr"ng{vyR171po(td Shfoty lnfartnoUannvaElDhie(ram TnmsPlDty lnnittuty:218 N.Lca Struat,SuiEC 312,Alaxandrjn.VA 2231A= 1 Ctta_tntfk ld;htf5' Q77- Jgp, truss Truss Typa - Qty Ply BUILDING D ROOF VINEYARD VIEW 137938927 35970R3 T08 Roof Speclal 2 1 Job Reference oohonaq - - - - - UNNOrsal'Component Cor'p;, EAST HAVEN CT 06512 -8,010 s Aug 112017 MiTek Industries,Inc. Thu Jul 25 2315:492019 Page 1 ID uH8lG91AM9_WQEtKnavHVNyuWBg-RdgCwVQsOrDcUOrvPU7nmOWwlzXr75_bEC4tXeyuNS8 3.7.1 7.2-14 11-54_ 14.5.12 i 3.7-11 3 7-3 " 4-2-4 3_0.10 4x4 w Scale 1 3 12' 13 12.00 12 1x4 6x6 = 4x4 = 10 15 17 8 16 7 19 3x8 I I 6 3x6 = 4x4 = 1x4 I1 7-2.14 ; 11-5-1 14-5,42 I 7-2-14 -moi A-2-4 3� 10 Plate Offsets(X yh_-.f1:Cdge,4-,0.71 - LOADING (psf) SPACING- 2-0-0 CSI. DEFL. in (loc) I/deft Lld PLATES GRIP TCLL(roof) 30.0 Plate Grip DOL 1 15 TC 0.40 Vert(LL) -0.24 1-8 >707 240 r MT20 197/144 Snow(Pf/Pg) 38.5150.0 Lumber DOL 1.15 BC 0,71 Vert(CT) -0.33 1-6 >526 180 TCDL 10.0 Rep Stress Incr YES WB 030 Horz(CT) 0,01 6 n/a n/a BCLL 0.0 Code IBC2015/TPI2014 Matrix-S Weight:62 ib FT=20% SCOL tori — - — LUMBER- BRACING- TOP CHORD 2x4 SPF No.2 TOP CHORD Structural wood sheathing directly applied or 5-9-4 oc puTIMS, BOT CHORD 2x4 SPF No.2 except end verticals,and 2-0-0 oc purlins(6.0-0 max.),4-5. WEBS 2x3 SPF No:2 BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing, WEDGE Left:2x4 SPF No.2 REACTIONS. (Ib/size) 6=837/Mechanical,1=837/Mechanical Max Horz 1=210(LC 13) Max Uplift 6=37(LC 14),1=-32(LC 14) FORCES. (lb)-Max CompJMax Ten -All forces 250(lb)or less except when shown. TOP CHORD 1-2=-9431131,2-3=729)170,3-4=738/138,4-5=-589/111,5-6=-BO21127 BOT CHORD 1-8=-183/586,7-8=1231607 WEBS 2-8=-253/153,3-8=-109/470,4-8=-257/130,4-7=-630/139,5-7=-128/888 NOTES- 1)Unbalanced roof live loads have been considered for this design_ 2)Wind,ASCE 7-10;Vuit=130mph(3-second gust)Vasd=103mph;TCDL=6.0psf;BCDL=6.Opsf;h=25ft;B=45ft;L=24ft;eave=4ft;Cat, II;Exp B;enclosed;MWFRS(directional)and C-C Exterior(2)0-0-12 to 3-0-12,Interior(1)3-0-12 to 7-2-14,Extenor(2)7-2-14 to 10-2-14,Interior(l)11-5-1 to 14-4-8 zone,cantilever left and right exposed;end vertical left and fight exposed,C-C for members and forces$MWFRS for reactions shown,Lumber DOL=1.60 plate grip DOL=1.60 3)TCLL:ASCE 7-10,Pr=30.O psf(roof live load:Lumber DOL=1-.15 Plate DOL=1.15);P9=50.0 psf(ground snow);Pf=38.5 psf(flat roof snow Lumber DOL=1 15 Plate DOL=1 15);Category ll;Exp B;Partially Exp.;Ct=1:1,Lu=50-0-0 4)Provide adequate drainage to prevent water ponding. 5)This truss has been designed for a 10 0 psf bottom chord live load nonconcurrent with any other live loads, bF NtEi r 6)'This truss has been designed for a live load of 20.Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide ty. will fit between the bottom chord and any other members, ��//� O� 7)Refer to girder(s)for truss to truss connections, 8)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift atjoint(s)6,1, 9)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads, ' 10)Graphical puriin representation does not depict the size or the orientation of the purlin along the top and/or bottom chord. �9.0994 g0�CS51�� July 26,2019 ®WARNING-Verity design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PARE MII-7473 reV 1010312015 BEFORE USE D Ipn vurid for use only wSlh MI7a!9connuclnrs Thidm'lln to has-^d only upon phmm-_tem Myo:4n,and i=_far an 1urLai¢Oitl hu'ding 0PT9nont,poi p d in appti blllty of doslg -3 bops syrntum,e'olafo usa,lhq'hulrpmg duslal'.w.mHly0fifyu �pnmrpalurcSfid t prapurt}!mcoipulc ItlisduSgn Inluiliu ovoln'.i_ 191/1�� liulidinpuunlljn..Arreshlg'Ifldltat7dlstgprnvnyi,bucvdiS%afLtdtvtdUntbuesyroharidfotebCrdmninhtireonty Adddwnnlfontpararyartdpmmananthrneing ! Welt to o(K?1y3 roquired tui id3Aihty and to IvoVanl rolin irmynth p!u511t14 puroaonf injury and propertydotnago.For qt meal tnilifnnca ropld$g Ifiu t fiA4Icndvr,stonpo,doliuiuy,ua i6rdonnd bradtig of liuss_�1 fnd tross Wito`rna,soa ANSInPll Quality CrlteHa,DSO-89 acid SCSI Bullding Component 16023 Swmgley Ridge Rd SnPoty lntommlion av-aN:.t71n hum Tnrda P)n1o,Inpiiuno. iB,N.Lsa,Slfemt,Swto;312,AlNiandric;VA 12314. Chesterfield,MO 63017 Job toss Truss Type r'—- lQty ply jJob DING D ROOF VINEYARD VIEW 137938928 35970R3 09 Roof Special 2 Reference!notional UnNaisa_i Component Corp„ EAST HAVEN-CT 06512 - - 8.010 s Aug 11 2017 MiTek Industries,Inc.-'PAP Jt1)25 23.15:50 2019 Page 1 ID uH84GS'Ah19_'N�EtK^3vHVPty-kAlBg-vgEb8gRUm9LT6YQ5yBU0tR26YNt9sYUMTspR35yuNS7 37-11, t 7=-74 4 10.9.10_ , 14'.5-12_ �— 37411 3-7-3= 4x4 Scale 114°=1' 3 12 , 13 12,00 12 1x4 �� 1t 146x6 = 4x4 = 5 2 'IS""----� r 10, 9 N 17 - 8 - 18- --�- 19 3x8 II 6 3xB = 44 = 2x4 II 7L2=74_ 10.9.1fa, 74.512 ----1_. 72-14 3=8-3 - - -- - -- - -- -- -- --- -- ---- - 'Plate OffeefsiX•YhId?d e0� LOADING (psf) SPACING- 2-0-0 CSI. DEFL. in (loc) I/deft L/d PLATES GRIP TCLL(root) 30,0 Plate Grip DOL 1.15 TC 0.35 Vert(LL) -024 1-8 >723 240 MT20 197/144 Snow(PfIPg) 38.5!50 0 Lumber DOL 1.15 BC 0.71 Vert(CT) -032 1-8 >532 180 TCDL 10,0 Rep Stress Incr YES WB 0,29 Horz(CT) 0 01 6 n/a n/a BCLL 0.01, Code IBC2015/TP12014 Matrk-S Weight*63 Ib FT=20% BCDL- 10.0 - IMBER- BRACING- )P CHORD 2x4 SPF No.2 TOP CHORD Structural wood sheathing directly applied or 5-94 oc purlins; ..JT CHORD 2x4 SPF No 2 except end verticals,and 2-0-0 oc purlins(6-0-0 max)'4-5,. WEBS 2x3 SPF No.2 BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing WEDGE Left:2x4 SPF No.2 REACTIONS. (Ib/size) 6=837/Mechanical,1=837/Mechanical Max Horz 1=218(LC 13) Max Uplift 6=-38(LC 14),1=-31(LC 14) FORCES. (lb)-Max CompJMax.Ten,-All forces 250(lb)or less except when shown. TOP CHORD 1-2=-943/133,2-3=-729/172,34=715/150,4-5=-6671117,5-6=797/141 BOT CHORD 1-8=-209158 7,7-8=-131/582 WEBS 2-8=-2561156,3-8=-129/503,4-8=-260/131,4-7=-589/138,5-7=-129/841 NOTES- 1)Unbalanced roof live loads have been considered for this design. 2)Wind ASCE 7-10;Vult=130mph(3-second gust)Vasd=103mph,TCDL=6.Opsf;BCDL=6.Opsf;h=25ft;B=45ft;L=24ft;eave=4ft;Cat- 11;Exp B,enclosed,MWFRS(directional)and C-C Exterior(2)0-0-12 to 3-0-12,Interior(1)3-0-12 to 7-2-14,Exterlor(2)7-2-14 to 10-2-14,Interior(1)10-9-10 to 14-4-8 zone,cantilever left and right exposed;end vertical left and right exposed;C-C for members and forces&MWFRS for reactions shown;Lumber DOL=1.60 plate grip DOL=1 60 3)TCLL•ASCE 7-10;Pr=30.0 psf(roof live load:Lumber DOL=1.15 Plate DOL=1,15),Pg=50 0 psf(ground snow),Pf=38 5 psf(flat roof snow Lumber DOL=1.15 Plate DOL=1 15);Category Il;Exp B;Partially Exp;Ct=1.1,Lu=50-0-0 4)Provide adequate drainage to prevent water ponding, 5)This truss has been designed for a 10,0 psf bottom chord live load nonconcurrent with any other live loads OF NE Fir, 6)`-This truss has been designed for a live load of 20.Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide YY will fit between the bottom chord and any other members -n �. Jo"; fob" - toss toss TyFe. —Qty Ply - PUILDING D ROOF VINEYARD VIEW• 137936929' 3597OR3 TIO RgBf S1ina ia1 2 1 E Job Reference (optional _ Un ve=Sa!Component Corp, EAST HAVEN CT 06512 _ 8.010 s Aug 11-2017 MITek ladustties,lha Thtl Jul 25 23.15:51 2019 Page 1 ID uH81G91AM9_WQEIKnavHVNyuWBg-NOoiLAR6XSTKji7HWd7FrebG9nDUb7kWIWZ_bXyuNS6 3.7<11 7-2-1410'2.2 14-5"12_-- 3-7-11 r� 3.7,g —j -211-4 �1 4-3-11 44 = Scale V 3 13 12 4x4 = 12.00 12 6x6 1x4 5 2. y 10 ~ 7 16 8 17 7 18 6 3x6 11 3x8 = 4x4 = 2x4 II 7:2.14 :.1a•2-2 M BA2 ..1.3:11' Plate Offsets LOADING (psf) SPACING- 2-0-0 CSI. DEFL. in (loc) Ildefl Ud PLATES GRIP TCLL(roof) 30.0 Plate Grip DOL 1,15 TC 0,42 Vert(LL) -0,23 1-8 >741 240 MT20 197/144 Snow(Pf/Pg) 38.5/50 0 Lumber DOL 1.15 BC 0.70 Vert(CT) -0.32 1-8 >541 180 TCDL 10.0 Rep Stress Incr YES WB 0.29 Horz(CT) 0.01 6 n/a n/a BCLL 0,0Weight 65 lb FT=20% _$CDL 10.0 Code IBC2015/TP12014 Matrlx-S LUMBER- BRACING- TOP CHORD 2x4 SPF No.2 TOP CHORD Structural wood sheathing directly applied or 5-9-5 oc purlins, BOT CHORD 2x4 SPF No 2 except end verticals,and 2-0-0 oc purlins(6-0-0 max.).4-5 WEBS 2x3 SPF No.2 BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing WEDGE Let 2x4 SPF No 2 REACTIONS. (Ib/size) 6=837/Mechanical,1=837/Mechanical Max Horz 1=226(LC 13) Max Uplift 6=-53(LC 11),1=-30(LC 14) FORCES. (lb)-Max CompJMax.Ten.-All forces 250(lb)or less except when shown TOP CHORD 1-2=-943/134,2-3=-7291173,3-4=-6951163,4-5=546/124,5-6=-7931154 BOT CHORD 1-8=-234/588,7-8=-142/557 WEBS 2-8=-258/159,3-8=-150/540,4-8=-2751137,4-7=-5541142,5-7=-135/798 NOTES- 1)Unbalanced roof live loads have been considered for this design, 2)Wind'ASCE 7-10;Vult=130mph(3-second gust)Vasd=103mph;TCDL=6,Opsf,BCDL=6.0psf;h=25ft;B=45ft,L=24ft,eave=4ft,Cat. 11,Exp B;enclosed,MWFRS(directional)and C-C Extenor(2)0-0-12 to 3-0-12,Intenor(1)3-0-12 to 7-2-14,Extefior(2)7-2-14 to 10-2-2 zone;cantilever left and right exposed,end vertical left and right exposed,C-C for members and forces$MWFRS for reactions shown;Lumber DOL=1.60 plate grip DOL=1.60 3)TCLL:ASCE 7-10;Pr--30 0 psf(roof live load Lumber DOL=1.15 Plate DOL=1.15),Pg=50.0 psf(ground snow),Pf=38 5 psf(flat roof snow Lumber DOL=1.15 Plate DOL=1.15),Category II,Exp B;Partially Exp,Ct=1 1,Lu=50-0-0 4)Provide adequate drainage to prevent water ponding, 5)This truss has been designed for a 10.0 psi bottom chord live load nonconcurrent with any other live loads. 6)'This truss has been designed for a live load of 20.Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide P,�¢�W JDy will fit between the bottom chord and any other members. 7)Refer to girder(s)for truss to truss connections. CD 8)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift at joint(s)6.1. 9)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along 1 the Top Chord and Bottom Chord,nonconcurrent with any other live loads, 10) Graphical purlin representation does not depict the size or the orientation of the purlin along the top and/or bottom chord. ; •099433' ROr-'Esslo0�� July 26,2019 tiamrs ®WARNING-verify design parameters and READ NOTES ON THIS ANOINCLUDED MITEK REFERENCE PAGE 01-7473 rev.1010312015 BEFORE USE. ,danignvalid for use onlyvxlh Mr't9k cogaaeten4Thi doolgn is based only upon paramolemahsvtt,and is for an individual building component,not a 4uss 6yltium Before 1RIe,the bdddidg daatgiler mbmt vain}tha'appbcoblldy of design paramutur8 nud properly incorporate this design into the overall b99d1np dm& Bra Unit Indicated r3*to prOvopl huAlln9 rlf l'Jividupl t(ms web and/or chord members only,Additional temporary and permanent bracing MiTek' is always required for stability and to prevent collapse with possible personal injury and property damage,For general guidance regarding the fabrication,storage,detivor,erection and bracing of trusses and truss systems,see ANSIRPli Quality Criteria,DSB-69 and SCSI Building Component 16023 Swinglay Ridge Rd Safety Information,nvullnlrto from Truss Plate Institute,218 N Lee Street,Suite 312,Alexandria,VA 22314 Chesterfield,MO 63017 Job Truss Truss Type---- -' — -- Qty Ply BWLDING,D ROOF VINEYARD VIEW 137938930" 95970R3 T11 Roof Special 1 1 - Universal Component Corp., Y EASTHAVENI CT 06512 -- - - 8.010 s Aug,11,2017 MiTek Industries,Inc. Thu Jul 25 23 15;52 2019 Page 1 - iDuHa4GgiAM9_WQEtKnavHVNyuW Bg-rCMLYWSkl mbBLsaU4cW UOsBPJAZQKRGfwAIY7zyuNS 5 40-10,8 3.771 7-2-14 1 9-6.9- - 14-5-12- --_---- , 4-11-3 4x4 = Scale 114'=1' 4 i16 " 6x6 4x4 = 12 I �' 6 12.00 12 -_- ZI 1 x414 ✓ •-r ~ 15- 3CP 19 2 - — - — - - 16 9 17 8 18 3x8 II 7 3x8 = 40 = 2x4 II 7-2-14 9.6 3 14-5-12 =12-14 " -2-3-11" 4-11'-3 Plate Offdels(X ,-1 9e�D O'71-- - — - - _ LOADING (psf) SPACING- 2-0-0 CSI; DEFL. in (]cc) I/deft Ud PLATES GRIP TCLL(roof) 30.0 Plate Grip DOL 1.15 ; TC 0,56 Vert(LL) -0.20 2-9 >839 240 MT20 197/144 Snow(Pt/Pg) 38.5/50.0 Lumber DOL 1.15 BC 17.65 Vert(CT) -0,28 2-9 >614 180 TCDL 10.0 Rep Stress Incr YES WB 0,33 Horz(CT) 0.01 7 We n1a BCLL 0.0 Code IBC20151TP12014 Matrix-S Weight'68 Ib FT=20% BCDL- -- _ _ 1 O-O I -- MBER- - — BRACING- P CHORD 2x4 SPF No2 TOP CHORD Structural wood sheathing directly applied or 5-11-2 cc purlins, __T CHORD 2x4 SPF Not except end verticals,and 2-0-0 cc purlins(6-0-0 max.):5-6. WEBS 2x3 SPF No2 BOT CHORD Rigid ceiling directly applied or 10-0-0 cc bracing WEDGE Left'2x6 SPF No2 REACTIONS. (ib/size) 7=823/Mechanical,2=939/0-5-8 Max Horz 2=242(LC 13) Max Uplift 7=-72(LC 11),2=-65(LC 14) FORCES. (lb)-Max.CompJMax,Ten,-All forces 250(lb)or less except when shown, TOP CHORD 2-3=-938/122,3-4=-706/162,4-5=-6611166,5-6=-5121125,6-7=-7751167 BOT CHORD 2-9=-252/554,8-9=-1541521 WEBS 4-9=-152/550,5-9=-3081143,5-8=-5011151,6-8=-1421741 NOTES- 1)Unbalanced roof live loads have been considered for this design, 2)Wind.ASCE 7-10;Vult=130mph(3-second gust)Vasd=103mph;TCDL=6-Opsf,BCDL=6,Dpsf;h=25ft;B=45ft;L=24ft;eave=4ft-,Cat_ II;Exp B;enclosed,MWFRS(directional)and C-C Exterlor(2)-0-10-8 to 2-1-8,Intetfor(1)2-1-8 to 7-2-14,Exterior(2)7-2-14 to 9-6-9 zone;cantilever left and right exposed;end vertical left and right exposed;C-C for members and forces&MWFRS for reactions shown;Lumber DOL=1 60 plate grip D0L=1 60 3)TCLL'ASCE 7-10,Pr-30,0 psf(roof live load Lumber DOL=1.15 Plate DOL=1.15),Pg=50 0 psi(ground snow);Pf=38,5 psf'(flat roof snow'Lumber D0L=1 15 Plate DOL=1.15),Category 11;Exp B;Partially Exp.;Ct=1:1,Lu=50-0-0 4)This truss has been designed for greater of min roof live load of 12.0 psf or 1 00 times flat roof load of 38.5 psf on overhangs non-concurrent with other live loads. (vP�/ 5)Provide adequate drainage to prevent water ponding, 6)This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads; �0 � JO&A 7).This truss has bean designed for a live load of 20 Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide iy will fit between the bottom chord and any other members. y 0 8)Refer to girder(s)for truss to truss connections. Q 9)Provide mechanical connection(by others)of truss to bearing plate capable of wlthstanding 100 Ib uplift at joint(s)7. _ • ,t ( ;' 10)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT atjl(s)2.This connection is for uplift only and does not consider lateral forces, ifl C '' }" W 11)This truss has been designed for a moving concentrated load of 250.0 lb live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any,other live loads, 12)Graphical puriln representation does not depict the size or the orientation of the purlin along the top and/or bottom chord., �r TOP ES+S1a�P July'26,2019 ®WARNING-Verify design parameters and READ NOTES ON THIS ANO INCLUDED MITEK REFERENCE PAGE MIJ-7473 rev.1010312015 BEFORE USE € ` f7c�ign vnlld,Idr u a anly,wlth lhTat oa n�cWra.lips rtes pri is tvi?nJ oady upon para r�fara alrnwn,on ui t6t an todir ffunl 4al01ng rl runt,not s ' n truG6'ayatdIns 0afato usm9thd buiklibp'dns goer tnuatvnilfyy the aPAilca411RY,?f dobtrmm pgmm�Upc artst,prapntly tticaiprrHtn dii¢dtxt�n tnta l6p nvuialt ■ Fnracln0 daalIIn'9mtlpq indfgtad L1lu,ptrvt=n!6txJ link of tttdlvldahl lrunswehnndLa shad marphu Doty.ftdd 6nngi[mcipctatyimd potmhnenl hdi Jny WOW u ntwayn 2t;aitad,roc StaUlifl�r Drill at pta I cGtORCa aitii pass littt'PnrnUnaf fnittty nn l Ptopprtydnrluign.For ganamt =,u u tupnrd rig tib taWicntloll,elnrapa,dell4ary a aiQ4n nntl ttrttnjj of UitsSE3-ptFd I+V ,Oy+fetn5,lnd' nNSifrpll,tluallly 4titetlo,DS134i9 and SCSI Etulidlnp Component 1 16023 Swingley Ridge Rd Satoty lnfomtailon w allnhla'ilan TN9sPlato fnn4Iuta,218 N.LB6 Sttanh 5ult5 1l2.p"exapdtfd,tiA: 411; Chaslerlfeld,M0 63017 D5 = - Tracts TNebYf?a -- l _ 'Qty' ?IY BUILDING D ROOF VINEYARD V1F.Vy 137938931 35970R3 ,112 Roof Special !'�tih Rsferenre`o'ilial)- Universal Component`Cbrp.1 EAST HAVEN CT 06572 u y B4OS(3.s AUg 11 2017 MTek Industries;InC 7110 Jul 25 23:15.53 2019;Prit{e' R 5gQyuNS4 ID:uHeIG9!AM9 WQEtKnavHVNyuWBg-JPv4msTM34k2z09geJ1jW3gWXavp2tdp9g2 pp 149` 7-11 7-2-14 Scale.11 4x4.1= 4 ti_.— m-.s �• ; 7 13 :.GxG' 4x4 8 12 X1+3 12,00 121x4 i 3 11 r 10 ° 2 ?' 15 9 16 6 17 7 3x8 If 4x4 II 3x8 = 4x4 = 7-2-14 p't3 1 j-I 'I 14-5•'72 7244 T a 1 8 3- a*6+11:_ Plate OffseL�(X Y)= 'f2 EdpQ.O G 7�,►5.0 3=Q 0-3-'ll. _Edad,0 274 LOADING '(psf) w CSL DEFL. In Qoc) I/dell Lid PLATES GRIP TOLL(roof) 30.0 Y SPACING- 2-0-0 Plate Grip DOL 115 TC 0,81 Vert(LL) 0 20 2-9 >Bfi6 240 i MT20 197/144 Snow(Pf/Pg) 38,5150 0 Lumber DOL 1,15 BC 0.64 I Vert(CT) -0.27 2-9 >632 180 TCDL 10.0 p Rep Stress incr YES WB 0.39 Horz(CT) 0,01 7 n1a n/a BCLL O•Q Code IBC20151TP12014 Matrix-S Weight'70 Ib FT=20% --CiCDL-- -- --_10Or _ — - _ ---- - - LUMBER- BRACING- TOPCHORD 2x4�SPF No,2 TOP CHORD Structural wood sheathing directly applied,or 5-11-2 cc purlins, BOT CHORD 2x4 SPF No:2 except end verticals,and 2-0-0 oc purlins(5-10-6 max.):5-6. WEBS 2x3 SPF Not BOT CHORD Rigid ceiling directly applied or 10-0-0 cc bracing. WEDGE Left:2x6 SPF No 2 REACTIONS. (lblsize) 7=823/Mechanical,2--93910-5-8 Max Horz 2=250(LC 13) Max Uplift 7=89(LC 11),2=-64(LC 14) FORCES. (lb)-Max.Comp./Max.Ten:-All forces 250(lb)or less except when shown. TOP CHORD 2-3=-938/120,3-4=-706/159,4-5=-660/178,5-6=-490/132,6-7=-771/182 BOT CHORD 2-9=-2741555,8-9=-170/497 WEBS 4-9=169/610,5-9=-357/155,5-8=-4691165,6-8=-1541703 NOTES- ed'o6flive�lp�s,'ilave tiesn yron5�1derad tar=lhFstlesign, 2) Wind:'14SCE�-t0;Vutt=1'JQrlfph(3 socant!gusty Vasd lJ3rrlpii.TCOLC=G.Opsf,,BGQL=6,gpsfi'h=25ft;�8=45fl,L.=j41j,eave=Aft;"Cat t66(p B,.-enclosed;MWFRS`(dlractfonal a4c-C'E7)-00=8 to 2-1-e,;/rlteiJGr(1)2-1 8 to.7-214x, �rtet3ai{2} -2-14"to`8-11-1 zone;cantilever left and right exposed;end vertical left and right exp ©Fc"td;C-C fon TI mhl=rs.atit)forces'&MWF,RScfo)teacll6n5, shown;Lumber DOL=1.60 plate grip DOL=1.60 3)TOLL:ASCE 7-10;Pr--30.0 psf(roof live load:Lumber DOL=1.15 Plate DOL=1.15);Pg=50.0 psf(ground snow);Pf-38.5 psf(flat roof snow:Lumber DOL=1.15 Plate DOL=1.15);Category ll;Exp B;Partially Exp.;Ct=1,1,Lu=50-0-0 4)This truss has been designed for greater of min roof live load of 12.0 psf or 1.00 times Dat roof load of 39,5 psf on overhangs non-concurrent with other live loads, of NES 5)Provido.odequate iirafflago to prevent't6tei tigpoltig. ' 6)This truss:Ties been designed for a 1115 psf 1iG�ttgtit chord live J4ad nQnconcurrent with any other live loads �4" �trW �Dy�' 7)*This trtlsshas beemdesl6ned fnr R live load�120:Opsf on the bott`am chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide -• Q ° tSQ- !F air. will fit between the bottom 6hord and any other members 8 Raferip'atrder(s)'iorLruss to lrflW onoectfons, ' ,. meCha!nit:�l�conneC!(dn`(fiy_otltrSF's)of truss to bearing plate capable of withstanding 100 Ib uplift atjoint(s)7. 101,Ono RTd USP;cotrit itors,jecommetlded,to connect truss to bearing walls due to UPLIFT atjt(s)2.This connection is for uplift only ) I w and does not consider lateral forces. 11)This truss has been designed for a moving concentrated load of 250.O1b'livt'located at all mid panels and at all panel points along the Top Chord and,Bottom Chord,nonconcurrent with any other live,fdads, 13 A. •' {7j 12)Graphical purlin representation does not depict the size or the orientetiori'oi the purlin along the top and/or bottom chord. /�� July 26,2019 ®WARNING-Verify des+gn parameters and READ NOTES 011 THISAND INCLUDED MITEK REFERENCE PAGE W-7473 rev.10/03(2015 BEFORE USE tlut{Fri vnT�t tar tieo.nnTy a?th hpTRFdD'conni�la�s.tfils desS4n ie tMsrirTanly uprin oOromP a 01i) i tind Is for4KtndFvtdaul bulidfny rom➢cn0nt,not Mit s us ayata-a 0 _04`§ ifmfiulld du�(pa0rmusjvot;typliiPppl(cal!tlitY,aldo�6nFpnrmMnr6+mdfrOpOdylrwttprKOFnIf+Suil gnilpto{hOovsM�11' 6.iJ){tin9Apl&n.vmrJnDfn3lc�fadf6l�ni�trlte�ItFiuI:F{Ifnpbttndivtd}lalfnt�swnbpn��!btdniumhdrd+nlity.AtltllDntlnlfhr�IwtaysndPbrmdnDntkrat7RD. I �� j fa nl yll$7 rv4ufmd far s2abEf3tvaild'Jf FnQ+riM.,coil�pseivun' a A©ps0iF01 injury nnd'P�apgdy dnmagu?forgarron t,qufdunra rmtl3ng nut u-.,. fabdcadan,ptcrape,dnUvvrya+uctun5+pd0incilFDottluxsesanUh4ssSySleuFS,ebe- _ AR51(TPlit303tity,CrlleMln;O588Datid8SSiHUDdingComponent 160235wld,M Ridge0Rd Sntoty fnrarmatton avalluYli6fn�i,7lUas?inta laai,tuta:2la ht.t:o0-atmat.sslltoalfi,Aro>Snrtdtlp:Vk,2z�1d. - - --!l- _ - ChesleAletd,MO 63D17 vy ` Job ;TrussTnrss Type' - -- _ - ;City Pty $U►t!31NG'D R_COF VINEYARD VIEW - - - 137938932 35970R3 T13 i3oof5�iacfaf 1 { 1 .loci Refernnra Universal Component Corp„ " EW 14AVEN CT 06512 $:010 s Aug'11 2017 MITek Industries,Inc, Thu Jul 25 23,15:55 2019 Page 1 !D.uHB!G9!AP{9_WQEtKnevHVNyuWBy Gn1UBYVdbh_ICJJ3lk3B?UmrIOcRWma5d8XCklyuNS2 �•10�. - 37.14 __-a-2-lit': R@-f0',__ _ 14{-12_ _ - 010 3-7-31 rJ '1G 6-2-3'— - [• -- 44 a Scale 1/4'=1' 4 /I. 113 5xB \\ 4x4 12 12.00 12 1x4 \\ 11 , a 3 'r `• \y - m cp 10 15 16 1 7 18 3x8"11 9 8 7 3x8 = 4x4 = 4x4 II ( 7-2-14 -- .-$3 10 14,542 7-2-14 S-fF-12 -- 6-2-3 — -- - I` 'Plate Offsets-(X,Y)-- LOADING (psf) SPACING- 2-0-0 CSI. _ DEFL. in (]cc) I/deft Ud PLATES` GRIP TCLL(roof) 30.0 Plate Grip DOL 1.15 TC 0.86 Vert(LL) -0.19 2-9 >891 240 MT20 197/144 Snow(Pf/Pg) 38,5150 0 Lumber DOL 1.15 BC 0.63 Vert(CT) -0 26 2-9 >652 180 TCDL 10,0 Rep Stress Incr YES WB 0.49 Horz(CT) 0.01 7 We n/a BCLL 0.0 Code IBC2015(TPI2014 Matr1x-S Weight-72 Ib FT=20% BCOL 9 -IMBER- BRACING- )P CHORD 2x4 SPF No.2 TOP CHORD Structural wood sheathing directly applied or 5-11-1 cc purlins, )T CHORD 2x4 SPF No.2 except end verticals,and 2-0-0 cc purlins(4-1-0 max,) 5-6 WEBS 2x3 SPF No.2 BOT CHORD Rigid ceiling directly applied or 10-0-0 cc bracing. WEDGE WEBS 1 Row at midpt 6-7 Left:2x6 SPF No.2 REACTIONS. (Ib/size) 7=823/Mechanical,2=939/0-5-8 Max Horz 2=257(LC 13) Max Uplift 7=106(1_C 11),2=-62(LC 14) FORCES. (lb)-Max.Comp/Max Ten,-All forces 250(lb)or less except when shown. TOP CHORD 2-3=-938/118,3-4=706/157,4-5=676/188,5-6=-467/139,6-7=768/198 BOT CHORD 2-9=-295/560,8-9=-187/471 WEBS 4-9=1811690,5-9=-463/166,5-8=-4361185,6-8=-169/663 NOTES- 1)Unbalanced roof live loads have been considered for this design-- 2)Wind:ASCE 7-10;Vult=130mph(3-second gust)Vasd=103mph;TCDL=6.Opsf,BCDL=6.Opsf;h=25ft;B=45ft,L=24ft;eave=4ft;Cat, II;Exp B,enclosed,MWFRS(directional)and C-C Exterior(2)-0-10-8 to 2-1-8,Intenor(1)2-1-8 to 7-2-14,Exterior(2)7-2-14 to B-3-10 zone;cantilever left and right exposed,end vertical left and right exposed;C-C for members and forces&MWFRS for reactions shown;Lumber DOL=1 60 plate grip DOL=1 60 3)TCLL:ASCE 7-10,Pr-30,0 psf(roof live load,Lumber DOL=1.15 Plate DOL=1 15);Pg=50.0 psf(ground snow);Pf=38 5 psf(flat roof snow,Lumber DOL=1.15 Plate DOL=1 15);Category II;Exp B;Partially Exp;Ct=1 1,Lu=50-0-0 4)This truss has been designed for greater of min roof live load of 12.0 psf or 100 times flat roof load of 38.5 psf on overhangs non-concurrent with other live loads. �t--QF NEI y 5)Provide adequate drainage to prevent water ponding. V 6)This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads. 1JIj :JO Q 7)"This truss has been designed for a live load of 20.Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide y�s T ' will fit between the bottom chord and any other members,with BCDL=10.0psf. 8)Refer to girder(s)for truss to truss connections, �' \ �' * '• 9)Provide mechanical connection(by others)of truss to'beanng plate capable of withstanding 100 Ib uplift at joints)except Qt=1b) f ' 7=106, _ 10)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT at jt(s)2,This connection Is for uplift only and does not consider lateral forces 'L ' 11)This truss has been designed fora moving concentrated load of 250,0lb live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. O.1 ' 4S 12)Graphical purifn representation does not depict the size or the orientation of the purlln along the top and/or bottom chord. opessl Ai9 ti,V^ July 26,2019 ®WARNING-Verify design parameters and READ NOTES ON THIS AND INCWOEO MITEK REFERENCE PAGE 01-7473 rev.10/03/2016 BEFORE USE Design valid for use only with MRek®connectors:This design Is based only upon parameters shown,and isJor an individual building component,not a truss system.Before use,the building de4pridrmust venfy the applicability of design parameters and property Incorporate this design Into the overall building design Bracing indicated is to pievtrnl'bucklmg of individual truss web and/or chord members only,Additional temporary and permanent bracing MT91( is always required for stability and to prevent collapse with possible personal Injury and property damage.For general guidance regarding Ilie fabrication,storage,delivery,erection and bracing of Trusses and truss systems,see ANSIfTPI1 Quality Criteria,DSB-89 and BCSI Building Component 16023 Swingley Ridge Rd Safety Information available from Truss Plate Institute,218 N Lee Street,Suite 312,Alexandria,VA 22314 Chesterfield,MO 63017 Jab mss Truss Type Qty Ply BUIL131NG D ROOF VINEYARD VIEW 137938933 3597OR3 14 Roof Special 1 1 J ! pit Reference a tional - - _ - — - ;Universal Component Corp„ EAST HAVEN-CT 06512 8:010 s Aug 112017 MITek Industries,Inc. Thuvhl 25 23 15.56 2019 Page 1 ID;uH8IG9lAM9 WQEtKnavHVNyuWBg-k_bsOuVFM?6cgTtFJSbQYll2nowBFC7FroGIGlyuNS1 I0 3-.7 &11 7.2-14 7 J-1-&12_ - � f -7.11 —3 7-3 XU5.r, (69-71 Scale=1 6x6 4 6x6 = 4x4 II � 11 l 1200 121x4 10 3 ,- if Af \ P ' {� 14 8 15 7. 3x8 11 4x4 4x4 = = 14.5 12 Plate-Olfsets(X;Y?=-.,j Ed '04 1,f4Edge,0-216_L K e,0-2-61 7 -6 LOADING (psf) DEFL. In (loc) I/defl L/d PLATES GRIP TCLL(roof) 300 SPACING- 2-0-0 CSI, >603 240 MT20 197/144 Snow(Pf/Pg) 38,5150.0 Plate Grip DOL 1,15 TC 0.75 Vert(LL) -0.28 2-8 Lumber DOL 115 BC 0.73 Vert(CT) -037 2-8 >462 180 TCDL 10.0 Rep Stress Incr YES WB 0.53 Horz(CT) 0.01 7 n/a n/a BCLL 0.0 Code IBC2015ITP12014 Matrix-S Weight 63 1b FT=20%� BCDL __ 10.0 LUMBER- BRACING- TOP CHORD 2x4 SPF No 2'Excepe TOP CHORD Structural wood sheathing directly applied or 5-8-15 oc purlins, 5-6.2x4 SPF 2100F 1.8E except end verticals,and 2-0-0 oc purlins(6-0-0 max,) 5-6. BOT CHORD 2x4 SPF No.2 BOT CHORD Rigid ceding directly applied or 10-0-0 cc bracing. WEBS 2x3 SPF No,2 WEBS 1 Row at midpt 5-7 WEDGE Left:2x6 SPF No 2 REACTIONS. (Ib/size) 7=823/Mechanical,2=939!0-5-8 Max Horz 2=265(LC 13) Max Uplift 7=-124(LC 11),2=-60(LC 14) FORCES (lb)-Max,Comp]Max Ten,-All forces 250(lb)or less except when shown- TOP CHORD 2-3=-922/115,3-4=-681/148,6-7=332/90 BOT CHORD 2-8=-3111567,7-8=-203/457 WEBS 5-8=0/406,5-7=-618/187 NOTES- 1)Unbalanced roof live loads have been considered for this design. 2)Wind ASCE 7-10;Vult=130mph(3-second gust)Vasd=103mph;TCDL=6.Opsf,BCDL=6 Opst;h=25ft;B=45ft;L=24ft;eave=4ft,Cat. ll;Exp B;enclosed;MWFRS(directional)and C-C Exterior(2)-0-10-6 to 2-1-8,Intedor(1)2-1-8 to 7-2-14,Exter(or(2)7-2-14 to 7-8-2 zone;cantilever left and right exposed,end vertical left and right exposed;C-C for members and forces&MWFRS for reactions shown;Lumber DOL=1.60 plate grip DOL=1.60 3)TCLL ASCE 7-10,Pr-30.0 psf(roof live load:Lumber DOL=1.15 Plate DOL=1.15);Pg=50.0 psf(ground snow);Pf=38 5 psi(flat roof snow:Lumber DOL=1.15 Plate DOL=1 15);Category Il,Exp B,Partially Exp.;Ct=1.1,Lu=50-0-0 �! �t to 4)This truss has been designed for greater of min roof live load of 12,0 psf or 100 times flat roof load of 38 5 psf on overhangs Q Ti V NE !' non-concurrent with other live loads. Q, 5)Provide adequate drainage to prevent water ponding. 6)This truss has been deslgmad for a 10.0 psf bottom chord live load nonconcurrent with any other live loads 7)'This truss has been designed for a live load of 20 Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide �d4~' flti will tit between the bottom chord and any other members,with BCDL=IO.Opsf. r U, 8)Refer to girder(s)for truss to truss connections, 9)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift at joints)except at--lb) rn { 7=124. 10)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT atlt(s)2.This connection is for uplift only and does not consider lateral forces- 11)This truss has been designed for a moving concentrated load of 250.Uib live located at all mid panels and at all panel paints along Qp "O.099113 the Top Chord and Bottom Chord,nonconcurrent with any other live loads, I r " SO Ca� 12)Graphical pudin representation does not depict the size or the orientation of the pudin along the top and/or bottom chord. July 26,2019 ®WARNING-Verity design paramefers and READ NOTES ON THIS AND INCLUDED MITER REFERENCE PAGE M11.7473 rev 10/03/2015 BEFORE USE _I aaia �• �nailfnwkSlfort:3vonlyttf4ittSiTaN�?rnnnurinrb11e6aQealpnl9hsxrdtartlyHtimiparuntateteshyvn;wtdlsfar anlSrdtyidvel(rlhtadulidla y pv neat,not } plr(lnn,a;�atnm.Betoivusn,ura6ulid6ngJdvlgnnrn,llslvoritpOutapyllsalol}tyvldvr>idnpnnmvlB!t�nndprgpartyfnwrpvtnlevWflnintethcwonUl � KtsM°�'�1�, hulldinpfleslpn,srncgptnrr�lrids/o'proud/u,MrrJillnaohJiltllvl:11181tn1SswabAOdlnrvlrcutf'in4ruf,at6artlY��dlflooellutnpamrytitidpdmtanrnlCrisefnp � EV® f lsufwuyo requ�rad rm ot8hiflly and ie pratieNe�lapar wllh p4rraf>fv Iietvo0stl iaiJury,nntt t>ta00ity dam89a='PvrtIvfiC.'nl4uidancvregnidgp ihn , fittKlcM(9n,atgmyye:da3ivvlryy arvuCan and bt,ceri9t of(mssas aril dusa syatttln aeo, ANGiRPt1 g4allly.GrllaritiiD9B-98 and 0051 Bttilding Cvmponvnt Chest Swld,M Ridge Rd 'saloly,lnto}ntltuon oval/ablaRem7tusePlafflln."OW(Ur'.3-18N,t.a6Strairt,9uI1o31R;Ninaandde+,VA22S1�f. ' I Chesterfleid`M063017 Job -- tossty Ply BUILDING,D'ROOF VINEYARD VIEW 137938934 3597OR3 15 Roaf-Spaciai 1 1 ` -- - __ �Job'R4teierice'�s-ti6na}.. -- --- - Univer?alComponent Corp„ EAST htAVERJ CT06512 - -' 8,010 s'rilug 1i 201;Ti�tYL4t Industries,Inc,Thu Jul 25 23:15:57.20t9"P ge'.1' ID.uH81G91AM9_WQEtKnavHVNyuWBg-CA9EcEWt71ETRdSRt95f5vrHFBID_gUO4SOJpByuNSO 10-2-13 -�-40:fI 3-1�-_.___ � _&xtt _ __r .e�;y '3•F-t0'- _ .14.5.12 89u.ar 3.1:9 3-1-2 2-.•1^, - i1-03' T -----4.2-15=---- I 4x4 = Scale 114"=1' 5x10 = 8 6x8 — 4x4 11 ., 6X6 — - - 8 15 12.00 12 1x4 c t� 3 i^MOl 14 13 ✓ k - 2 20= 12 21 11 22 10 23 3x8 II 9 3x8 = 1x4 II 3xB = 4x6 = &•2-i t' 877` "10.213 , 14-5-12-- _ t _ - I --8-#-17 ^-- - -2-0=12" `1-'_l.6=�_ "- .4.2.15-� ' Rlate�tfsets{X,Y} :a= ,'4:Q.4-3 Edri 6144PO 3-45doe,,8 Edgjo-z-61. -_ - LOADING (psf) SPACING- 2-0-0 CSI. DEFL. in (loc) Ildefl Ud PLATES GRIP TCLL(roof) 30.0 Plate Grip DOL 1.15 TC 0,51 Vert(LL) -0,13 2-12 >999 240 MT20 197/144 Snow(Pf/Pg) 38,5/50,0 Lumber DOL 1.15 BC 0.55 Vert(CT) -0,18 2-12 >965 180 TCDL 10,0 Rep Stress Incr YES WB 0.46 Horz(CT) 0,01 9 n/a n/a BCDL _ 10;0' ' Code IBC2015/TP12014 Matrix-S Weight 87 Ib FT=20% — —_— _ IMBER- BRACING. )P CHORD 2x4 SPF No.2 TOP CHORD Structural wood sheathing directly applied or 5-11-12 oc purlins, DOT CHORD 2x4 SPF Not except end verticals,and 2-0-0 oc purlins(6-0-0 max):4-5,7-8. WEBS 2x3 SPF No,2 BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing. WEDGE WEBS 1 Row at midpt 7-9 Left'2x6 SPF Not REACTIONS. (Ib/size) 9=823/Mechanical,2=939/0-5-8 Max Horz 2=263(LC 13) Max Uplift 9=-113(LC 11),2=-61(LC 14) FORCES. (lb)-Max Comp./Max,Ten.-All forces 250(lb)or less except when shown. TOP CHORD 2-3=-949/126,3-4=-746/158,4-5=-451/148,5-6=-433/179,6-7=508/174,8-9=-290/69 BOTCHORD 2-12=-326/564,11-12=-197/424,10-11=-196/425,9-10=-166/360 WEBS 5-10=428/151,6-10=-171/494,7-9=-692/182 NOTES- 1)Unbalanced roof live loads have been considered for this design, 2)Wind-ASCE 7-10,Vult=130mph(3-second gust)Vasd=103mph;TCDL=6,Opsf,BCDL=6,0psf;h=25ft;B=45ft;L=24ft;eave=4ft,Cat. ll;Exp B,enclosed;MWFRS(dlrectiorial)and C-C Exterlor(2)-0-10-8 to 2-1-8,Interlor(1)2-1-8 to 6-2-11,Exterior(2)6-2-11 to 10-2-13,Interior(l)10-2-13 to 14-4-8 zone,cantilever left and right exposed;end vertical left and right exposed,C-C for members and forces&MWFRS for reactions shown,Lumber DOL=1.60 plate grip DOL=1.60 3)TCLL•ASCE 7-10;Pr=30.0 psf(roof live load,Lumber DOL=1.15 Plate DOL=1.15);Pg=50.0 psf(ground snow);Pf=38 5 psf(flat roof snow:Lumber DOL=1.15 Plate DOL=1.15);Category ll;Exp B,Partially Exp;Ct=1.1,Lu=50-0-0 4)This truss has been designed for greater of min roof live load of 12,0 psf or 1.00 times flat roof load of 38 5 psf on overhangs non-concurrent with other live loads, 5)Provide adequate drainage to prevent water ponding 6)This truss has been designed for a 1Q.0 psf bottom chord live load nonconcurrent with any other live loads, 7).This truss has been designed for a live load of 20,Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide 4 sO will fit between the bottom chord and any other members: 6)Refer to girder(s)for truss to truss connections. 9)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift at Joint(s)except Gt=ib) 9=113 i 10)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT at 1t(s)2.This connection Is for uplift only and does not consider lateral forces; - 11)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along' the Top Chord and Bottom Chord,nonconcurrent with any other live loads, QQ 004 �Cr 12)Graphical purlin representation does not depict the size or the orientation of the purlin along the top and/or bottom chard, ,July 26,2019 ®WARNING-Verily design parameters and REAO NOTES ON THIS AND INCLUDED MtTEK REFERENCE PAGE A111.7473 rev.1010312015 BEFORE USE t qij ,•hold tar use arity,vnsh jrtnok4omir:= n7s dc�JOn k used a ly upoa pmn,nblum a of n,and W reran Inha18un1 bru7Cfng cpmpocopl,nqD T p 1rUtl Nam Ord usejljo baiitlaig daiagner rpdat vonfy,thn app lty AityafGppigr,pnmmpterrt and`prcipnf�j+lnaarppealc+Ihluda`ettio lotsma,nvmnlV. bultd�nj7derJ9n.9mr.InglfMlcatrflEsta"nroydrttbOLklllpatNtdlvldtdtlfrussWabauullprchtirdmdmbirnionly_Adtllgaaafta/npnia}r`bnd,psrmGh4'aFtiacfro3+, Ic olwvye'foquiro0lorabddhty arta to pre4onl cdlopse 71fi p¢as h1n"r a�onpl iojurypnd prapprty drialpga For9onamt pi ldanrc rrgprdutp IIIc tnbflcliq 'plora0e,deflun"ry,macfF�n and txaui?1ppnf,tius<a pod trues ayal�rira,seu artSfffP11 tivallty erltoda DSe ee and I3CBt6ulldin�Component 16023 Swingley Ridge Rd Sdaty lnrormagri`available kdm Truss P1atA Ir�hiura:2713 N.L'oo Slfael;SOftn 312.Atnxpadr „VA 22311,` Chesterfield,MO 63017 Jptj' TrussrUssType---- - - Qty Ply BUILDING—DROOF VINEYARD VIEW 137938935 3597GR3 Ti4 Roof Special 1 1 Joh'Iteferenco a (�tidnal)_ liniUC-6512 Component Corp.,` EAST,14AVEN' 06512 8.010 s Aug 11,2017 Mt'T,ek Industries,Inc. Thu Jul 25 23:1559 2019 Page'1 '_ IU:uN3tGfllAt�t9_YJOEtifgavHVtVyuWBg-8�N f141'79w(1BhxccLb87AKwdii?OySUNIhXmVPt3yuN5 QQ-i0^ 110.11' 7-3-7 °-7-iG AO-1G-5 W-5-12 -t - f3-10 4-10.11 2,4-12 2-4-3,, '1-2-11 3-7-7 --r Scale 1h 04 5 f 16 6x6 = 4x4 II ' w 5x6 = 15 5xfi = J3 rA4 - 0 = i' 12 00 12 0 ~ 13 d 12 2 _— 19 11 20 10 21 9 22 8 4x8 II 1x4 II 4x4 = 3x8 = 4x4 = si:itl•11 i�7.37 t 10.10.5 14-5-12 i tEL� 4-10-11 Y 2 4=17 -3-6-14 3 7-7 >. - Plate OIlse s(X,Y) '[2 Edgy 4=0 7 j3:Q•3-9.0.2-81,(ti 6 t-12.Edne].REd go.0=2-81 LOADING (psf) SPACING- 2-0-0 CSI, DEFL. in (loc) I/deft Ud PLATES GRIP TCLL(roof) 30.0 Plate Grip DOL 1.15 TC 0,44 Vert(LL) -0,07 2-11 >999 240 MT20 197/144 Snow(Pf/Pg) 38.5/50 0 Lumber DOL 1.15 BC 0.42 Vert(CT) -009 2-11 >999 180 TCDL 10,0 Rep Stress Incr YES WB 0.89 Horz(CT) 0,01 B n/a n/a SCLL 0.0 ' Code IBC2015ITP12014 Matrix-S j Weight 78 Ib FT=20% BGDL _- 10.0._ - I UMBER- BRACING- TOP CHORD 2x4 SPF No.2 TOP CHORD Structural wood sheathing directly applied or 5-2-10 oc purlins, BOT CHORD 2x4 SPF No.2 except end verticals,and 2-0-0 or purlins(6-0-0 max.),3-4,6-7, WEBS 2x3 SPF No.2 BOT CHORD Rigid ceiling directly applied or 10-0-0 ocbracing. WEDGE Left:2x6 SPF No.2 REACTIONS. (Ib/size) 8=823/Mechanical,2=939/0-5-B Max Horz 2=256(LC 13) Max Uplift 8=-89(LC 11),2=-62(LC 14) FORCES. (lb)-Max.CompJMax.Ten,-All forces 250(lb)or less except when shown. TOP CHORD 2-3=953/121,3-4=-5621145,4-5=-4611165,5-13=-548/213,7-8=-284162 BOT CHORD 2-11=-258/525,10-11=-258!523,9-10=2161563,8-9=-148/353 WEBS 3-11=0/333,4-9=-499/125,5-9=-2061469,6-8=-717/169 NOTES- 1)Unbalanced roof live loads have been considered for this design 2)Wind,ASCE 7-10;Vult=130mph(3-second gust)Vasd=103mph;TCDL=6.Opsf;BCDL=6,Opsf,h=25ft;B=45ft;L=24ft,eave=4ft,Cat. II;Exp B,enclosed;MWFRS(directional)and C-C Exterior(2)-0-10-8 to 2-1-8,Interior(1)2-1-8 to 4-10-11,Extenor(2)4-10-11 to 10-10-5,Intenor(1)10-10-5 to 14-4-8 zone;cantilever left and right exposed;end vertical left and right exposed;C-C for members and forces&MWFRS for reactions shown;Lumber DOL=1.60 plate grip DOL=1.60 3)TCLL:ASCE 7-10;Pr=30.0 psf(roof live load-Lumber DOL=1.15 Plate DOL=1 A 5);Pg=50.0 psf(ground snow),Pf=38,5 psf(flat roof snow:Lumber DOL=1.15 Plate DOL=1 15),Category 11,Exp B;Partially Exp;Ct=1.1,Lu=50-0-0 4)This truss has been designed for greater of min roof live load of 12.0 psf or 1.00 times flat roof load of 38.5 psf on overhangs OF NENI non-concurrent with other live loads. V 5)Provide adequate drainage to prevent water ponding ��.`�4�w �Oy -0 6)This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads. 7)"This truss has been designed for a live load of 20 Opsf on the bottom chord in all areas where a rectangle 3-6-0 tali by 2-0-0 wide �- will fit between the bottom chord and any other members. 8)Refer to girders)for truss to truss connections, 9)Provide mechanical connection(by(others)of truss to bearing plate capable of withstanding 100 Ib uplift at joint(s)8. r , 6: 10)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT at jt(s)2.This connection is for uplift only l� i and does not consider lateral forces. 4: r; � r 11)This truss has been designed for a moving concentrated load of 250.0lb live located at all mid panels and at all panel points along "� the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 12)Graphical purlin representation does not depict the size or the orientation of the purlin along the top and/or bottom chord. �i4 p•4994521 S50, July 26,2019 ®WARNING-Vertry design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE 11411.7473 rev.10/03/2013 BEFORE USE, ®� 1 t_ 4�_.•....r,.......... . (°r E.R Igep.piLel j;tjltnLtw rntn�rwtnt Tint t C,a10n wild for tt$O only rilii:A tEA in6 n5. ,�z'v��v t' nr�p ,I^ 0: I a ujtr ti a/s!lm;Ba(Dra uea;Ina bUldlrig ttos gpnlmual v+uriy fho app9lcafillfy ut t atgn,M!mm�tOra and propntiy lncorpNutn Una tla+lgn lnl0nis 4Yerall ��$��, built��IInp desCgn,8rnct fg hic!(rn1aA14'ipprrn'r it dticl NtO of tnrHuldunl utrtswebn+tillpr cNcrd mntnbaraonly,l llDnaf taMparaly Gild purntincnl,bra.ing j ko olvJayo roquitod for c{Ubrlily tirid in protenfsalla!>a6 Wdb po65r11tp pt:r6nnf rnjgy and properly daanggb,Fo�rtlonaml,guidance rognrding lh4 fnitrit:ogun,bittmge.detiwrryy otocllan nml hrcing df trusses and Ir4a;:yalems,eee. ANSRPf1 QW11y Crltorra•4S9-tih and BC"si Bullding Component i 16023 Swingley Ridge Rd Safely In roimntlon avaifnh-a Rain Ttvsa Plata Inalituut.ZION.Loa Simal,Sudo 312,1A1oxPmealn.VA 22314. - 1 Chesterfield,MO03017 Job -- Tru as_ - - Truss Type Qty Ply BUILDING D ROOF VINEYARD VIEW 137938936 35970R3 T17 Roof Special 1 1 Jeb Reference qlti0tiai . Universal Component Corp:,-- "" EAS f,fiAVEN.CT 06512, - 8.010 s Aug 112017 MITek lndustrl�s,Ina,Thu J6125 23 16:00 2019 Page 1 ID.uH81G9tAM9 WQEtKnavHVNyuWBg-clrNEFYmQDc214BOYIfMiYTpFPLIBzygmPEzPWyuNRz -i0• 24, _1l t 5.11-7 a=10-3. ) 2.1146 4x4 Scale,1X'=1• 6 II 2x4 ' - - 5x6 =,. L 16 F _ 17 I 5x6 I 5x6 = 15 12.00 12 13 19 11 20 10 21 9 22 3x8 11 8 1x4 II 4x4 = 3x8 = 4x4=_ 1 3 611 .5.11-7 i't•5�13' M 5.12 5.6,.6 - ----- - Plate Offsets(X•Y)-_ 12:Edge.O.O 71. - LOADING (psf) SPACING- 2-0-0 CSI. DEFL, in (loc) I/deft Ud PLATES GRIP TCLL(roof) 30.0 Plate Grip DOL 1.15 TC 0.33 Vert(LL) -009 9-10 >999 240 MT20 197/144 Snow(Pf/Pg) 38 5150 0 Lumber DOL 1,.15 BC 0.48 Vert(CT) -012 9-10 >999 180 TCDL 10.0 Rep Stress Iner YES WB 0.74 Horz(CT) 0,01 6 n1a n/a BCLL OA ' BCDL 10,0 Code IBC2015(rP12014 Matrix-S Weight 75 Ib FT=20% - MBER -- - _ BRACING- - P CHORD 2x4 SPF No,2 TOP CHORD Structural wood sheathing directly applied or 5-9-4 oc purlins, __T CHORD 2x4 SPF No,2 except end verticals,and 2-0-0 oc purlins(6-0-0 max) 3-4,6-7• WEBS 2x3 SPF No.2 BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing WEDGE Left 2x6 SPF No 2 REACTIONS. (Ib/size) 8=823/Mechanical,2=93910-5-8 Max Horz 2=248(LC 13) Max Uplift 8=-64(LC 11),2=-64(LC 14) FORCES. (ib)-Max CompJMax.Ten,-All forces 250(lb)or less except when shown. TOP CHORD 2-3=-974/120,3-4=741/142,4-5=-516/147,5-6=-541/209.7-8=279/54 BOT CHORD 2-11=-2631559,10-11=-263/558,9-10=-234/747,8-9=-127/342 WEBS 3-11=-30/291,3-10=-28/365,41-9=-6831134,5-9=-1691378,6-8=-7461151 NOTES- 1)Unbalanced roof live loads have been considered for this design. 2)Wind.ASCE 7-10;Vult=130mph(3-second gust)Vasd=103mph,TCDL=6.Dpsf;BCDL=6 Opsf,h=25ft;B=45ft,L=24ft;eave=41t;Cat. II,Exp B;enclosed;MWFRS(directional)and C-C Exterior(2)-0-10-8 to 2-1-8,Interior(1)2-1-8 to 3-6-11,Exterior(2)3-6-11 to 11-5-13,Interior(1)11-5-13 to 14-4-8 zone;cantileverleft and right exposed;end vertical left and right exposed;C-C for members and forces&MWFRS for reactions shown;Lumber DOL=1 60 plate grip DOL=1,60 3)TCLL•ASCE 7-10,Pr=30,0 psf(roof live load,Lumber DOL=1.15 Plate DOL=1 15),Pg=50.0 psf(ground snow);Pf=38 5 psf(flat roof snow.Lumber DOL=1 15 Plate DOL=1.15);Category 11;Exp B;Partially Exp„C1=1.1,Lu=50-0-0 4)This truss has been designed for greater of min roof live load of 12.0 psf or 1.00 times flat roof load of 38.5 psf on overhangs non-concurrent with other iive loads, -OF NES 5)Provide adequate drainage to prevent water ponding. �- 6)This truss has been designed for a 10,0 psf bottom chord live load nonconcurrent with any other live loads. 7)'This truss has been designed for a live load of 20 Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide �1 will fit between the bottom Chord and any other members, 8)Refer to girder(s)for truss to truss connections.. �• 2 '* 9)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 lb uplift at joint(s)8.• I 1L 10)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT atjt(s)2,Thls connection is for uplift only _ and does not consider lateral forces. 11)This truss has been designed for a moving concentrated load of250,01b live located at all mid panels and at all panel points along 2 the Top Chord and Bottom Chord,nonconcurrent with any other live loads, 12)Graphical purlin representation does not depict the size or the orientation of the purlin along the top and/or bottom chord._ 9°FFss�o�'� July 26,2019 ®WARNING-Verily design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGEMII.7473 rev,1010312015 BEFDRE USE. QallfOrl vatldfcrwn 61yw1w KOTek.+YnpmoedW.,.Thin dc4lgn Ln haled only upon permiristern shown.and In foram lntrivldual tallldng carnponatt,twl! Im n 4uss t+yatam.Bnfnrc upe;tnu quildmg,dOpigppr most vnnfy+f)n 7pyi1l W6flgY,nt clothjn Prof urr.andproi ady lnmrimp!o lhlp duslgn tpto lfto'ovnralf tntgdln0 daafgn.0racf+tg Il+d'cotad ts'to prnvant IsupW ng o!lndev�Juat Wma+ra4°nnd/ot elleed mumbam only:7�digoae>tamppiary,m+d�armannnt hme9ng. 10iTe w I�!tlimyurnuulraafaT,aWbll+lynnd,toPt�'onl,collpppQ+v,li�pgfniblA,prtrso�ntjn�•nndpragcrfydtima�n.Fprpensral�tMililnnr�eagaid,r,glle6, Ynutknllra,slDrnga,6eliYettyy 1 fkltllln find t191f1![g Gt l(n5 a^a 011d VU63 5)alefir 0,300 ANHIII p{i Quall[y Cd!ana,,t>4[S•89nnd OCSI OuUdingComponent 16023 Swingley Ridge Rd safdtyhtformntion avulinbiR lrpoi Tn t s P oto lnnt$utq,216 N,Lei Straot SaOo 31:,Air ind_dn;VA643i4, Cheslerlield,NO 63017 Job — cuss-- -_ ----- -Truss Type. - — - Qty Ph' BUILDING D ROOF VINEYARD VIEW 137938937 35970R3 i18 Roof Special 1 1 _ II dab Reference(ontionall Universal Component Corp., EAST HAVEN,GT 05512 — - `- 8,4,ibsAug 11-2017,1AiTgk lnduWiWr-.Inc, Thu Jul 25 23.16:02 2019 Page 1 ID.uH81G9IAM9_WQEtKnavHVNyuWBg-Z7y7fxaoyrsmYOLPfihgozY76C1 Ufuc7Ey4TOyuNRx 108 2-211 4:2-7 9.7-10 t2-!-$ __ 14-5-12- ,(•148 2.2-1d 2�i-12 - 5-0-3 i 2-5-11 I 2-4-7 1 44= Scale 1 5 17 5x6= 4x4 7 16 15 3 18 ti 6x6 = I 5x6 3 / o 12.00 12 14 13 22 19 12 20 11 21 10 9 23 8 3x6 II 2x4 II 1x4 II 4x4 = 3x8 = 4x4 = ( 2 2.11 4.7:7 sa-14, 12-1 5 14.51�2�� x•2`11 2-4-12 'Plate'Offsets(X,Y)- 2:EdQ LOADING (psf) SPACING- 2-0-0 CSI. DEFL. in (loc) I/dell Ud PLATES GRIP TCLL(roof) 30.0 Plate Grip DOL 1.15 TC 0.50 Vert(LL) -008 10-11 >999 240 MT20 197/144 Snow(PHPg) 38.5/50 0 Lumber DOL 1.15 BC 0,48 Vert(CT) -011 10-11 >999 180 TCDL 10.0 Rep Stress Incr YES WB 0.60 Horz(CT) 0.01 8 n/a n/a BCLL 0.0 Code IBC2015/TPI2014 Maffix-S Weight,73 Ib FT=20% BCDL 1[1,L1 - LUMBER- BRACING- TOP CHORD 2x4 SPF Not TOP CHORD Structural wood sheathing directly applied or 5-9-0 oc purlins, BOT CHORD 2x4 SPF No.2 except end verticals,and 2-0-0 oc purlins(5-8-1 max) 3-4,6-7, WEBS 2x3 SPF No.2 BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing. WEDGE Left-2x6 SPF No,2 REACTIONS. (Ib/size) 8=823/Mechanical,2=93910-5-6 Max Horz 2=240(LC 13) Max Uplift 8=-39(LC 11),2=-65(LC 14) FORCES. (lb)-Max,Comp./Max.Ten.-All forces 250(lb)or less except when shown. TOP CHORD 2-3=-9731114,3-4=-1018/159,4-5=-686/145,5-6=-553/164,6-7=-2971112, 7-8=-7921138 BOT CHORD 2-12=-2511666.11-12=-2511564.10-11=-25211035,9-10=-1061309 WEBS 3-12=-57/266.3-11=-811687,4-11=426/116.4-10=-752/175,5-10=-1051375, 6-9=657/159,7-9=-127/736 NOTES- 1)Unbalanced roof live loads have been considered for this design. 2)Wind,ASCE 7-10,Vult=130mph(3-second gust)Vasd=103mph;TCDL=6.Opsf,BCDL=6 Opsf;h=25ft,B=45ft;L=24h;eave=oft;Cat. Il;Exp B;enclosed,MWFRS(directional)and C-C Exterior(2)-0-10-8 to 4-7-7,Interior(1)4-7-7 to 9-7-10,Exterior(2)9-7-10 to 12-1-5 zone;cantilever left and right exposed,end vertical left and light exposed;C-C for members and forces&MWFRS for reactions shown;Lumber DOL=1.60 plate grip DOL=1.60 3)TCLL:ASCE 7-10;Pr=30.0 psf(roof live load.Lumber DOL=1.15 Plate DOL=1:15);Pg=50.0 psf(ground snow);Pf=38,5 psf(flat roof snow:Lumber DOL=1 15 Plate DOL=1 15);Category 11,Exp B:Partially Exp;Ct=1.1,Lu=50-0-0 or E)W 4)This Miss has heen designed for greater of min roof live load of 12,0 psf or 1.00 times flat roof load of 38.5 psf on overhangs .` � J� .0 non-concurrent with other live loads tS' 5)Provide adequate drainage to prevent water ponding. 6)This truss has been designed for a 10,0 psf bottom chord live load nonconcurrent with any other live loads. * Q. 7).This truss has been designed for a live load of 20.Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide will fit between the bottom chord and any other members. v 8)Refer to girder(s)for truss to truss connectlons- ,i '" W 9)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift at Joint(s)8. 10)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT at Jt(s)2.This connection is for uplift only and does not consider lateral forces. 11)This truss has been designed for a moving concentrated load of 250 Olb live located at all mid panels and at all panel points along �QA 0-099455 ' the Top Chord and Bottom Chord,nonconcurrent with any other live loads, , 12)Graphical purlin representation does not depict the size or the orientation of the purlin along the top and/or bottom chord. �S$1 July 26, 19 ®WARNING-Verify design Paramefers and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE MII-7473 rev,10/03/2015 BEFORE USE. t WIN, I Design valid for use opry with M,Tek@ connectors,This design is based only upon parameters shown,and Is for an Individual budding component,not a truss system Before tmo.the building dricipgarmust verify the applicability of design parambler,and properly incorporate this design into the overall 1 y��'�� building design,Bracing hidbated is to prevanl hucktiy�� ng of individual truss web and/or chord membets only.Additional temporary and permanent bracing I IUliiTell is always required for stability and to prevent collapse with possible personal injury and property damage.For general guidance regarding the 16023 Swmgle y Ridge fabricatlon,storage,deli3ply erection and bracing of trusses and truss systems,see ANSIITPII Quality criteria,DSB•89 and SCSI Building Component a Rd Safely Informallon ovair l Te from Truss Plate Institute,218 N Lee Street,Suite 312,Alexandria,VA 22314. Chesterfield,MO 63017 Joh cuss T"ITYRO OCYEPty — BUILDING7D�-ROOF_VINEYARD VIEW 137936938 35970113T19 RptitSoccip,%det, 1 1 JobBeference,(ontional) Universal Component Corp., WT'HAVEN1.GT 06512 Thu du12523:16:0321)19 Pagol 7 TIA��234-—2 -4 WW-2 3— 1-6-15 0-10.11 4x4 = Scale 1,54,5 19 4X4 3X6 5x6 8 46 17 14.3 FIT 5X6 C6 3jq 7T 2 21 22 23 24 25 14 13 12 11 10 9 4x6 = M = 4x4 = 3X8 = 4X4 =2x4 II 2x4 II NAILED NAILED IPIAT '��173, ' _6-5_ „_8. _ 9.7-10 12;8431 1146-12 3. 3 2-2 -3-2-12 3-1. -a-16 LOADING (psf) TCLL(roof) 30.0 i SPACING- 2-0-0 CSI., DEFL. in (loc) 11clefi Ud PLATES GRIP Plate Gnp DOL t.15 TC 0.31 Vert(LL) -0.06 12-13 >999 240 MT20 197/144 Snow(PF/Pg) 38 5150.0 Lumber DOL 1.15 BC 0,54 Vert(CT) -0.09 12-13 >999 180 TCDL 10.0 Rep Stress Incr NO WB OA2 Horz(CT) 0,01 9 n1a n1a BCLL OD Code IBC20151rPI2014 Matrix-S We;ght*82 lb FT 20% BCDL_ '10.0 JMBER- BRACING- )PCHORD 2x4 SPF No 2 TOP CHORD Structural wood sheathing directly applied or 5-5-12 cc purlins, _JT CHORD 2x6 SPF Not except end verticals,and 2-0-0 cc purlins(44-13 max.) 3-4,7-8 WEBS 2x3 SPF Not BOT CHORD Rigid ceiling directly applied or 10-0-0 cc bracing. REACTIONS. (lb/size) 9=631/Mechanical,2=965/0-6-8 Max Herz 2=231(LC 9) Max Uplift 9=-41(LC 10),2=-91(LC 10) FORCES. (lb)-Max.Comp IMax Ten.-All f6i8es 250(lb)or less except when shown TOP CHORD 2-3=-1056134,3-4=-170i47-.`&ti=-1 074/78,5-6=-628/124,6-7=-6131118,7-8=-253/63, 8-9=-766/57 BOT CHORD 2-14=-1471614,13-14=-1511597,12-13=86/1649,11-12=-78/708,10-11=-32/269 WEBS 4-13=-630/71,6-11=-101/426,7-10=-719159,8-10=-411735,3-14=0/326,3-13=-7211237, 5-11=585/116,5-12=01504,4-12=-994/91 NOTES- 1)Unbalanced roof live loads have been considered for this design. 2)Wind,ASCE 7-10;Vult=130mph(3-second gust)Vasd=103mph;TCDL=6.Opsf,BCDL=6.Cpsf,h=25ft;B=45ft;L=24ft;eave=4ft;Cat. 11;Exp B;enclosed;MWFRS(directional);cantilever left and right exposed;end vertical left and right exposed;Lumber DOL=1.60 plate gnp DOL=1.60 3)TCLL.ASCE 7-10;Pr--30,0 psf(roof live load,Lumber DOL=1-15 Plate DOL=1.1 5);Pg=50.0 psf(ground snow);Pf=38.5 psf(flat roof snow:Lumber DOL=1.1 6 Plate DOL=1 15);Category 11;Exp B:Partially Exp,Ct=1 1,Lu=50-0-0 4)This truss has been designed for greater of min roof live load of 12.0 psf or 1,00 times flat roof load of 38 5 psf on overhangs non-concurrent with other live loads. 5)Provide adequate drainage to prevent water pending. 6)This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads. 7)*This truss has been designed for a live load of 20 Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide wall fit between the bottom chord and any other members 8)Refer to girder(s)for truss to truss connections. 9)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 lb uplift atjoint(s)9. 10)One RT4 LISP connectors recommended to connect truss to bearing walls due to UPLIFT at jt(s)2.This connection is for uplift only and does not consider lateral forces. 11)This truss has been designed for a moving concentrated load of 250.Olb live located at all mid panels and at all panel poihts along Di the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 12)Graphical purlin representation does not depict the size or the orientation of the purlin along the top and/or bottom chord, 13)"NAILED"indicates 3-1 Od(0.146"x3')or 2-12d(0 148"x3.25")toe-nails For more details refer to MITek's ST-TOENAIL Detail. rip 0994 -4) In the LOAD CASE(S)section,loads applied to the face of the truss are noted as front(F)or back(13) SS1 6AD CASE(S) Standard - July 26,2019 A WARNING-Verify design parameters and READ Nord ON THIS AND INCLUDED MITEK REFERENCE PAGEM117473 rev.1010312015 BEFORE USE nl,, un. campervotd, MiTek" is CunElly PrIm �Ijdfnq 16023 Swinglay Ridge Rd d. Pie 'T fntgdiitg 1",_1 I've oil Chesterfield,NO 63017 'd to O I., P-__11 b d f-I trot:11- . 1. 10 -S 1—T Job toss Truss Type aty Ply BUILDING D ROOF NINEY�RD VIEW i 137938938 35970R3 ;T19 Rbtal,3p?eisllGlydBr 1 1 _ JabRttitlhrta nu8ottal!'_ niysulsal Component Corp„ EAST-HAVE 0$512' 8.010 s Aug 112017WTek lndusultas,Inc.Thu Jul 25 23:16:04 2019 Pege 2 ID'uHBIG9iAM9_WQE(KnavHVNyuWBg-V W4t4drGTS6U niVnn7kltOdWZOhl7rpQh1 CAYHyuNRv LOAD CASE(S) Standard 1)Dead+Snow(balanced).Lumber Increase=1 15,Plate Increase=l 15 Uniform Loads(plf) Vert 1-3=-97,3-4=-97,4,6=-97.6-7=-97,7-8=-97,2-9=-20 Concentrated Loads(lb) Vert.'13M-33(F) WARNING-Verily design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE M11.7473 rev 1010312095 BEFORE USE, =rlupipn vofid for usv or4y rOth- 11ifp dgclan is basad only uppn pnmmurs clshm;n;uvl lii'liri an Indlv3uld Iarlldbi9=111,011"li nut u bu s dyatunf:Hnfn a uua.U:q build�fl dosignur ntu5iwalify vi upplldptdUly of dunfgn pprametera and piopnrty 1rtblpariild M13 dIM01IMP 1110 overall IU1sTG—SIC t>Uil�llrr0,0✓ist�n,tjraeing lndtratndl.to proennt hvcMlnp'nl fndivi>iapl MrspwMandler�0rd mnrnbecr.mrly,ftctdltlonril utnlN, Ynnd patrmrinnib»clis(I is idwaycurptpnvSluPatufrSpyailtl,to aronlrutwpau�ylurp riUtlapw�wlatIn,rydo}propenA slrrpll uapyCrItrlo' s r03ardU13681 ,YnNr:cnrtvn,a.orcg0.dud:3ary,BmtllOflarldUreC[rig4TAy?tagS7t1*�UIKSeyrJl9mt,aea gfdSllFPhQunll(yCdiorlo,A39.69at1d6C31BtdltliitgCvmponent 16023SpnngleyRrdgeRd Sntoty into, nvaPd u:a front Tares PletO Annu:e,210 N:Lcc SuneL aallo 317,p nxandda VA?2314:^ _ Chesterpeld,MO 63017 Job russ "TruSs Typa< -pry ply BUILDING D-ROOF-VINEYARD VIEW I 137938939 35970R3 20 Rorif Special 1 1 ; Job Reference(optional) ,Univ0sal Cornponent Cbrp., -EAST HAVEN`CT 06512 -`" -- LL 8.010 s Aug 112017 M Tek Ihdustdes;Inc. Thu Jul 2523:16:05 2019 Pagel 'i0.4H$IG8iAh99_WQDMkn9vH,V J uWBg-aieGI47cuEmELPs4_LrFXPbAg4Q7RsLzawhyk4lyuNRu -6-10, 3-7-11 ?-2-t•i - 10.1 V9 a-1.0 - 3-7-11 - 3.7•-,3 3-8-11 4x4 — Scale=1:49.8 4 12,/ 1 13 12,00 12 \ / 4x4 = 1x4 \ 11 f 14 6x6 = 3 6.111 10 2 r;a ---ifi -.._-- - ------17 - 18 - 3x8 11 9 8 7 3xB = 2x4 II 4x4 , l - _ 'Z•2�14 -- 10-t1.9 1?-1•t} 7•?.•ht -3.&11 - 17.7 "PleteOffsetsX1——,j2-,Lde00.71 -- - --_ - -- - LOA ( SI NG (psf) TCLL SPACING- 2-0-0 C . DEFL. in (loc) i/deft Ud PLATES GRIP TCLL(roof) 30,0 Plate Grip DOL 1.15 TC 0,33 Vert(LL) -021 2-9 >665 240 NIT20 197!144 Snow(Pf/Pg) 38 5150.0 Lumber DOL 1.15 BC 0.66 Vert(CT) -028 2-9 >504 1 BO TCLL 10.0 Rep Stress Incr YES WB 0.24 Horz(CT) 0.01 7 n/a n/a BOLL 0 A 13CDL- ,10-0 Code ISC2015ITPI2014 Matrix-S Weight-58 Ib FT=20% _ - MBER- BRACING- P CHORD 2x4 SPF No,2 TOP CHORD Structural wood sheathing directly applied or 6-0-0 cc purlins, __T CHORD 2x4 SPF No.2 except end verticals,and 2-0-0 cc purlins(6-0-0 max;):5-6. WEBS 2x3 SPF No.2 BOT CHORD Rigid ceiling directly applied or 10-0-0 cc bracing WEDGE Left 2x6 SPF No.2 REACTIONS. (Ib/size) 7=682/Mechanical,2=800/0-5-8 Max Horz 2=224(LC 13) Max Uplift 7=-30(LC 14),2=-62(LC 14) FORCES. (lb)-Max-.CompJMax-.Ten,-All forces 250(lb)or less except when shown. TOP CHORD 2-3=756/115,3-4=-524/154,4-5=-514/133,6-7=-615/65 BOT CHORD 2-9=-187/448 WEBS 4-9=-97/315,5-8=-643/163,6.8=-1 1 5161 4 NOTES- 1)Unbalanced roof live loads have been considered for this design. 2)Wind:ASCE 7-10,Vult=130mph(3-second gust)Vasd=103mph,TCDL=6.Opsf,BCDL=6,Opsf,h=25ft,B=45ft;L=24ft,eave=oft;Cat_ II,Exp B:enclosed;MWFRS(directional)and C-C Exterior(2)-0-10-8 to 2-1-8,Interior(1)2-1-8 to 7-2A4,Exterior(2)7-2-14 to 10-2-14,Interior(1)10-11-9 to 11-11-12 zone;cantilever left and right exposed;end vertical left and right exposed,C-C for members and forces&MWFRS for reactions shown;Lumber DOL=1,60 plate grip DOL=1.60 3)TCLL ASCE 7-10;Pr=30.0 psf(roof live load'Lumber DOL=1.15 Plate DOL=1:15);Pg=50.0 psf(ground snow);Pf=38.5 psf(flat roof snow:Lumber DOL=1 15 Plate DOL=1.15);Category ll;Exp B,Partially Exp.,Ct=1.1,Lu=50-0-0 4)This truss has been designed for greater of min roof live load of 12,0 psf or 1 00 times flat roof load of 38 5 psf on overhangs non-concurrent with other live loads. 5)Provide adequate drainage to prevent water ponding- NE 1i 6)This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads. 7)*This truss has been designed for a live load of 20,Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide will fit between the bottom chord and any other members. C, B)Refer to girder(s)for truss to truss connections. Q ' 9)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift at joint(s)7. 10)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT at jt(s)2.This connection is for uplift only !L! and does not consider lateral forces. 11)This truss has been designed for a moving concentrated load of 250.O1b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads, 12)Graphical purlin representation does not depict the size or the orientation of the puriin along the top and/or bottom chord, July 26,2019 A WARNING-Verify design parameters and READ NOTES ON THIS AND INCLUDED MITER REFERENCEPAGE M11-7473 rev.1010312015 BEFORE USE �y j DezlgnviZ fei u:,a only'vdili K0 fa60edhnndarV[lilt desipp is boned Wvupm paramdtpra shown,and is to:an U)&Mdunl hung component,nor -nhss,pyAtaal Befara urs,Ulo,b l(ding dn�ipluarmapF reply tho t ppltenbifdy of dhalOn paramo(nroand prdpa tyinrorposlteUrlu design thin Ihir war d!- { nllldid0;dasfgn.8ra8n(ildd�nfadistot;rcvelithtiskl0hgotlnlrvldualu'usstVo�4ndror'cHovdrnuiutxira`ahty':1diYilfenntidmpckdry,mnd'tntrmannriaLrncing (r�� le ulwayIIrroRaiida lOrstatiligyorid tit,prdvmit,eodnpsawide passfbid p,-[saga!injury and pfgp0ay damage.Fef�anergl gu�dhnro re?arding Ilia `" ,fnFi{a 1100.artsr3gu_delhoary,uiacllon:.ndbrgedytU.liussdSandlruCWsy7'dAtfSl/rPtiQuallryCritorfR;DSO.89and BC9iBuildingComponent 16023SwingleyRidge Rd 'Safaty'fitformation'avallabta homTnrss Pial'cins0liilo,9.to N.Lao Sirear,Suita312.Alaxendpa,Vh223t4; ''• - Chesterfield,MO 63017 Job Truss russ Type qty Ply BUILDING D ROOF VINEYARD VIEW 137938940 35970R3 21 Common 4 1 _ Job Reference(optional UnfWlrsa)Component Corp., EAST MAVEN CT 06512" - 8 010's Aug,11 2017 MTek Industries:Inc._,Thu'4125 23'1' Pxgu.1 1D:uHHiG9iAtVlB_iN4EiKrravHVNyuWBg Rl t±eU ldtN43tvICtl?eAVYrimyp(p7gLRtipUj8L vf&YUNR,t 10.8 3.7.11 7-2-14 1 i2-t•D i t}90 tT P.-7-11 3.7-3 4 iQ-2 Scale=1 4x4 4 11 10 1 12 12.00 12 9 // 1x4 �� //// ti 13 3 5 1 14 -7 - 15 6 3x6 I I 3x6 2x4 11 = 7-214 12'1'0 7-2.14 4-10.2 ?late oifaets(XtY� 12:F 0-,0.7 15:t 2.8.Edg LOADING (psf) SPACING- 2-0-0 CSI. DEFL. in (loc) Ildefl Ud PLATES GRIP TCLL(roof) 30.0 Plate Grip DOL 1.15 TC 0.48 Vert(LL) -0,22 2-7 >627 240 MT20 197/144 Snow(Pf/Pg) 38.5/50.0 Lumber DOL 1 15 BC 0.67 Vert(CT) -0.29 2-7 >484 180 TCDL 10.0 Rep Stress Incr YES WB 0.16 Horz(CT) 101 6 rile n/a BCLL 0.0 Code IBC2015/rP12014 Matrix-S Weight:52 Ib FT=20% _BCDL _-- 10.0.m - LUMBER- BRACING- TOP CHORD 2x4 SPF No.2 TOP CHORD Structural wood sheathing directly applied or 6-0-0 oc purlins, BOT CHORD 2x4 SPF No,2 except end verticals WEBS 2x3 SPF No.2 BOT CHORD Rigid ceding directly applied or 6-0-0 cc bracing. VVEDGE Left-2x6 SPF No.2 RI EACTIONS. (1b/size) 2=800/0-5-8,6=682/Mechanical Max Horz 2=213(LC 13) Max Uplift 2=-63(LC 14),6=-28(LC 14) FORCES. (lb)-Max,Camp,/Max.Ten,-All forces 250(lb)or less except when shown. TOP CHORD 2-3=753/112,3-4=-522/151,4-5=-5501112,5-6=-648110B BOT CHORD 2-7=-135/447 WEBS 4-7=61/304,5-7=-7/305 i 140TES- it)Unbalanced roof live loads have been considered for this design ')I�Exp BS enclosed;MWFRS(directional)and C)C Extenor(2)-0-10-8 to 2 1-8f l Berior(1)2-1 f8 to 7-2-14,Exterior()7-2--14 toy Cat. 10-2-14 zone;cantilever left and right exposed;end vertical left and right exposed,C-C for members and forces&MWFRS for reactions shown;Lumber DOL--1 60 plate grip DOL=1.60 3)TCLL:ASCE 7-10;Pr=30.0 psf(roof live load:Lumber DOL--1.15 Plate DOL=1.15);Pg=50.0 psf(ground snow);Pf=38.5 psf(flat roof snow-Lumber DOL=1,15 Plate DOL=1.15);Category II;Exp B;Partially Exp;Ct=1.1 �4)This truss has been designed for greater of min roof live load of 12,0 psf or 1.00 times flat roof load of 38.5 psf on overhangs non-concurrent with other live loads. �� NEW, j5)This truss has been designed for a 10.0 psf bottom chord live load nnnrnncurrent with any other live loads, '6)*This truss has been designed for a live load of 20.0psf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide will fit between the bottom chord and any other members. wti Q2 7)Refer to girder(s)for truss to truss connections. 8)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift atjoint(s)6, 19)One RT4 USP connectors recommended to connect truss to beanng walls due to UPLIFT at jt(s)2.This connection is for uplift only I,r and does not consider lateral forces. UJ 110)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along m�J r the Top Chord and Bottom Chord,nonconcurrent with any other live loads. Q 699439 ` A��FESSION�y July 26, 019 CA MAN ®WARNING-Verify design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE MI1-7473 rev.1010312015 BEFORE USE (IG:Ij}A valill Iar ul,h ably Will l0ol_cdorlealnr3-Thindo3lun Is/mond ally upon puronmtem dickun,and IS for all Indlvldunt ba0dinl ea lIliwO u,it d Uas6iryalara,Hafara aaa,ills b}I{tdtnt daslgitol mustYen(y ilio pppllGllr�llly'erf d9gipa,pa:nmRlam a!?d ptopadylOGarpara}e lllfi dao(gn Lata 1nU ar rill hldldin{das1lin.srnr�np IrWirulad Il to pfirvr a1 tifict llnif at 11 dlw duel truss WUb vi!'orrlu rd rrstmrtiutn ar fy.nddldoiwl o incety an+f,parrp lnenl hrarhNt MITO(� 'tG a7 Yi7yD tet(tfUOd it'6raltllll tjaQ to p[aVaar Cp,'InlpSa Wirrl P0691U10#te[E07mt iaiury Aad pY0pn11y dniJ+arje,FOr 61Jn� go(4 faf>a{[rN+g Vla� J (aoredlan dad INpclrxp'Of ituzes anJ 111123 5jrarnm..sac ANSrr7P11 nuafity Crltotia.0SQ-89 utid BCSI aulltling'Component Y 16023 Swingtay f2idge Rd -T^ 36toty lnroimnaor, avaiinblei ffarn i russ,Rate Incl told 210 N.Lea S11cuu-Llha 312,�jVaxrndnn;VA 23314, ChesleKeld,MD 63017 i Job i runs - --= russ_Typa — -_ - Qty Ply BUILDING D ROOF VINEYARD VIEW 137938941 r 35970R3 i 22 Rpof Spccfal 1 1 ; i - � Jpb'Reigfe,ncp�rimptrpliPl�, - - r � Universal Component Corp., EAST HAVEN"C7 06512 - 8,010 s Aug 11'2617 MI1;elL tnduslrfes,Inc.Thu'Jul 25 23.16.06 2019 Page 1 tD:OH81G91AM9 WQEtKnavHVNyuWBg-RvCeUJdW73MC07eAuYmmypjuPgTZbrx}BLhHc9yuNRt I' 2-0-9 -2;0:9 1-0-10 1x+4 I I Scale=1.10,6 6.66 112 2 y r _ 3 0 U4 Ii 2x4 = 7.0.9 — -- LOADING (psf) SPACING- 2-0-0 CSI. DEFL. in (loc) I/deb L/d PLATES GRIP TCLL(roof) 30.0 Plate Grip DOL 1.15 TC 0.16 Vert(LL) -0.01 2-4 >999 240 MT20 197/144 Snow(Pf/Pg) 38.5!50.0 Lumber DOL 1.15 BC 0.15 Vert(CT) -001 2-4 >999 180 TCDL 10,0 Rep Stress Incr YES WB 0.00 Horz(CT) 0.00 2 n/a n/a BCLL 0,0 RCbL' Code IBC2015/TPI2014 Matrix-S Weight 7 Ib FT 20/o c 10,0 = LUMBER- BRACING- - - )P CHORD 2x4 SPF No.2 TOP CHORD Structural wood sheathing directly applied or 2-0-9 oc purlins, )T CHORD 2x4 SPF No,2 except end verticals:- EBS 2x3 SPF No.2 BOT CHORD Rigid ceding directly applied or 10-0-0 oc bracing. REACTIONS. (Ib/size) 4=46/Mechanical,2=278/0-6-10 Max Horz 4=-48(LC 12) Max Uplift 4=-18(LC 20),2=-64(LC 16) Max Grav 4=273(LC 32),2=320(LC 34) FORCES. (lb)-Max,Comp./Max Ten.-All forces 250(lb)or less except when shown. TOP CHORD 1-4=-256/36 NOTES- 1)Wind:ASCE 7-10;Vult=130mph(3-second gust)Vasd=103mph;TCDL=6,Opsf;BCDL=6,Opsf;h=25ft;B=45ft;L=24ft;eave=4ft;Cat, Il,Exp B;enclosed;MWFRS(directional)and C-C Exterlor(2)zone;cantilever left and right exposed;end vertical left and right exposed;C-C for members and forces&MWFRS for reactions shown;Lumber DOL=1,60 plate grip DOL=1,60 2)TCLL ASCE 7-10;Pr--30.0 psf(roof live load Lumber DOL=1:15 Plate DOL=1.15);Pg=50.0 psf(ground snow);Pf=3B.5 psf(flat roof snow.,Lumber DOL=1.15 Plate DOL=1,15);Category 11;Exp B;Partially Exp.;C1=1.1 3) Unbalanced snow loads have been considered for this design 4)This truss has been designed for greater of min roof live load of 12.0 psf or 1.00 times flat roof load of 38.5 psf on overhangs non-concurrent with other live loads= 5)This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads, 6)"This truss has been designed for a live load of 20.Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide will fit between the bottom chord and any other members 7)Refer to girder(s)for truss to truss connections. 8)Provide mechanical connection(by others)of truss to bearing plate capable ofwithstanding 100 lb uplift-at joint(s)4. of NIF 9)One'RT4 USP connectnrs rencrimmended to connect truss to bearing walls due to UPLIFT at Jt(s)2-This connection is for uplift only and does not consider lateral forces. 10)This truss has been designed for a moving concentrated load of 250.0Ib live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 0 994g' '� �aFESSi��y, July 26,2019 ®WARNING-Verily design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCEPAGE MII.7473 rev.1010312015 BEFORE USE. Design valid for use only with MiTek®connectors-This design Is based only upon parameters shown,and is for an individual building component,not �• 1 a!mss systam Baforom%tha budding,dot4gr ormusl verify the applicablkly of design pnfdmolnla andpropady incorporata this dasign Into the overall building design BraC460 indicated is to pirewil61wckling of individual truss web and/or ttliRd maiabai^eonly,Additional temporary and permanent bracing j {�f]�'�'�j�e. Is always required for stability and to prOeni collapse with possible personal injury and property damage.For general guidance regarding the ,M fabrication,storage,dallvary,erection and bracing of trusses and truss systems,see ANSIrrPl1 quality Criteria,DSB.89 and BCSI Building Component 16023 Swingley Ridge Rd Safety information available from Truss Plate Instllule,218 N Lee Street,Suite 312,Alexandria,VA 22314. chesterfield,MO 63017 — Job' Truss TrdscType Qty j P BUILDING D ROOF'VINEYARD VIEW 137938942, r hoof Special 1 3�fl70R3 T23 � Job Reference o tlonnll - U iiversal Component Corp., EAST HAV[N CT 00512}- ----T - H,010 s Aug 11 2017 MIPek,tpdUstries,Inc.Thu Jul 25 23.16.08 2019 Page 1 ID•uH61G9iAM9_WQEtKnavHVNyuWBg.NHKOv fnXhcvGJoZozoElEo8gdl93gEocfAOh2yuNRr 0.10��® 3-7.41 7=?•14 9 6-10-. 14-5.12 a.11�.q 3.7 41 4-11-2-- Sale 114 4x4 4 }f ff 6x6 : 4x4 = 12 6 12,00 12 1x4 N\ li / 14 95 3 f 10 Lb` 16 9 17 e 18 7 3x8 If 2x4 II 3x8 = 4x4 = - 7-2-14 - ( 2 x•12 '4-11-2' -71 LOADING - - - LOADING (psf) SPACING- 2-0-0 CSI DEFL. in (loc) Ildefi L/d PLATES GRIP TCLL(roof) 30.0 Plate Grip DOL 1,15 TC 0.56 Vert(LL) -020 2-9 >839 240 MT20 197/144 Snow(Pf/Pg) 38 5/50,0 Lumber DOL 1.15 BC 0.65 Vert(CT) -028 2-9 >614 180 TCDL 10,0 Rep Stress Incr YES WB 0.33 Horz(CT) 0.01 7 n/a n/a BCLL 0.0 Code IBC20151TP12014 Matnx-S Weight'68lb FT 20% BCDL __ 10-0 _ LUMBER- BRACING- TOP CHORD 2x4 SPF No.2 TOP CHORD Structural wood sheathing directly applied or 5-11-2 oc purlins, BOT CHORD 2x4 SPF No,2 except end verticals,and 2-0-0 or purlins(6-0-0 max.):5-6 WEBS 2x3 SPF No.2 BOT CHORD Rigid ceiling directly applied or 10-0-0 or bracing WEDGE Left-2x6 SPF No.2 REACTIONS. (Ib/size) 7=823/Mechanical,2=939/0-5-8 Max Horz 2=242(LC 13) Max Uplift 7=72(LC 11),2=-65(LC 14) FORCES (lb)-Max.Comp JMax.Ten.-All forces 250(lb)or less except when shown. TOP CHORD 2-3=-938/122.3-4=706/162,4-5=-6611166,5-6=5121125,6-7=-7751167 BOT CHORD 2-9=2521554,8-9=-1541521 WEBS 4-9=152/550,5-9=308/143,5-8=-5011151,6-8=-142/741 NOTES- 1)Unbalanced roof live loads have been considered for this design„ 2)Wind.ASCE 7-10,Vult=130mph(3-second gust)Vasd=103mph,TCDL=6.Opsf;BCDL=6.Opsf;h=25ft,B=45ft;L=24ft;eave=4ft,Cat. II,Exp B;enclosed;MWFRS(directional)and C-C Exterior(2)-0-10-8 to 2-1-8,Interior(1)2-1-8 to 7-2-14,Extenor(2)7-2-14 to 9-6-10 zone;cantilever left and right exposed;end vertical left and right exposed;C-C for members and forces&MWFRS for reactions shown,Lumber DOL=1,60 plate grip DOL=1.60 3)TCLL•ASCE 7-10;Pr=30.0 psf(roof live load:Lumber DOL=1.15 Plate DOL=105),Pg=50.0 psf(ground snow),Pf=38,5 psf(flat roof snow:Lumber DOL=1 15 Plate DOL=1.15);Category 11;Exp B;Partially Exp.;Ct=1.1,Lu=50-0-0 4)This truss has been designed for greater of min roof live load of 12.0 psf or 1.00 times flat roof load of 38 5 psf on overhangs ®F Ns-W +_ non-concurrent with other live loads. ' , rO 5)Provide adequate drainage to prevent water ponding_ y other live loads O� 6)This truss has been designed for a 10,0 psf bottom chord live load nonconcurrent with an / 7).This truss has been designed for a live load of 20.Opsf on the bottom chord in all areas where a rectangle 3-6 0 tali by 2-0-0 wide �� will fit between the bottom chord and any other members. 8)Refer to girder(s)for truss to truss connections, t n � 9)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift at joint(s)Z. i ,'t t tltc+ 10) One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT at Jt(s)2_This connection is for uplift only t _ and does not consider lateral forces ` 11)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along (j. �? the Top Chord and Bottom Chord,nonconcurrent with any other live toads. 0,0, 12)Graphical purlin representation does not depict the size or the orientation of the purlin along the top and/or bottom chord. p July 26,2019 mum ®WARNING-Verily design parameters and READ NOTES GN THI s AND INCLUDED M1TEK REFERENCE PA GE M!i•7473 rev.Yo/o3/20t5 BEFORE USE tt } DeSgnra114fr(uuacnfywtlti!{fru��c�nrcWe�Ttd-'dasfpn'tehsrJ°niy{IpunparnnnWrs 1m4r,anditfor onrndvlduelhiAdingc°mporioM,not u UtisSsyi dm,f9glaro'usur INa ouT0ing d s gn¢r loos[wrfy Inn nppdralvtiityol de 10n p9mRtptont and propoffy Ince pnr 1v lhlri dniign ihlP Ilia wc:Uli bulldtn0 dnalpn,-HrdGlip Indlrfll8d}s to prrJOnl hltrl iliag Of FnNvldunl6U6s Web Nidra shunt c4land ers Doty-Add da iol ttipe}lye y and pdmgnenl b nNng YV I is arWoYn mquuad rnr Vtpni6tyodd td pi[wrinl rullupewtiih pvsawh pnraonnt irgury,nndprgpa Aipplt34: uaPecCrlt gale D513 99 and BGSI BJIIdIng Component 16023 Swingley Ridge Rd Inhriu-loan,p: nga aFlivery,ervotian sod niacMg of uussa anu flues ry.tums,s.n ry Chesterfield,MO 63017 8°(oty tnfomwl7°n'nunlln6la tram linos Alnto Ut�tliulu;t is,N.Loo svael,5dpe 91z Aieu+ndr ,vA a c31K; }oh russ - "-" Truss Type- `- 4ty Ply "BUILDING D ROOF VINEYARD VIEW 137938943 9597083 4 Roof Special -Jnb@eference fo trona/ Universal Component Cory_:,, EASTHAVEN-CT 06512-- - - 8,010 s Aug,li 2017 MITek Industries,Inc.Thu Jul 25 23:16:09 2019 Page 1 ID:uH81G91AM9_WOEtKnavHVNyuWBg-rUum7KtPl_lmtTNIahKTaRLFU1 NYo6b9rjvrrDUyuNRq 10f 37.11` 72-14 _ $,112 -r- 14-5-12 -- u 70•tSt '"—3=7-11 'j 3_-7.3 1-8-0 5-6-10 z l 4x4\ Scale 114"=1' 4 r 12 14s 12.00 12 /r 1x4 \\ 11 f � r 3 rao 2 15 -- 16 17 3x8 II 9 8 7 3x8 = 4x4 = 4x4 II 7-2-1i18.112 ,14-JM2 ---- -•- 7-2_1.1` gg_ip. - —� '•Plate Of et Y-.- 2_Ede`0 0• j&OF 34.013411,j7:Edg%0 2-81 - - - - - LOADING (psf) SPACING- 2-0-0 CSI. DEFL. in (loc) I/defi L/d PLATES GRIP TCLL(roof) 300 Plate Grip DOL 1.15 TC 081 Vert(LL) -0,20 2-9 >866 240 MT20 1971144 Snow(PflPg) 36 5/50.0 Lumber DOL 1.15 BC 0.64 Vert(CT) -0.27 2-9 >632 180 TCLL 10.0 Rep Stress Incr YES WB 0.39 Horz(CT) 0;01 7 n/a n!a 10.00 BCLL 0Code IBC2015rfP12014 ! Matrix-S Weight,70lb FT 20% BCfJL_ _ IMBER- BRACING- )P CHORD 2x4 SPF Not TOP CHORD Structural wood sheathing directly applied or 5-11-2 oc purlins, _JT CHORD 2x4 SPF No.2 except end verticals,and 2-M oc purlins(5.10-6 max.)'5-0. WEBS 2x3 SPF No.2 BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing: WEDGE Left,2x6 SPF No.2 REACTIONS. (Ib/size) 7=823/Mechanical,2=939/0-5-8 Max Horz 2=250(LC 13) Max Uplift 7=-B9(LC 11),2=-64(LC 14) FORCES. (lb)-Max.Comp,/Max.Ten:-All forces 250(ib)or less except when shown. TOP CHORD 2-3=938/120,3-4=-706/159,4-5=-660/178,5-6=-490/132,6-7=771/182 BOT CHORD 2-9=-274/555,8-9=-170!497 WEBS 4-9=-1691610,5-9=-3571155.5-8=-469/165,6-B=-154/703 NOTES- 1)Unbalanced roof live loads have been considered for this design. 2)Wind,ASCE 7-10,Vult=130mph(3-second gust)Vasd=103mph;TCDL=6.Opsf,BCDL=6,Opsf;h=25ft;B=45ft;L=24ft;eave=oft,Cat. Il;Exp B;enclosed;MWFRS(directional)and C-C Exterior(2)-0-10-8 to 2-1-8,Interlor(1)2-1-8 to 7-2-14,Exterior(2)7-2-14 to 8-11-2 zone;cantilever left and right exposed;end vertical left and right exposed;C-C for members and forces$MWFRS for reactions shown;Lumber DOL=1.60 plate grip DOL=1.60 3)TCLL•ASCE 7-10;Pr=30,0 psf(roof live load`Lumber DOL=1.15 Plate DOL=1 15);Pg=50.0 psf(ground snow);Pf=38 5 psf(flat roof.snow:Lumber DOL--1,15 Plate DOL=1.15);Category 11;Exp B;Partially Exp.;Ct=1.1,Lu=50-0-0 4)This truss has been designed for greater of min roof live load of 12.0 psf or 1.00 times flat roof load of 38:5 psf on overhangs non-concurrent with other live loads. OF NE� 5)Provide adequate drainage to prevent water ponding. 6)This truss has been designed for a 10 0 psf bottom chord live load nonconcurrent with any other live loads. (G1t11: JQ Q 7)•This truss has been designed for a live load of 20;Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide will fit between the bottom chord and any other members: �•+ 8)Refer to girder(s)for truss to truss connections. 2' ^ r 9)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift atjoint(s)7. { ,, �V' 10)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT at jt(s)Z This connection is for uplift only and does not consider lateral forces. 11)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 12)Graphical purlln representation does not depict the size or the orientation of the purlin along the top and/or bottom chord. 0 09943_ �ly� ��fiESStiON�. July 26,2019 a ®WARNING-Venty design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE M11.7473 rev,f 0103120fS BEFORE USF_ t O+:slOnvnfldfor uacn1ya61t>tkTri(*3sgnnadaie:TtaadeslgnWtasddonly,Uponparomoeaecthown,widl5fornnindhr:dWWildirigmmpeni•nf,Dolt 'nitaa�syatQnu[1o1p`rou¢a,fimUulf07ngdosfOnFrrpua{aaeily,Ifronppljeoiitl�tyofdgr�opneimdarsarnifpmgndylrctu�rltles�Fltltd4Alg11'InID{li4wavatli r- pp •laiini4ingdestpn.Oricin0iridhsfpol's'lop•o'uelatdticNllaO[?i'fndlvldualUus`swab'I+nd�o?Giardgiombhrs'anty,'hddiktonpl;tompdraryand'pamnnmtlfi'reeinD, � ;,1yi��®i�` ` I 1s ak4ugga triqulyd tar'< lillily drift Iv preaxlUt cO1tAPGawilh'PCUWtite pearA�aal injgry pnd,0ropertydaaaege:per ganeml,p.IlUaacC mgeiUtng aaa±: a tab iaaltaa��aa,wdngd,durary.oratiltnn and kraJhg arUiasse and truss aya{uaia.seo AMSIfTPI1 txivagsy Giiledp,Ds9.60 and B[:sl llulfdiri0 QomPonent 16023 Swingley Ridge Rd Sara{yldforrnultoh a'vallnhfalram7m�sP15teIn517aie,2fBN:iaaSticaLSUilo,3f2;'•{tlnxnr'.RrIo;,VA:2314. [ Chestedleld,M063017 Jab - -- oras f TrussT-ype;` - ally BUILDING D ROOF VINEYARD�VIEW 137936944 95970R3 T25 RcoLSpaiael 1 1 i - JnG Reference�(opUaiiall Universal Component Corp., EASTHAVEN.CT 06512 -- 8.010 s Aug 112017 MITdk Industries,Itic.,Thu Jul 25 23.16:10 2019 Page,1 ID.uH81G91AM9_W OEU<navHVNyuWBg-KgR9Kgg13ltdVdyx76n6ftPW RIxXYHJ3zfVixyuNRp D 8 3-7-11 1 7-0-14 —'$3 10 9 I�r12 O 1t1 - • -3-7-11 3-7-3 -0-t2 6 2 2 = Scale.1/A 4x4 = 4 f 13 5x8 \N 44 = 12 12.00 121x4 10 k� — 15 9 16 8 17 18 7 3xB li 4x4 II 3x8 = 4x4 = 7.2.14 &5-ti0 14.5.12 - J Plate Orlsels(X Y)- J2 EdRe 0.0=7) 15:13 f�-Q 6-2-61,<7.Ed�n;O LOADING (psf) DEFL. in (loc Ildefl L/d PLATES GRIP SPACING- 2-0-0 CSi. ) TCLL(roof) 30,0 Plate Grip DOL 1.15 TC 0.86 Vert(LL) -0.19 2-9 >891 240 MT20 1971144 Snow(PfIPg) 38.5150.0 Lumber DOL 1 15 BC 0.63 Vert(CT) -0,26 2-9 >652 180 TCDL 10.0 Rep Stress Incr YES WS 0.49 Horz(CT) 0,01 7 n/a Na BCLL 0.0 Code IBC20151TP12014 Matrix-S Weight'721b FT20% = BCDL 10.0 BER- BRACING- LUM LUMBER- 2x4 SPF No.2 TOP CHORD Structural wood sheathing directly applied or 5-11-1 cc purlins, TOP BOT CHORD 2x4 SPF No 2 except end verticals,and 2-0-0 cc purlins(4-1-0 max):5-6. WEBS 2x3 SPF No 2 BOT CHORD Rigid ceiling directly applied or 10-0-0 cc bracing WEBS 1 Row at midpt 6-7 WEDGE Left,2x6 SPF No.2 REACTIONS. (Ib/size) 7=823/Mechanical,2=93910-5-8 Max Horz 2=257(LC 13) Max Uplift 7=-106(LC 11),2=-62(LC 14) FORCES, (lb)-Max.Comp Wax,Ten.-All forces 250(lb)or less except when shown. TOP CHORD 2-3=-9381118,3-4=-706/157,4-5=-6761168,5-6=-4671139,6-7=-768/198 BOT CHORD 2-9=2951560,B-9=-1871471 WEBS 4-9=-1B11690,5-9=-4631166,6-8=-4361185.6-8=-1691663 NOTES- 1)Unbalanced roof live loads have been considered for this design. 2)Wind:ASCE 7-10;Vult=130mph(3-second gust)Vasd=103mph,TCDL=6.Opsf;BCDL=6.Opsf;h=25ft;B=45ft;L=24ft;eave=4ft,Cat. 11;Exp B;enclosed;MWFRS(directional)and C-C Exterior(2)-0-10-8 to 2-1-B,Intedor(1)2-1-8 to 7-2-14,Extedor(2)7-2-14 to 8-3-10 zone;cantilever left and right exposed;end vertical left and right exposed;C-C for members and forces&MWFRS for reactions shown;Lumber DOL=1,60 plate gnp DOL=1.60 3)TCLL:ASCE 7-10,Pr-30,0 psf(roof live load Lumber DOL=1.15 Plate DOL=1.15);Pg=50-0 psf(ground snow),Pf=3B 5 psf(flat roof snow:Lumber DOL=1,15 Plate DOL=1,15),Category 11;Exp B;Partially Exp„Ct=1.1,Lu=50-0-0 4)This truss has been designed for greater of min roof live load of 12,0 psf or 1.00 times flat roof load of 38.5 psf on overhangs o¢ NIF non-concurrent with other live loads, YV 5)Provide adequate drainage to prevent water ponding. P. W �0 ottom chord live load nonQ� 6)This truss has been designed fora 10,0 psf bconcurrent with any other live loads 7)'This truss has been designed for a live load of 20 Opsf on the bottom chord in all areas where a rectangle 3-6-0 tell by 2-0-0 wide z'rQ a6- so` will fit between the bottom chord and any other members,with BCDL=10,0psf sr 8)Refer to girder(s)for truss to truss connections, 1 9)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift at Joint(s)except Qt=lb) CC; 7=106. 10)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT at Jt(s)2,This connection is for uplift only fi ti> and does not consider lateral forces. 11)This truss has been designed for a moving concentrated load of 250.Olb live located at all mid panels and at all panel points along ��O the Top Chord and Bottom Chord,nonconcurrent with any other Iive loads. A 12)Graphical puriin representation does not depict the size or the orientation of the purlin along the top and/or bottom chord. SS10, July 26,2019 mai AWARNING-Verity design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE M11-7473 rev 10/03/2015 BEFORE USE l• i7cFpnvnLd latvau only,wlpilATokG'J Oonnacld!a.TMs ddslgn fs ttaa0y oniyupan poranwtors Gf'own,ondtu inran,lnaivldunf 61,ptvnp cOmporianl,-n01 atNassysium,'eotontu9m,ilia b0dinpdoognnrmug vmirylltulrptdr u1111Y.uldlrnign{1att�IrihttrsatiU'p:NiltrflytrwlpoRtfelbladnb'•gtinto iJrnv0o1411 WOW tnlfldifgd0 pn,allfrJnpittdirated6toplovOntWWirigp;indlvidualtnwers4bnbdior-chordmOrrrdcmonly.;itdditiofro�tamp4igry,andpnnnnnord6radPp 'U�„'T fs61ways,ratltdrp0cirhlAhAliyPod toprovenkcOOPW.bili,poGaYJnrGDonnlMjUry:inrlrytrnmiyddgtups,FnrA(n Yl putdgiirYrrljnfUrp1110 1bbdCnl ,olur^Q0ru�.Qellvo efoy trim and tulictnp of tiussosand tiujo oy0t6ma o8tr- ANSfiTPK Qunllly Gdtann,T1S0.88 and©G51 Bulldinp Component 16023 Sw Ogley Ridge Rd &ataly"IMcrm811dn•nvn1t06lafrtnitTrussr+tnratnnlliuio,YipN.LaoStmeLSo1n312.Wt>xnnrJrla;VA22314, ( Chesterfield,MO63017 Job Truss ;Truss Type - Qty P S' BUiLOING D,jt7Op'YINEYARp VIE4W -3 - r 137936945 5970R3 T25 j'Root Spatclal. 1 1 ' IaplLSrial); _ _ stJniversdi Component Corp.: - EAST HAVEN CT 06512 — Job`Refeienae "` 8.010 s Aug 112017 M{TyhlndYi tr_Fe3,Inc.,Thu Jul 25 23:16:11 2019 Page 1 ID.uH81G91AM9_1AJQEIKnavHVNyuWBg-os?XYOhfgc?U7nX7h5MxfsQc?rlhG gSldP2HNyuNRo p•Ifrt#" 3T-id 7=244 k1Wil 3-7-11 I' 3-7.3 0I$4 6-910 6x6 \\ Scale=1:49,9 4 80 = 4:A it 13 6 _ ,.ice." - - _ - - , - -. -•- 11- � 12.00 12 1x4 3 ti i �Y 4 9 . n 14 _ 15 I�3x8 11 8 7 4x4 = 44 = 7.8.2 6.9-10 Plate Offsets-(X;Y)= (2',Edae,O-f177L f4tEdite;0=2 61.f6:Edge 0-2 B] ---- LOADING (psf) SPACING- 2-0.0 CSI. DEFL. in (loc) I/dep L/d PLATES GRIP' TCLL(roof) 30.0 Plate Grip DOL 1.15 TC 0.75 Vert(LL) -028 2-8 >603 240 MT20 197/144 Snow(Pf/Pg) 38.5/50.0 j Lumber DOL 1.15 BC 0.73 Vert(CT) -037 2-8 >462 180 TCDL 10.0 1 Rep Stress incr YES WB 0.5.3 Horz(CT) 0.01 7 n/a n1a 10.0 9 BCLL 0.0 * i Code IBC20151TPI2014 Matrlx-S Weight:63 lb FT 20% BCFjL MBER- - BRACING- — - P CHORD 2x4 SPF No.2*Except* TOP CHORD Structural wood sheathing directly applied at 5-B-15 cc purlins, 5-6'2x4 SPF 2100F 1 BE except end verticals,and 2-0-0 cc purlins(6-0-0 max.):5-6 BOT CHORD 2x4 SPF No,2 BOT CHORD Rigid ceiling directly applied or 10-0-0 cc bracing. WEBS 2x3 SPF No.2 WEBS 1 Row at midpt 5-7 WEDGE Left'2x6 SPF No.2 REACTIONS. (Ib/size) 7=823/Mechanical,2=939/0-5-8 Max Horz 2=265(LC 13) Max Uplift 7=-124(LC 11),2=-60(LC 14) FORCES. (lb)-Max CompJMax Ten.-All forces 250(lb)or less except when shown. TOP CHORD 2-3=-922/115,3-4=-681/148,6-7=-332/90 BOT CHORD 2-8=-311/567,7-8=-2031457 WEBS 5-8=01406,5-7=-618/187 NOTES- 1)Unbalanced roof live loads have been considered for this design, 2)Wind ASCE 7-10;Vult=130mph(3-second gust)Vasd=103mph;TCDL=6.Opsf;BCDL=6.Opsf;h=25ft;B=45ft;L=24ft;eave=4ft;Cat. Il;Exp B,enclosed;MWFRS(directional)and C-C Exterior(2)-0-10-8 to 2-1-8,Interior(1)2-1-8 to 7-2-14,Extefior(2)7=2-14 to 7-8-2 zone,cantilever left and right exposed;end vertical left and right exposed;C-C for members and forces&MWFRS for reactions shown;Lumber DOL=1,60 plate grip DOL=1.60 3)TCLL:ASCE 7-10;Pr=30,0 psf(roof live load.Lumber DOL=1 15 Plate DOL=1.15);Pg=50.0 psf(ground snow);Pf=38.5 psf(fiat roof snow Lumber DOL=1.15 Plate DOL=1 15),Category II,Exp B;Partially Exp.;Ct=1.1,Lu=50-0-0 4)This truss has been designed for greater of min roof live load of 12.0 psf or 100 times flat roof load of 38 5 psf on overhangs �r OF Nie ,y non-concurrent with other live loads. V f! 5)Provide adequate drainage to prevent water ponding. �P ��f�J "Joy Q 6)This-truss has been designed for a 10,0 psf bottom chord live load nonconcurrent with any other live loads. 7)*This truss has been designed for a live load of 20.Opsf on the bottom chord in ail areas where a rectangle 3-6-0 tall by 2-0-0 wide will fit between the bottom chord and any other members,with BCDL=10,0psf• 8)Refer to girder(s)for truss to truss connections. 9)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift atjoint(s)except Ot=1b)- — 7=124 i t f' 10) One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT atlt(s)2.This connection is for uplift only and does not consider lateral forces. 11)This truss has been designed for a moving concentrated load of 250,0lb live located at all mid panels and at all panel points along CLQ 0-UggA3` <p�' the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 2)Graphical purlln representation does not depict the size or the orientation of the purlin along the top and/or bottom chord. SSI�� July 26,2019 A WARNING-Venry deslgn parameters and READ NOTES ON THIS AND INCLUOED MITER REFERENCE PAGE MY-7473 rev,10/03/2015 BEFORE USE peslgnvnAdfor useonly lvlytROTeW IcoRnuati •Tksdarign35basedonlyuponpnrnmhlER%fi wn;andliafornni ;rjquW,rwdding,canipcnnat,not' .n truss ayetnrtl,Befara use,Mira hisldlnR Ilur.'gyei mitt,!vOliff ttlli a(tALcnttlifiy of 411fqu psrdtllaliirs Sand pragudy`fn'rvrpa'mte I1llu;dutJ{piInto,ihe u4nruy bugdtng d+is(gd,Bracrtiq lluflafod is la proven!fldi: lif of individual truss webiaiiatnr chord nitillibord or%-,'AddiifP41 tainpomry wid'fremrnm•m brprtfag M i�'e " s`ntvnyJ}regartedfgr,.JpUltrtyendlaprgvanteellaf,�rwllbp>9sS:Wairc�-aianlinldryaae[prrljitntydomirye. FcrgeSkreWgulddn�.u'rugncci44nny ihn fabrication,atoiago,delivery,erection and bracing of frus-ses and truss systems,see AHSrfTP11 qunRly,Cfliefio,D5"D ped BCsl Bulldinp,Gomponent 16023 Swingley Ridge Rd i Safely Inforlitiition available from Truss Plate Inslliule,218 N Lee Street,Suite 312,Alexandria,VA 22314, Chesterfield,MO 63017 Job 'Truss 1nrsSTYpe city Ply BUILDING D ROOF VINEYARD VIEW 137938946 9597OR3 T27 Roof Special � 1 .19b Reference optional) _ 23:1Sst2 2019 Page 1 -Universal Corrlponenl Corp., EAST HAVEN CT 06512 $,Ofs Aug 11 2017 MiTek Industries;Inc. u Ju125 ID•uH81G91AM9_WQEtKnavHVNyuW Bg-G3ZvIMIHbv7Lkw6KFp�C4zn?ENXvSWcXH8bgpyuNRn .0,10.8 ___3-7-11 7-2•iR' 7,10 a 145-12 I 11.10.8" '3.7-11 3-75 101•7.3 67-11 Scale=1 8x8 4 6x6 44 II LL _ 12 �r 1200 12 1x4 10 �\ 0 3 9 ' l 13 -- - --- e� -14 15 7 3x8 11 4x4 4x4 = = 14.5•'12_ Plate OffsetstX,Y�—_(2E a 0.0 7, 4f .Edae, •3.81,IS:Kd 1A-0-2-81 —-- ---- - LOADING (psf) - ; SPACING- 2-0-0 CSI. DEFL in (loc) Ildefl Lid PLATES GRIP TCLL(roof) 3010 Plate Grip DOL 1,15 TC 0.75 Vert(LL) -0.30 2-8 >559 240 MT20 197!144 Snow(Pf/Pg) 38.5!50.0 Lumber DOL 1 15 BC 075 Vert(CT) -0.41 2-8 >416 180 TCDL 10,0 Rep Stress Incr YES i WB 0 51 Horz(CT) 0,01 7 n/a nla BCLL 0,0 Code IBC2015ITP12014 I Matrix-S Weight.62 Ib FT 20°/ = BCDL BER- BRACING- BER-UMCHORD 2x4 SPF No.2'Except' TOP CHORD Structural wood sheathing directly applied or 5-8-8 cc purlins, 2x4 SPF 2100F 1:BE except end verticals,and 2-0-0 cc purlins(6-0-0 max.):5-6. 5 x4 BOT CHORD 2x4 SPF Not BOT CHORD Rigid ceding directly applied or 9-9-4 cc; WEBS 2x3 SPF Not WEBS 1 Row at mldpt 5-7 WEDGE Left:2x6 SPF No.2 REACTIONS. (Ib/size) 7=823/Mechanical,2=939/0-5-8 Max Horz 2=263(LC 13) Max Uplift 7=-119(LC 11),2=-61(LC 14) FORCES. (Ib)-Max.CompJMax.Ten.-Alf forces 250(fb)or less except when shown. TOP CHORD 2-3=915!115,3-4=-6721146,6-7=-333/90 BOT CHORD 2-8=-306/557,7-8=-1971453 WEBS 5-8=01397,5-7=-61411 80 NOTES- 1)Unbalanced roof live loads have been considered for this design, 2)Wind-ASCE 7-10,Vuit--130mph(3-second gust)Vasd=103mph,TCDL=6 Opsf,BCDL=6.Opsf;h=25ft,B=45ft;L=24ft;eave=4ft;Cat, 11;Exp B;enclosed,MWFRS(directional)and C-C Exterior(2)-0-10-B to 2-1-8,Interior(1)2-1-B to 7-2-14,Exterior(2)7-2-14 to 7-10-1 zone,cantilever left and right exposed;end vertical left and right exposed;C-C for members and forces&MWFRS for reactions shown;Lumber DOL=1,60 plate grip DOL=1.60 3)TCLL ASCE 7-10;Pr=30,0 psf(roof live load'Lumber D0L=1.15 Plate D0L=1,15),Pg=50,0 psf(ground snow);Pf=38.5 psf(flat roof snow Lumber D0L=1 15 Plate D0L=1,15),Category 11,Exp B;Partially Exp;Ct=1.1,Lu=50-0-0 �� Q t- 4)This truss has been designed for greater of min roof live load of 12,0 psf or 1 00 times flat roof load of 38,5 psf on overhangs r non-concurrent with other live loads, �Q, 4��J J0/yN�0,p 5)Provide adequate drainage to prevent water ponding. 6)This truss has been designed for a 10.0 psf bottom chord live load noncanctlrrPnt wrth any other live loads. =O-0 wide 3v 7).This truss has been designed for a live load of 20.Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0 �- ,t will fit between the bottom chord and any other members,with BCDL=10.Opsf. JIiJ1 B)Refer to girder(s)for truss to truss connections. apahie of withstanding 100 Ib uplift at joint(s)except Qt=1b) 9)Provide mechanical connection(by others)of truss to bearing plate c 7=119. 10)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT atit(s)2.Thrs connection is for uplift only and does not consider lateral forces �Q Q.-09943`�� 11)This truss has been designed for a moving concentrated load of 250 Gib live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. p'gU/=ESSi0�P 12) Graphical puriln representation does not depict the size or the orientation of the purlln along the top and/or bottom chord. July 26,2019 AWARNING-Verify design parameters and REAO NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE 11,1II.7473 rev.1010312095 BEFORE USE. Usaidn wild.kraae pnlYl+Irr jtrTv`#9rc lnpc;arp 7u�da�pr fc bq cd aly,:.ran rr�rstnar.��wn;,tvrA 141G an l d)v?d1al brnt�,q leat,'rat� nUuss®yutugl.9'sfnrt:Uea,uinhu�dlerydeSelgnarmitaP:Jlrritylharipptira6Ggy,oidnai(an'pdranlmm�hem4ropprtyl'vcaeporefndUc,da p,ntotfin,r+v(rr huitrlin8deSvOn:BraemdiMiicatod)alplhniveptboc4jirlgofi44,'rvlddhltrussweb lindforchird-.inlrent4eery:Aldi,,nnItenipprury_nairarmMbIltOeclltia MiTb . is ntK;ry +ognlred Im srniltuiy Un 1,io"ptevpnt wiinrrcwdi s3bia pvraonal Intiry nml uror utly dnmogn.For gert0 a,g1tidarnco Fell IrIg dto16023 Fit fah+IbUI;•N.;aror0gd.doGvv�yy,atotricnandlsraF�np,prtrussaaandtrnestpynfo= zee;- fUt6rr1"i'17(AvnU}'yGrStulla,OS&89atid8G31BUIId6r0Component Chsterfeld,MO6301Rd Sphiylnfammtlpn avadnirin4pnrTrusPiplclUWro,21aN'LenSVatiLS'a11n312.glnxnmldn;VA2231d:' - - Job BUILDING 0-ROOF VINEYARD VIEW Truss Ply �26 Roof Special 137938947 Job Reference(optional) Universal Component Corp., -EASTHAVEN,CT05612 ,MiTvH,lnduslries�Ina 'PluJul-2623:16:11320ig'P�-gel-, 8,0 10-t Ajig,l 1-2017 o,=7w,.jr,A1F6 ,.M 'g"4� 0.10.8 3.7.1,1: B-5-91 114,542 4x4 = Scale 4 13 SX8 4x4 12 — 1200 [1T 1x4 3 C 7 10 l .," �_ 2 15 -Ar 16 17 18 9 ixa 11 a 7 3x8 = 44 = 4x4 11 7-2-14 14.5,12 Plaid OffsdtLr&� [7:Ed4%0-2-8j LOADING (psf) (roof) 30,0 SPACING- 2-0-0 CSI. DEFL. in (loc) Ildefi Ud PLATES GRIP Plate Grip DOL 1 15 TC 0 81 i Vert(LL) -0.19 2-9 >886 240 MT20 1971144 Snow(Pf/Pg) 38.5/500 Lumber DOL 1 15 BC 0.64 Vert(CT) -0,26 2-9 >647 180 TCDL 10.0 Rep Stress Inor YES WB 0,44 Horz(CT) 0.01 7 n/a n/a BCLL 0,0— Code IBC2015ITP12014 Matrix-S BCDL Weight,71 lb FT 20% EMBER- BRACING- )P CHORD 2x4 SPF No,2 TOP CHORD Structural wood sheathing directly applied or 5-11-1 oc purlins, __)TCHORD 2x4 SPF No,2 except end verticals,and 2-0-0 Do purlins(4-9-4 max.):5-6. WEBS 2x3 SPF No 2 BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing. WEDGE WEBS I Row at midpt 6-7 Left:2x6 SPF No 2 REACTIONS. (lb/size) 7=823/Mechanical,2=93910-5-8 Max Horz 2=255(LC 13) Max Uplift 7=-102(LC 11),2=62([_C 14) FORCES. (lb)-Max.Comp./Max.Ten—All forces 250(lb)or less except when shown, TOP CHORD 2-3=938/118,3-4=-706/158,4-5=-6671185,5-6=-4721137,6-7=7691194 BOT CHORD 2-9=-289/559,8-9=-182/477 WEBS 4-9=-1781663,5-9=-433/162,5-8=-444/179,6-8=-165/672 NOTES- 1)Unbalanced roof live loads have been considered for this design.. 2)Wind-ASCE 7-10;Vult=130mph(3-second gust)Vasd=103mph,TCDL=6.Opsf,BCDL=6.Opsf,h=25ft;B=45ft,L=24ft;eave=4ft,Cat 11;Exp B;enclosed;MWFRS(directional)and C-C Exterior(2)-0-10-B to 2-1-8,Interior(l)2-1-8 to 7-2-14,Exterior(2)7-2-14 to B-5-9 zone;cantilever left and right exposed;end vertical left and right exposed;C-C for members and forces&MWFRS for reactions shown;Lumber DOL=1.60 plate grip DOL=l 60 3)TCLL:ASCE 7-10,Pr=30 0 psf(roof live load Lumber DOL=1.15 Plate DOL=I-.15);Pg=50.0 psf(ground snow);Pf--38.5 psf(flat roof snow:Lumber DOL=1.16 Plate DOL=1.15),Category 11,Exp B;Partially Exp;Ct--1.1,Lu=50-0-0 4)This truss has been designed for greater of min roof live load of 12,0 psf or 1.00 times flat roof load of 38.5 psf on overhangs non-concurrent with other live loads. 6)Provide adequate drainage to prevent water ponding, 6)This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads, X) 7)*This truss has been designed for a live load of 20.Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide will fit between the bottom chord and any other members,with BCDL=10.0psC 8)Refer to girder(s)for truss to truss connections. 9)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 lb uplift at joint(s)excepfat=lb) 7=102 10) One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT atjqs)2.This connection Is for uplift only 1Lu and does not consider lateral forces. 11)This truss has been designed for 6 moving concentrated load of 250,01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. OA 0 0 06.94 '2) Graphical purlin representation does not depict the size or the orientation of the purlin along the top and/or bottom chord. July 26,2019 A WARNING-Verify design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE 911-7473 rev 1010312015 BEFORE USE ofmlpn'vllld 143i i1fie 6vily T14 d6&'qa1-;bawd tnly(ilatin;wwroilons MioWn,Mid b f0c;M ladividdlil bU5d1iDrLCQfVpojKqiXj'n0l, lni6ilir"witil ,t ifBC Wei( fabiricalivi,olarng*,delik% e4 udioll iTid bncii)p 6r ltus%osiied lion GyBiegiB,zoo ANS10111 Q6611ty Clitoris,OS13-OR tt6d'ISCS1 Bullding Componont 16023 Swinglay Ridge Rd Rafe foolhula.718 N.Ucj'Suoa, VA 22314. Chesterfield,MO 63017 Job Truss russT,ypa - Qty Ply BUILDINGD'ROOF VINEYARDVIEW 137938948 35870R3 29 Root Special 1 1 I I EAST HAVEN CT 06512 8. Jabf2sfcra�ce�tiartal - . Universal Component Corp., 010 s Aub 11 2917,MiTek Industries,Inc. Thu Jul 25 23.16:15 2018 Page 1 I D:uH81 G91AM9_W QEtKnavHVNyuW Bg-ge F2 N OkAu gVwbOgvwxQtpi b H 6 SQvC rJ2DFNGQByuNRk -{? 3-7-11 7-2-14 _,. t`r•10•f3 3-7-11 3-7.3 1-]0 i 5-4-11 Scale.1r, 4x4 4 f �13 % ?- "IQ j 6 1� 12.00 12 15 1x4 a 14 11 10 r / 2 *� 'y 16 9 17 8 18 7 3x8 II 2x4 II 3xa = 4x4 = 7-2-14 9-t-1 _3 14-5-12 7-_2-14 1-10-3 54.11 — �IaIE afisels>(Y.Yi L2:cdge;0.0 7] LOADING (psf) SPACING- 2-0-0 CSI, DEFL. in (loc) I/deft L/d PLATES GRIP TCLL(roof) 30,0 Plate Grip DOL 1.15 TC 0.74 Vert(LL) -0.20 2-9 >859 240 MT20 197/144 Snow(Pf/Pg) 38.5/50,0 Lumber DOL 1.15 BC 0,65 Vert(CT) -0 27 2-9 >627 180 TCDL 100 Rep Stress Incr YES WB 0.38 Horz(CT) 0,01 7 n/a n/a BCLL 0.0 Code iBC2015ITP12014 Matrix-S Weight.69 FT 20% = BCDL .10.0 LUMBER- BRACING- TOP CHORD 2x4 SPF No.2 TOP CHORD Structural wood sheathing directly applied or 5-11-2 cc purlins, BOT CHORD 2x4 SPF No.2 except end verticals,and 2-0-0 cc purlins(6-0-0 max.)'5-6 WEBS 2x3 SPF No,2 BOT CHORD Rigid ceding directly applied or 10-0-0 oc bracing WEDGE Left 2x6 SPF No 2 REACTIONS. (Ib/size) 7=823/Mechanical,2=939/0-5-8 Max Horz 2=248(LC 13) Max Uplift 7=-85(LC 11),2=-64(LC 14) FORCES. (lb)-Max.Comp/Max.Ten.-All forces 250(lb)or less except when shown. TOP CHORD 2-3=-938/121,3-4=706/180,4-5=-659/175,5-6=-496/130.6-7=-772/178 BOT CHORD 2-9=-269/554,8-9=-166/503 WEBS 4-9=-165/592,5-9=342/151,5-8=477/161,6-B=-1511713 NOTES- 1)Unbalanced roof live loads have been considered for this design. 2)Wind:ASCE 7-10,Vult=130mph(3-second gust)Vasd=103mph,TCDL=6,opsf;BCDL=6,Opsf;h=25ft,B=45ft;L=24ft;eave=4ft,Cat. ll;Exp B,enclosed;MWFRS(directional)and C-C Exterior(2)-0-10-8 to 2-1-8,Intenor(1)2-1-8 to 7-2-14,Extedor(2)7-2-14 to 9-1-1 zone,cantilever left and right exposed;end vertical left and right exposed;C-C for members and forces t3,MWFRS for reactions shown,Lumber DOL=1.60 plate grip DOL=1.60 3)TCLL ASCE 7-10;Pr=30.0 psf(roof live load Lumber DOL=1,15 Plate DOL=1.15);P9=50.0 psf(ground snow);Pf=38 5 psf(flat roof snow:Lumber DOL=1.15 Plate DOL=1-,15);Category Il;Exp B;Partially Exp,Ct=1 1,Lu=50-0-0 4)This truss has been designed for greater of min roof live load of 12.0 psf or 1.00 times flat roof load of 38.5 psf on overhangs f NE non-concurrent with other live loads. � 5)Provide adequate drainage to prevent water ponding 4/ 6)This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads. 7)1 This truss has been designed for a live load of 20.Opsf on the bottom chord In all areas where a rectangle 3-6-0 tall by 2-0-0 wide �Cj av will fit between the bottom chord and any other members. 8)Refer to girder(s)for truss to truss connections cc 9)Provide mechanical connection(by others)of truss to beanng plate capable of withstanding 100 Ib uplift at joint(s)7. y `' 4 10)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT at It(s)2.This connection is for uplift only m ?!? Uj and does not consider lateral forces. 11)This truss has been designed for a moving Concentrated load of 250.0Ib live located at all mid panels and at all panel points along N the Top Chord and Bottom Chord,nonconcurrent with any other live loads, ' 12)Graphical purlin representation does not depict the size or the orientation of the pudi tn along the top and/or bottom chard �0 �' 9�4�3 July 26,2019 ®WARNING-Verify desrgn parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE M11-7473 rev.10/03/2015 BEFORE USE D Ipn vutirlddr use enly w;Ih l f,Tsn OtNi(10,.iar,77c'a aix+l; N Fa9e 3 anl}'u,otipnrS?olars yY.nwn aria is tar an indrviduni buUanuJ conipenont,nal aitntpsayatany't;ororpuso;lbnbolamffdnsl9oertnuFivorliyttuapplirabfh/at�aaplginQ�mmala�r rndpmgarylawrtw+ntntnludeil�nln1n:nnwrr411 MiTek! P, 16023 SvMgley!z•�Ildlnn,d�Sfln>er?drVp(ptL«atptllc'lopiavenfUl�:�fhiD,ninip+++kfu,atUUsswcbnndtaret:ordtatlrnbareciSgt•Atldll(r,'nal!enipararyandpp�arnikmuuttupdnfl 1e01wayA roquUoy(ar�fuuiHly and lO;prrrvanl w:lOpsp w,v!pG.ElWd per&pnal inlliry�rpl prOpetly cicunpQO.FortIanrml pu�danon reflpr4lntl the �; 1pbriu�tltm,pinmga,del{ii+ndyy,nreGinn and�3qutlt9ttnls:,nant�d'uupe*syaterng,pna - AN5tripll'QualltyGr]iprin,DS6.&BnndBC51Bu11tl1ngCompon°nt 1 Chesterfeld,M 61301 Rd Snrety tHrdrmotian avoltablo htun7rusa Plata'lo�tttuta,21B tr,Loo 5npdt„Sui:n312."Ngxnpdrip„4A'17354. ”" - - Job11russ Trua5Type -' — -'' "- Qty Ply BUI DINGD ROOF VINEYARD VIEW { I 137938949 kmR3 T30 Roof Sgei tai 1 1 Universal Component Corp„ - EAST HAVEN CT 06512--" - 8A10`s Au9,11 2017 MtTek Industries,Inc.Thu Jul 25,23;96:16 2019 Page 1 ID.uH81G9tAM9_VVQEtKnavHVNyuUVBg-BgpQbllofadnDYP5Ufy6Mw7 WWsi?xJSBSv6pzayuNRJ -� 3-741. t @•&9' -14�1210•tf — 3-7=11 3-7-3-` 44 = Scale '[W--l' 4 12 6x6 = 4x4 = 12,00 U - •� -- r'7 6 1x4 _ 3 '+ t l � 10 I " 2 " - —- 16 - 17 i6 Y 13x8 it 9 8 7 3x8 = 4x4 = 2x4 ll - — 7-2-14 (?late Offsets X Yl =2:Ed a 0-0• - LOADING (psf) SPACING- 2-0-0 CSI, DEFL. In (loc) I/defl Ud PLATES GRIP (roof) 30.0 Snow Plate Grip DOL 1.15 TC 0.50 Vert(LL) -0.20 2-9 >832 240 MT20 1971144 TCDL Snow(Pf/Pg) 385150.0 010 Lumber DOL 1.15 BC 0.66 Vert(CT) -0,28 2-9 >611 180 BCLL 10.0 Rep Stress Incr YES i WB 0.32 Horz(CT) 0,01 7 n/a n/a -BCDL 16.6i Code IBC2015/TPI2014 Matrix-S Weight 68 lb FT 20% ,IMBER- - - T — - - - — BRACING- ' IP CHORD 2x4 SPF Not TOP CHORD Structural wood sheathing directly applied or 5-11-2 cc purlins, .JT CHORD 2x4 SPF No 2 except end verticals,and 2-0-0 oc purlins(6-0-0 max) 5-6 WEBS 2x3 SPF No 2 BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing. WEDGE Left:2x6 SPF No.2 REACTIONS. (Ib/size) 7=823/Mechanical,2=939/0-5-8 Max Horz 2=240(LC 13) Max Uplift 7=67(LC 11),2=-65(LC 14) FORCES. (lb)-Max Comp./Max Ten.-All forces 250(ib)or less except when shown TOP CHORD 2-3=-938/123,3-4=-7061162,4-5=-664/163,5-6=-518/123,6-7=-776/163 BOT CHORD 2-9=-2461554,8-9=-151/527 WEBS 4-9=1481538,5-9=-299/141,5-8=-510/149,6-B=-139/751 NOTES- 1)Unbalanced roof live loads have been considered for this design. 2)Wind.ASCE 7-10,Vult=130mph(3-second gust)Vasd=103mph;TCDL=6 Opsf,BCDL=6.Opsf,h=25ft;B=45ft;L=24ft,eave=4ft;Cat. II;Exp B;enclosed;MWFRS(directional)and C-C Exterior(2)-0-10-8 to 2-1-8,Interior(1)2-1-8 to 7-2-14,Exterior(2)7-2-14 to 9-B-9 zone,cantilever left and right exposed;end vertical left and right exposed,C-C for members and forces&MWFRS for reactions shown;Lumber DOL=1 60 plate grip DOL=1 60 3)TCLL•ASCE 7-10;Pr-30.0 psf(roof live load:Lumber DOL=1.15 Plate DOL=1.15);Pg=50 0 psf(ground snow);Pf=38.5 psf(flat roof snow Lumber DOL=1.15 Plate DOL=1 15);Category II;Exp B;Partially Exp,;Ct=1 1,Lu=50-0-0 4)This truss has been designed for greater of min roof live load of 12.0 psf or 1.00 times flat roof load of 38.5 psf on overhangs non-concurrent with other live loads, / O� �, 5)Provide adequate drainage to prevent water ponding. V !' 6)This truss has been designed for,a 10,0 psf bottom chord live load nonconcurrent with any other live loads 7)"This truss has been designed for a live load of 20.Opsf on the bottom chord in all areas where a rectangle 3-6-0-tall by 2-0-0 wide O will fit between the bottom chord and any other members. 8)Refer to girder(s)for truss to truss connections. / a 9)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift at joint(s)7; -. 10)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT at jt(s)2.This connection is for uplift only r and does not consider lateral forces. 11)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. ��, !�•- r� 12)Graphical purlin representation does not depict the size or the orientation of the purlin along the top and/or bottom chord. ',099456" ;Ogge}33- July 26;2019 ®WARNING-Verify design pararnefers and READ NOTES ON THIS AND INCLUDED A11TEK REFERENCE PAGE M11-7473 rev 1010312015 BEFORE USE. Oesignvngd'Inr u:n aniywllh h°lYakvconnc<Iar�Ttus design tx trnadd,cnly upon pa�n+ tces ha�vd,unu I,far an Gldiildual u_tn�ng eompenvn4 pot a uds nyala"i eoiola Ufio,IIrO Guldit+(1 daclOnri-munt,YogrY Ihn`appUcrilil0ty,or,doal04 pq+ametois artd propmiyln[6tpai+rtd d111;dnslgn Inbthe ovandl. hJ�IdinO dt:sl0nr 6ratino tnd1=1 I is ro fuevuit buc4¶n0 of GitUv>,��ol itusawNb,andAor chord tnombbrsonry.AddRlonat rampaTary",Ord pumineoiul bradng �;'�"�y��r laatwgynio"yulrodrur,st081lNylmdiauimdaici,7tapsiRwlthua5:l6tajtcmond11n1+?rYMrdp+aQartyQRtjtoge;Porgenaialt1u11tnnr�Otut1(,igtltu- - faWiGolla alomtlo,delis ry,eroclWn and b;•s�ng at 0a:3e5 agdlsdss9ystvhia.sec •AN6VTPlf aunury crtlerlA,OSB•80 and 6C910u11dh+g Component 16023 Swinglay FLdga Rd Snroty Infbm+allon nvalls6fa from TnrssPloialnal4uta,2f8 N;Lee:SlreaL N1tc 312:Noxandrio,VA2231d, Che-1 aid,MO 63017 Jtlb toss Tg16s Type Qty Ply BUILDING D ROOF VINEYARD VIEW 137938950 3597483 31 Roof Special 1 1 Job Reference o tional Universal Component Corp„ EAST HAVEN CT 06512 -8:010 s Aug 11 2017 Mi I ek Industries,Inc.Thu J11128 23:16;')7 2019 Pagel ID:uH8lG9iAM9 WQEtKnavHVNyuWBg-COMoo3mQQSleri_H2MTLu7girF56gmQLgZsMVIyuNRi QQ1D• 3-7.1i 7�Y14 1t1�11 145'12' -,1 Q•.iD•8` 3-7-11 I-`3 7.3 3-1 3 4-I-11 Scale 1/4 44 4 j/ 13 12- 6x6 = 4x4 = 12.00 _ 6 1 x4 �� 11 / (a 1 _ _6 3 14 1.6 0 r { 10 9 17 18 16 6 7 3x8 II 2x4 II 3x6 = 4x4 = 7-2-14 1Q 4.1 t 1.5-12 1- " i-2.14 Plata Olfse 2:Ed e,0.0• - LOADING (psf) SPACING- 2-0-0 CSI. DEFL. in (loc) I/deft Ud PLATES GRIP TCLL(roof) 30.0 Plate Grip DOL 1.15 TC 0.40 Vert(LL) -0.21 2-9 >809 240 MT20 1971144 Snow(Pf/Pg) 38.5/50.0 Lumber DOL 1.15 BC Q:66 Vert(CT) -028 2-9 >599 180 TCDL 100 Rep Stress Incr YES WB 0.27 Horz(CT) 0,01 7 n/a n/a BCLL 0.0 Weight 66 Ib FT=20% _ 10.0 Code IBC2015ITPI2014 MatrlX-S BCDL - _ LUMBER- BRACING- TOP CHORD 2x4 SPF No.2 TOP CHORD Structural wood sheathing directly applied or 5-11-1 cc purlins, BOT CHORD 2x4 SPF No 2 except end verticals,and 2-0-0 cc purlins(6-0-0 max.)'5-6 BOT CHORD Rigid ceiling directly applied or 10-0-0 cc bracing WEBS 2x3 SPF No,2 WEDGE Left'2x6 SPF No 2 REACTIONS. (Ib/size) 7=823/Mechanical,2=939/0-5-8 Max Horz 2=232(LC 13) Max Uplift 7=49(LC 11),2=-67(LC 14) FORCES. (ib)-Max.Comp/Max Ten.-All forces 250(lb)or less except when shown TOP CHORD 2-3=-937/124,3-4=-705/163,4-5=679/152,5-6=-5401117,6-7=-781/149 BOT CHORD 2-9=-222/553,8-9=138/551 WEBS 4-9=130/495,5-9=-274/136,5-8=544/140,6-8=-1 311791 NOTES- 1)Unbalanced roof live loads have been considered for this design. 2)Wind:ASCE 7-10;Vult=130mph(3-second gust)Vasd=103mph,TCDL=6,Opsf;BCDL=6,Opsf;h=25ft,B=45ft;L=24ft;eave=4ft;Cat. 11;Exp B,enclosed;MWFRS(directional)and C-C Extenor(2)-0-10-8 to 2-1-8,Interior(1)2-1-8 to 7-2-14,Exterior(2)7-2-14 to 10-4-1 zone;cantilever left and right exposed,end vertical left and right exposed,C-C for members and forces&MWFRS for reactions shown,Lumber DOL=1.60 plate grip DOL--1.60 3)TCLL:ASCE 7-10;Pr=30 0 psf(roof live load Lumber DOL=1,15 Plate DOL=1.15);Pg=50 0 psf(ground snow),Pf=38 5 psf(flat roof snow-Lumber DOL=1.15 Plate DOL=1 15);Category II,Exp B,Partially Exp.;Ct=1.1,Lu=50-0-0 4)This truss has been designed for greater of min roof live load of 12 0 psf or 1.00 times flat roof load of 38 5 psf on overhangs of NES non-concurrent with other live loads. ! 5)Provide adequate drainage to prevent water ponding. �� J0, A yO� 6)This truss has been designed fora 10,0 psf bottom chord live load nonconcurrent with any other live loads. 7)'This inks has been designed for a live load of 20 Opsf on the bottom chord in all areas where a rectangle 3-6- tall by 2-0-0 wide ' lr0 will fit between the bottom chord and any other members. A 4 8)Refer to girder(s)for truss to truss connections. (L 9)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift at joint(s)7. f`• 10)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT at jt(s)2-,This connection is for uplift only and does not consider lateral forces. 11)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along ()i the Top Chord and Bottom Chord,nonconcurrent with any other live loads. ��• �a;�� 3� {,� 12) Graphical purlin representation does not depict the size or the orientation of the purlin along the top and/or bottom chord. p q�FEss1 July 26,2019 i ®WARNING-Veiny design parameters and READ NOTES ON THIS AND INCLUDED M1TEK REFERENCE PAGE M11•7473 rev,10/03/2075 BEFORE USE. t Dcsyytr vaad for ri�n only wiei 'viuia torulc;wu i�iu dgn a baaC� d;;f�.^rte"r !"uPd o¢qm nn^nt,rpt E �� dltU[ss syt„am,gdraroihsbuirdrrp<las(Onafmust vngtylhe npA6eabanry of dnaronpammatmu ami prct<?axly ir�cvtr!fo*ntn 4:ih dnai¢n ln1Dt11b OVCr71�1 ( ,ID��t�. bu{Idlnpdesi¢n.8raefitpirtdli 1pdIsIgprnvailAutklln¢oftrb�INddaiUucsWabundrortRprdptarnbntsonly,AdddiatintIampdtary,nntlparmannnihrpci0¢ fti(+ { lsnivoys'rag4UodraYseU1t11Y>+ndioyrppntcwiopso�hlht> 6lalnpnrnnnpttnlnrinptlluApanydnmapa,ForganatplpaillnncetetiodktDthe16023 Ridge eWicatian•s:on0u,dep4oN.°scat r n.nil nrodnp a1 uus i and htx syatrina,3na. AHsV,1 QOailty Cdtedh,03$430 and IiGSI aupoing component Chesterfield,MO 63017Rd nip Snrpty lnroiinal[an nv6lieUle Uelri Tnres Petp tlmtimin•21&tt,Wo Sireta.SPho 312:Nnxpnddn,yg 22314, _ _ V�M - _-_- - _ Job cuss Truss Type Qty Ply BUILDING D ROOF VINEYARD VIEW -- - 137938951 95970R3 32 Roof Special 1, 1 Job Reference ODGonal _ Universal Component Corp., EAST HAVEN CT 06512 8.010 s Aug 112017 MrRek lndUOtriesi4ric, ThU JUL 25 23:30:18 2019 Pagel ID uH81GgiAM9_WQEtKnavHVNyuWBg-5CwAOPm2AItVTi2Ub3_aRLDuafRGPDQUvObwfTyuNRh 72-b1_ _ 01'1.9_ 9'44 1 D-B' 3-7-11-�� --,3-7- 1 3 - ---3-g 11 3-6-3—--- 4X4 --4x4 =' Scale,1/4"=1' 4 ' 1200 12 '12 '<<; 13 1x4 \ 1 ,- 14 6x6 = 4x4 = 10 f o 3x6-11 17 - -9 - - 19 - 8 19 ----7- , 3xB = 4x4 = 1x4 II MET — - _.14-5-12 --- 2-14 3 8-11 - - - - --Pate s�- O{frets X Y)- �z�E��-� -----_--- _-- _- --_ �- = -_-_---- - ----- --- _ LOADING (psf) SPACING- 2-0-0 CSI„ DEFL. in (loc) I/clef! L/d PLATES GRIP TCLL(roof) 30,0 Plate Grip DOL 1,,15 TC 0.34 Vert(LL) -021 2-9 >791 240 MT20 1971144 Snow(Pf/Pg) 38.5/50:0 Lumber DOL 1.15 BC 0.67 Vert(CT) -0,29 2-9 >590 180 TCDL 10.0 Rep Stress Incr YES WB, 0.29 Horz(CT) 0,01 7 n/a n/a BCLL 0,0 BCDL---__-- g Code ISC2015ITP12014 Matrix-S Weight:65 Ib FT=20% _-. �-- 30.0 IMBER- BRACING- - -- )P CHORD 2x4 SPF No,2 TOP CHORD Structural wood sheathing directly applied or 5-11-1 CC purlins, __)T CHORD 2x4 SPF No,2 except end verticals,and 2-0-0 oc purlins(6-0-0 max) 5-6 WEBS 2x3 SPF No.2 BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing. WEDGE Left'2x6 SPF No.2 REACTIONS. (Ib/size) 7=823/Mechanical,2=939/0-5-8 Max Horz 2=224(LC 13) Max Uplift 7=-35(LC 14),2=-68(LC 14) FORCES. (lb)-Max.Com pJMax.Ten.-All forces 250(Ib)or less except when shown. TOP CHORD 2-3=-937/122,3-4=-705/161,4-5=700/139,5-6=-562/110,6-7=-785/136 BOT CHORD 2-9=-197/552,8-9=-127/576 WEBS 4-9=-109/460,5-9=-262/130,5-8=582/137,6-8=-126/836 NOTES- 1)Unbalanced roof live loads have been considered for this design, 2)Wind:ASCE 7-10,Vult=130mph(3-second gust)Vasd=103mph,TCDL=6.Opsf,BCDL=6.OpsF,h=25ft;6=45ft,L=24ft;save=4ft,Cat. Il,Exp B;enclosed,MWFRS(directional)and C-C Exterior(2)-0-10-8 to 2-1-8,Interior(1)2-1-8 to 7-2-14,Exterior(2)7-2-14 to 10-2-14,Interior(1)10-11-9 to 14-4-8 zone,cantilever left and right exposed;end vertical left and right exposed:C-C for members and forces&MWFRS for reactions shown:Lumber DOL=1,60 plate grip DOL=1.60 3)TCLL ASCE 7-10;Pr-30.0 psf(roof live load Lumber DOL=1,15 Plate DOL=1.15);Pg=50 0 psf(ground snow),Pf-38 5 psf(flat roof snow:Lumber DOL=1 15 Plate DOL=1 15);Category Il;Exp B;Partially Exp;;Ct=1.1,Lu=50-0-0 4)This truss has been designed for greater of min roof live load of 12.0 psf or 1.00 times flat roof load of 38 5 psf on overhangs' non-concurrent with other live loads. dIF NES 5)Provide adequate drainage to prevent water ponding 6)This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live,loads. 7)`This truss has been designed for a live load of 20 Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide ' �Q` D. �0 will fit between the bottom chord and any other members �" .�! -XY, 8)Refer to girder(s)for truss to truss connections, 9)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift atjoint(s)7 10)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT at Jt(s)2.This connection is for uplift only and does not consider lateral forces. ' LU 11)This truss has been designed fora moving concentrated load of 250.01b live located at all mid panels and at all panel points along -of the Top Chord and Bottom Chord,nonconcurrent with any other live loads, 12) Graphical puritn representation does not depict the size or the orientation of the purlin along the top and/or bottom chord, rip ' 4799af V ' 10N�.. July 26,2019 I ®WARNING-Verify design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGEMII.7473 rev 1010312015 BEFORE USE Design valid for use only with MITek®connectors.This design is based only upon parameters shown,and is for an Individual building component,notfa a truss system.Before use,the building designer must verify the applicability ordesign parameters and properly incorporate this design into the overall : budding design.Bracing indicated is to prevent buckling of individual buss web and/or chord members only,Additional temporary and permanent braurig (-� is always required forstabdily and to prevent collapse with possible personal injury and property damage M1T64L�,Far general guidance regarding the fabrication,storage,tlaRvnryry,,erection and bracing of trusses and truss systems,see ANSIITPII Quality Criteria,DSB-39 and BCSI Budding Component 16023 Svingley Ridge Rd va Safety Information hiinbys from Truss Plate Institute,218 N Lee Street,Suite 312,Alexandria,VA 22314. Chesterfield,MO 63017 Job Truss Tru6sTypp Qty Ply �UILDINGD-ROOF VINEYARD VIEW 137938952', 85970R3 33 Roof Spetlal 1 1 Jab Reference(opGonall Universal Component Corp„ -EAST HAVE,V CT 08592 8:010-s Aug 11 2017 MlTek Industhes,Inc. Thu Jul 25 23;16-,,19 2019 Page 1 ID uH81G91AM9_WQEtKnavHVNyuWBg-ZPUYDIngx3?M4'r8g9nVp_YI2A3nSBfpdBtLTavyuNRg Qp 1DEj ---3.711 74-14 11-7-1 t 14• T2�l D•1q.g 3 7-11 -` 3-7-3 t}3 -2t 11 Scale,11, 4x4 4 12� 13 12,00 121x4 \\ J 14 11 � v 3 6x6 44 = 6 - 16 9 17 8 18 7 3x8 II 1x4 II 3x8 = 4x4 = 7-2-14- - -- 2-10-11- Plate Qrfse4s(<Y)= Z1.Edeg_ -0-71 LOADING (psf) SPACING- 2-0-0 CSI, DEFL. in ([cc) Ildefl Ltd PLATES GRIP TCLL(roof) 30,0 Plate Grip DOL 1,15 TC 0.41 Vert(LL) -0,22 2-9 >775 240 MT20 1971144 Snow(Pf/Pg) 38,5/50,0 I Lumber DOL 1.15 BC 0,67 Vert(CT) -029 2-9 >585 180 TCDL 100 Rep Stress Incr YES WB 0.30 Horz(CT) 0.01 7 n1a n/a BCLL 00 Code IBC2015rrP12014 Matrix-S Weight:63 Ib FT=20% BCDL _ 10.0 LUMBER- - - BRACING- TOP CHORD 2x4 SPF No,2 TOP CHORD Structural wood sheathing directly applied or 5-11-0 cc purlins, BOT CHORD 2x4 SPF No,2 except end verticals,and 2-0-0 oc purlins(6-0-0 max) 5-6 WEBS 2x3 SPF No,2 BOT CHORD Rigid ceiling directly applied or 10-0-0 cc bracing WEDGE Left 2x6 SPF No 2 REACTIONS. (Ib/size) 7=823/Mechanical,2=93910-5-8 Max Horz 2=217(LC 13) Max Uplift 7=-35(LC 14),2=-69(LC 14) FORCES. (lb)-Max Comp./Max Ten -All forces 250(lb)or less except when shown. TOP CHORD 2-3=-9371120,3-4=-7051159,4-5=7241128,5-6=-584/105,6-7=791/121 BOT CHORD 2-9=-1 701552,8-9=-119/603 WEBS 4-9=89/445,5-9=-261/131,5-8=-6251138,6-8=-125/885 NOTES- 1)Unbalanced roof live loads have been considered for this design„ 2)Wind:ASCE 7-10;Vult=130mph(3-second gust)Vasd=103mph,TCDL=6.Opsf;BCDL=6.Opsf;h=25ft;8=45ft,L=24ft,eave=4ft;Cat. it;Exp B;enclosed,MW FRS(directional)and C-C Extetior(2)-0-10-8 to 2-1-8,Interlor(1)2-1-8 to 7-2-14,Extenor(2)7-2-14 to 10-2-14,Interior(1)11-7-1 to 14-4-8 zone,cantilever left and right exposed,end vertical left and right exposed,C-C for members and forces&MWFRS for reactions shown;Lumber DOL=1 60 plate grip DOL=1,60 3)TCLL-ASCE 7-10,Pr=30.0 psf(roof live load Lumber DOL=1 15 Plate DOL=1.15);Pg=50,0 psf(ground snow),Pf=38.5 psi(flat roof snow Lumber DOL=1 15 Plate DOL=1.15),Category II;Exp B;Partially Exp.;Ct=1 1,Lu=50-0-0 4)This truss has been designed for greater of min roof live load of 12.0 psf or 1.0D times flat roof load of 38 5 psf on overhangs N non-concurrent with other live loads, ��V - 5)Provide adequate drainage to prevent water ponding. 6)This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads JO�� 7)'This Miss has been designed for a live load of 20.Opsf on the bottom chord in all areas where-a rectangle 3-6-0 tall by 2-0-0 wide �- will fit between the bottom chord and any other members. ¢r 8)Refer to girder(s)for truss to truss connections. 9)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift at Joint(s)7, t 10)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT at jt(s)2 This connection is for uplift only and does not consider lateral forces. 11)This truss has been designed for a moving concentrated load of 250-01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads,. 12)Graphical purlin representation does not depict the size or the orientation of the purlin along the top and/or bottom chord, V" �'099�1�� R°�sssioNP July 26,2019 ®WARNING-Verily design parameters,ard READ NOTES DN THIS AND INCLUDED MITEK REFERENCE PACE Mll-7473 rev.1010312015 BEFDRE USE paslpn SM1dldfor Use Witty ailh MiTeYE toilneUO&7fils dmd9r,is im'rind fly upon perarootorr ahowri,and is for an individual building component,not 10 a Was syntem Befold'oo,the builda+ Castgrtnf mirGtwnnf%,the pprillcilbihty,of design parafpdter wid property Incorporate this design into the overall ��'aC txdldliog(!mn Braijififildicated Flo l9roVant hh In atltldwiAslel tiuss web andlor chord members only.Additional temporary and permanent bracing is always required for stability and to prevent collapse"wth possible personal Injury and property damage.For general guidance regarding the fabrication,clorago,delivery,erection and bracing of trusses and truss systems,sae ANSITPIt Quality Criteria,DSB-89 and SCSI Building Component 16023 Swingley Ridge Rd Safety InformnBon available from Truss Plate Institute,218 N.Lee Street,Suite 312,Alexandra,VA 22314. Chesterfield,MO 63077 Job ' ruse Ttuss Type Qty" P(y" `-BUILDING D ROOF VINEYARD VIEW 137938953 3597OR3 34 Roof Special 1'. 1 n Reterence4o tional Universal COlnpanint Corp., -'EAST HAVEN CT 06512 - - 401 0 s,Aug;,1 2017 MiTek Industries,Inc.Thu Jul 2523:16,.21.20,19 Page 1 ID.uH81G9lAM8 WQEtKnavHVN3,uWBg-VncJeRpxTgF3KJ13HCXH3zrQKtTrczxwbBgae0yuNRe 'D'iO4 -'0-11 7.2-14- 1Q-101 _.i_12-2-9 id•512 1078 , 3-7-11 3 7-3 3-7-3 1-4-824:� 4x4 Scale'1/4=1' 4 13 14 ij 12,00 12 1x4 15 12 1x4 // 3 5 16 4x4 = 4x4 = i 2 4f' 18 19 20 - 3x8 IF 1D 9 8 3x8 = 4x4 = 1x4 II 7=z-i S 12-2-9 -14.5-,2- 4.11-112-33 [�_L®L 1 - Plate Of(sats Y-_ LOADING (psf) SPACING- 2-0-0 CSI. DEFL. in (loc) Ildefl LJd PLATESry` GRIP TOLL(roof) 300 Plate Grip DOL 1 15 TC 0.31 Vert(LL) -0.23 2-10 >748 240 MT20 197/144 Snow(Pf/Pg) 38S/50.0 Lumber DOL 1.15 BC 0,68 Vert(CT) -0,29 2-10 >578 180 TCDL 10.0 Rep Stress Incr YES WB 0.30 Horz(CT) 0,01 B We n/a BCLL 0,0 ' EiCOC 10.0 Code I802015[TPI2014 Matr(x-5 Weight 62 Ib FT=20% - _ MBER- - - - ~f - - - BRACING- IP CHORD 2x4 SPF No,2 TOP CHORD Structural wood sheathing directly applied or 5-11-1 cc purlins, .JT CHORD 2x4 SPF No,2 except end verticals,and 2-0-0 cc purlins(6-0-0 max,)-6-7. WEBS 2x3 SPF No,2 BOT CHORD Rigid ceiling directly applied or 10-0-0 cc bracing. WEDGE Left'2x6 SPF Not REACTIONS. (Ib/size) 8=823/Mechanlcai,2=939/0-5-8 Max Horz 2=209(LC 13) Max Uplift 6=-34(LC 14),2=-70(LC 14) FORCES. (lb)-Max.Comp,/Max.Ten,-All forces 250(lb)or less except when shown, TOP CHORD 2-3=-940/119,3-4=-707/159,4-5=-707/143,5-6=-7861108,6-7=603/81,7-8=-7901111 BOT CHORD 2-10=-142/554.9-10=-102/576 WEBS 4-10=-116/475,5-1 0=-2661141,6-9=-613/125,7-9=121/880 NOTES- 1)Unbalanced roof live loads have been considered for this design. 2)Wind:ASCE 7-10,Vult=130mph(3-second gust)Vasd=103mph,TCDL=6,Opsf,BCDL=6:Opsf;h=25ft,B=45ft;L=24ft,eave=4ft;Cat. Il;Exp B;enclosed,MWFRS(directional)and C-C Exterior(2)-0.10-8 to 2-1-8,Interior(1)2-1-8 to 7-2-14,Extenor(2)7-2-14 to 10-2-14,Interior(1)12-2-9 to 14-4-8 zone;cantilever left and right exposed;end vertical left and right exposed;C-C for members and forces&MWFRS for reactions shown;Lumber DOL=1.60 plate grip DOL=1,60 3)TCLL`ASCE 7-10;Pr=30.0 psf(roof live load,Lumber DOL=1,.15 Plate DOL=1.15);Pg=50,0 psf(ground snow);Pf=38.5 psf(flat roof snow:'Lumber DOL=1.15 Plate DOL=1 15);Category II;Exp B.Partially Exp.;Ct=1.1,Lu=50-0-0 4)This truss has been designed for greater of min roof live load of 12,0 psf or 1.00 times flat roof load of 38.5 psf on overhangs non-concurrent with other live loads. QF � 5)Provide adequate drainage to prevent water ponding. - 6),This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads ��(�1jd joly�'0� 7)'This truss has been designed for a live load of 20.Opsf on the bottom chord In all areas where a rectangle 3-6-0 tall by 2-0-0 wide s Q will fit between the bottom chord and any other members.- 6)Refer to-girder(s)for truss to truss connections. 9)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib'uplift atjoint(s)B.' 10) One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT at It(p)2 This connection is for uplift only and does not consider lateral forces- NI W 11),This truss has been designed for a moving concentrated load of 250.Olb'live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads„ �� 12)Graphical purlin representation does not depict the size or the orientation of the pudin along the top and/or bottom chord. QA --099433 July 26,2019 ®WARNING-Verify design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGEMII-7473 rev.10103201S BEFDREUSE 'DUlpn vnitd fcr uuu arylywlU7 fdiTe&t cA+nnette+a?h!u Ceclgll It€baeo4 silty upon pot;zmolatsshgrm,nntl,ie loran Urepvidusl twtdfnq egmpgntlnl.m7[ . �i 1 4ggySByLtqnt."HgIDnSUgq.thngNlPditifldeutgput'muslvprdyrhgnp{i:irulljkityol+ldn(pnprvine,.artrAudl�rul+�i�s'loao+pos@tatlit°s dn�lgn,l�dq,lhua`vesnll- � �V� 'i` Unt4lhip'de pn,arab(npind�nUtU.?stoprnyonllU�ueWbip4h[[Idfvhfuaftrusa'vr6Sandlattl7tir8lgCrrshcrSoNy,Addlll6iwltgmpaalyzlndpcgn+uetmlbrasing € MiTele (naM'syrytugUirgdtoratandly@ndtgpmvanl,colt@psewl07pose+Wnpursoga�in;uryanOp+opn�t/'iinma;,F�snnerMpiddnncireatuclfnlin4 P `f@trkgtllln,@Sgrit7a,ifghVarryy,ur`e�ifan srtul brnl.'iyf g1,11vswtand uuus sy:,tanae,@ae:._ At{S1f1PI/.�[dallly Ctltdda,tFSD%Bs and t3C918ultd(np'Gompanent ( 16023 Swingley Ridge Rd 'sadlyl. o npaa+to Liam 7n+a PI@Sq tn711tut3:°TTa�.LCq SUuat;$Sdt4 37?;Alisrnrid ln:VA?2sta, Chesterfleld,MO 63017 Job- - russ Trus.,Type- Qty pty f3Ull.DING D'ROOF VINEYARD VIEW 1379389541 35970R3 35 RoofSp"Iet, 1 1 -1 __ Jab Reference(oaticiigll' -- Universal Component Corp„ EAST HAVEN-,CT 06512' 8;010 s Aun 11'2017101Tpk Ihdu-61(4s,Inc. Thu Jul 25 23:16 22 2019 Page 1_ ID:uH81G9iAM9_WQEtKnavHVNyuWBg-z_AhrnpZE_NwxTtFgv2WbBNb3Gp1 L044grZ7AEquNRd 7.244- E 10'181_ - '12.10-1 .14-542 U90_•8 3 7-�1 3 7-3` 3-73 ' 2.0-a f 1.7-1'1 Scale'14 4x4 4 13 14 1200 12 \ 1x4 \\ 12 15 1x4 � \ f 16 4x4 r 4x4 11 \\ J t7 7 N �a N - 18 10 19 9 20 8 3x8 II 3x8 4x4 = 1x4 II = -12-10-1- 14•fz�12� ITill I Plate Ofse -D-7, 6: .2-0 .37E - LOADING (psf) SPACING- 2-0-0 CSI. DEFL. in ([cc) Ildefl Ud PLATES GRIP TCLL(roof) 30.0 Plate Grip DOL 1.15 TC 0.31 Vert(LL) -0.23 2-10 >727 240 MT20 1971144 Snow(Pf/Pg) 38 5150 0 Lumber DOL 1.15 BC 0.68 Vart(CT) -0.30 2-10 >572 180 TCDL 10.0 Rep Stress Incr YES WB 0.31 Horz(CT) 0.01 8 n/a n/a BCLL 0,0 ' Code IBC2015/rP12014 Matrix-S Weight.61 Ib FT= 20°1° BCDL 10.0 - - LUMBER- BRACING- TOP CHORD 2x4 SPF No,2 TOP CHORD Structural wood sheathing directly applied or 5-11-1 cc puriins, BOT CHORD 2x4 SPF No.2 except end verticals,and 2-0-0 cc purlins(6-0-0 max.)•6-7. WEBS 2x3 SPF No,2 BOT CHORD Rigid telling directly applied or 10-0-0 cc bracing. WEDGE Left-2x6 SPF No,2 REACTIONS. (Ib/size) 8=823/Mechanical,2=93910-5-8 Max Horz 2=201(LC 13) Max Uplift 8=-33(LC 14),2=-70(LC 14) FORCES. (ib)-Max.CompJMax.Ten.-All forces 250(lb)or less except when shown. TOP CHORD 2-3=-9401119,3-4=-706!158,4-5=-7061144,5-6=8181110,6-7=-609162,7-8=798193 BOT CHORD 2-10=-1131554,9-10=-841572 WEBS 4-10=-1151474,5-10=-259/142.6-9=-6361121,7-9=-107/902 NOTES- 1)Unbalanced roof live loads have been considered for this design. 2)Wind:ASCE 7-10;Vult=130mph(3-second gust)Vasd=103mph;TCDL=6 Opsf;BCDL=6.Opsf;h=25ft,B=45ft;L=24ft;eave=4ft;Cat. II;Exp B;enclosed;MIWFRS(directional)and C-C Exterior(2)-0-10-8 to 2-1-8,Intedor(1)2-1-8 to 7-2-14,Exterior(2)7-2-14 to 10-2-14,interior(1)12-10-1 to 14-4-8 zone;cantilever left and right exposed;end vertical left and right exposed,C-C for members and forces&MWFRS for reactions shown,Lumber DOL=1 60 plate grip DOL=1.60 3)TCLL ASCE 7-10;Pr=30.0 psf(roof live load:Lumber DOL=1,15 Plate DOL=1.15);Pg=50 0 psf(ground snow),Pf=38.5 psf(flat roof snow.Lumber DOL=1.15 Plate DOL=1 15);Category Il;Exp B;Partially Exp.;Ct=1 1,Lu=50-0-0 4)This truss has been designed for greater of min roof live load of 12.0 psf or 1.00 times flat roof load of 38.5 psf on overhangs 0� NSvV non-concurrent with other live loads. V 5)Provide adequate drainage to prevent water ponding. ;0 6)This truss has been designed for a 10,0 psf bottom chord live load nonconcurrent with any other live loads 7)'Tnts truss has been designed for a live load of 20.0psf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide *(�� will fit between the bottom chord and any other members. 8)Referto girder(s)for truss to truss connections. 9)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift at joint(s)6. i• ci. 10)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT at Jt(s)2,This connection Is for uplift only and does not consider lateral forces. .OIb live located at all mid panels and at all panel points along 11)This truss has been designed for a moving concentrated load of 250 the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 12)Graphical purlin representation does not depict the size or the orientation of the purlin along the top and/or bottom chord. ©;p- .'0.99'6' opkss July 26,2019 ®WARNING-Verify design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE MIF-7473 rev.1010312015 BEFORE USE DeSign tal,d far use Only,!h " ln TigS degige jS hnean verify the appildoblity of design properly Incorporate this design into the overall only upon para?i-l-n 8tmi and is for an individual building component,not a tw�®fit russ system.Before use,the liulltig designer must pt3rFltrldlrS+A Acid building design.Bracing indicated is prevent buckling of individual Truss web andlor chord members only.Addltionai temporary and permanent bracing Mira Is always required for stability and to prevent collapse with possible personal injury and property damage_For general guidance regarding the tabtication,aialogo,'delivery,erection and bracing of busses and truss systems,seeANSIRPII QualityCriteria,DSB-89 and SCSI Building component 16023 Swingley Ridge Rd ;Salotylnformotlon,available from Truss Plate Institute,218 N Lee Street,Suite 312,Alexandna,VA 22314, Chesterfield,MO 63017 Jab - - toss -— - i Trust Type -- - - Qty` ;pty IPPILDING D ROOF VINEYARD VIEW137938955 i85970R3 36 Rcol'Special .fofi Reference'(qotlonall,, - Universal'C0tnpon6ritCorp., EAST HAVEN-CT0155212;- - _ - '8.010 s Aug 112017 MITek Industries,rnc.'Thu JN 25 23.1623 2019 Pagel— )D.uH8)G9fAM9_WQEtKnavHVNyuWB9-RAk337gB?IVnZdSROdaIBC; rr mg8G4SOD3VJh/gyuNRc 0.1 3.7=,11 _ _ 7-2-14 r 1�ILr1 AT-5.0 14-5=1 (h R, gI-m, - T 3-7-3 r�373 -= } Z7;8.� � 4x4 Scale=1.49,9 4 t � 13 J \\1,4 12.00 12 1x4 12 s-15 1x4 ;1 3L 5 . 16 4x4 = 11- 4x4 = 2 3x8 II 18 10 19 9 20 8 3x8 = 1x4 II 4x4 = 7-2-14= Plata offsets ix,Y)= -- LOADING (psf) SPACING- 2-0-0 CSI, 6EFL. in (loc) Well L/d i PLATES GRIP TCLL(rcof) 30.0 Plate Grip DOL 1.15 TC 0.31 Vert(LL) -0.24 2-10 >712 240 MT20 197/144 Snow(Pf/Pg) 38,5/50.0 Lumber DOL 1.15 BC 0.68 Vert(CT) -0.30 2-10 >566, 180 TCDL 10.0 Rep Stress incr YES WS 0.33 Horz(CT) 0,01 8 n/a n/a BCDL 0.0 BCDL 100 Code IBC2015/TP12014 Matrix-S Weight:59 lb FT 20% IMBER- — ---- -• _ - BRACING- )P CHORD 2x4 SPF No.2 TOP CHORD Structural wood sheathing dtreetly applied or 5-11-1 ee purlins, .JT CHORD 2x4 SPF Not except end verticals,and 2-0-0 cc purlins(6-0-0 max) 6-7 WEBS 2x3 SPF No.2 BOT CHORD Rlgld ceiling directly applied or 10-0-0 cc bracing. WEDGE Left.2x6 SPF No.2 REACTIONS. (Ib/size) 8=823/Mechanical,2=939/0-5-8 Max Horz 2=193(LC 13) Max Uplift 8=33(LC 14),2=71(LC 14) FORCES. (lb)-Max CompJMax.Ten,-All forces 250(lb)or less except when shown. TOP CHORD 2-3=-940/117,3-4=708/156,4-5=-7041149.5-6=-8551115,6-7=-627/47,7-8=-828/66 BOT CHORD 2-10=-83/555,9-10=-63/571 WEBS 4-10=-1131471,5-10=-255/144,6-9=-6701127,7-9=-92/957 NOTES- 1)Unbalanced roof live loads have been considered forihis design. 2)Wind:ASCE 7-10:Vult=130mph(3-second gust)Vasd=103mph;TCDL=6Jlpsf;BCDL=6-Opsf,h=25ft;B=45ft;L=24ft;eave=oft;Cat. II;Exp B;enclosed;MWFRS(directional)and C-C Exterior(2)-0-10-8 to 2-1-8,Interlor(1)2-1-8 to 7-2-14,Exterior(2)7-2-14 to 10-2-14,Intenor(1)13-5-9 to 14-4-8 zone;cantilever left and right exposed;end vertical left and right exposed;C-C for members and forces&MWFRS for reactions shown,Lumber DOL=1 60 plate grip DOL--1,60 3)TCLL:ASCE 7-10,Pr=30 0 psf(roof live load-Lumber DOL=1.15 Plate DOL=1.15),Pg=50 0 psf(ground snow);Pf=38,5 psf(flat roofsnow-Lumber DOL=1.15 Plate DOL=1.15);Category II,Exp B;Partially Exp.;Ct=1 1,Lu=50-0-0 4)This truss has been designed for greater of min roof live load of 12 0 psf or 1 00 times flat roof load of 38.5 psf on overhangs non-concurrent with other live loads,, -01F N.EF 5)Provide adequate drainage to prEwPnt water ponding. -- 6)This truss has been designed for a 10,0 psf bottom chord live load nonconcurrent with any other live loads. �� -�1)1( J% 'Q 7)'This truss has been designed for a live load of 20 Opsf on the bottom chord In all areas where a rectangle 3-6-0 tall by 2-0-0 wide will fit between the bottom chord and any other members. ��4' , mak-• 0 8)Refer to girder(s)for truss to truss connections. 9)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift atfolnt(s)8, l 1 a 10)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT at)t(s)2.This connection is for uplift only and does not consider lateral forces. Uj 11)This truss has been designed-for a moving concentrated load of 250,01b live located at all mid panels and at all panel points along ' �+ the Top Chord and Bottom Chord,nonconcurrent with any other live loads. a` 12)Graphical puriin representation does not depict the size or the orientation of the purlln along the top and/or bottom chord. <�4p•-O.099A�a ' g��ESStiO�P July 26;2019 A WARNING-Verify design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE Mll-473 rev,1010312015 BEFORE USE Oe1lpnVstfd Idi Lao nhty,WlRr'rSlTokO"2oapeawrc Tids"da'slan l bOad gglyupon paran:eivat shown,all 0is fm an Indiv_iduat bundlrrp componvniA not n trsassyl tvnr:6atam u;v.lhn nutld ng tlbviprivrrntlt tvetfiv the nppligCzltity:vf dnasjn p unmatansluid titopsfly lhoa+pcoSts tlu":pt7lpn into the OWN- Ealid(ng drslgn=0rachi2Tndlsnt;d is to woven'bocsQng of dwfdU6 "o" o atrvtrotltpore3mrd mamborsoni�/utdlponni tQmparray and p9rrnadenl hr�in0, d� it 6'twnypr0quitndfa2vt{vfliylyagd,tnprvv0nfiatlapgpvnthpo5balpurc0nptinryyimd,Dtapartjdirrn .PertloNkmlprildnnxregnhfn"g0igs _ fstxt�a0svt,situ„Oo_ddlSyv+V,emGl4n nlib brhdte0,of uu sns nfW Truss ayutdnie,aae AtiSf/iPl1 giidllty trrttet♦b,D86t•SA;and t3CS19o11ding Component f 16023 Swingley Ridge Rd sdfatylnfonnnuon Qualls nflcntTmsc Qlatedris4 Wte,Ziff N;lce Sguvt Suuo 312.Al lin idfla;OF 2?�'14, Chesterfield,MO 63017 Job 1 runs TrussType {Qty ;Ply BUILDING D ROOF VINEYARD VIEW 137938956' �5970R3 7 Roof-soeclal, li -_1 ob_Reference-o tional Universal Component Ca)ry.,' ERST HAVEN CT 06512 8.010 s Aug 11 2017 MiTek Industries,Inc. Thu Jul 2523:']6 25 28 t0'Pagu'1 ID.uHBIG9iAM9_WQEtKnavHVNyuW Bg-NZrpUosRXvmVowbgW2cDDp26NUgbYPvW WoonnZyu(JRa -f0 37-11 7.2-14 10-7-15 A4.1-1 1a15)2 10= - 3-7� 1 3•b:1 l 35-1, 0 •a' Scale=1 44 14 13� 12.00 12 \ 15 4x4 O 1x4 \ 12 5 3 16 �4 • 10x10 — �6�T 3x8"II 17 10 16 g 8 3x8 = 14-1.1 l '7-2-14- 6-103 - PIS10,011sets(X'Y) f2'Edae tl=tJ 71 L8M-4-8 g-2-121 — LOADING (psf) SPACING- 2-0-0 CSI, DEFL. in (loc) I/dell Ud PLATES GRIP TCLL(roof) 30.0 Plate Grip DOL 1.15 TC 0.30 Vert(LL) -0,24 2-10 >695 240 MT20 1971144 Snow(Pf/Pg) 38.5/50 0 Lumber DOL 1-15 BC 0.69 Vert(CT) -0 31 2-10 >555 180 TCDL 100 Rep Stress Incr YES WB 0.10 Horz(CT) 0.01 8 n/a n/a BCLL 0.0 Code IBC20151TP12014 Matrix-S Weight 20% 58Ib FT= BCpL 10',0 - - -- - LUMBER- BRACING- TOP CHORD 2x4 SPF No.2'Except` TOP CHORD Structural wood sheathing directly applied or 5-11-3 cc purlins, 6-7.2x4 SPF 2100F 1 BE except end verticals,and 2-0-0 cc purlins(6-0-0 max.).6-7, BOT CHORD 2x4 SPF No.2 BOT CHORD Rigid ceiling directly applied or 10-0-0 cc bracing. WEBS 2x3 SPF No.2'Except' 7-8 2x4 SPF 210OF 1 BE,6-9.2x4 SPF No.2 WEDGE Left 2x6 SPF No,2 REACTIONS. (Ib/size) 8=821/Mechanical,2=93610-5-8 Max Horz 2=185(LC 13) Max Uplift 8=-32(LC 14),2=-71(LC 14) FORCES. (lb)-Max,Comp/Max.Ten.-All forces 250(lb)or less except when shown. TOP CHORD 2-3=9351116,34=-7021155,4-5-6921155,5-6=-9041116,6-7=-660147,7-8=-77110 BOT CHORD 2-10=-521553,9-10=-34/569,8-9=-64/563 WEBS 4-10=-1181476,5-10=-2551148,6-9=-771507 NOTES- 1)Unbalanced roof live loads have been considered for this design- 2)Wind'ASCE 7-10;Vult=130mph(3-second gust)Vasd=103mph,TCDL=6.Opsf;BCDL=6,Opsf;h=25ft,B=45ft;L=24ft,eave=4ft;Cat, II;Exp B,enclosed;MWFRS(directional)and C-C Exterior(2)-0-10-B to 2-1-8,Interior(1)2-1-8 to 7-2-14,Exterior(2)7-2-14 to 10-2-14 zone,cantilever left and right exposed,end vertical left and right exposed;C-C for members and forces&MWFRS for reactions shown,Lumber DOL=1 60 plate grip DOL=1.60 3)TCLL.ASCE 7-10,Pr=30 0 psf(roof live load Lumber DOL=1,15 Plate DOL=1,15);Pg=50.0 psf(ground snow);Pf=38 5 psf(flat roof snow*Lumber DOL=1.15 Plate DOL=1.15);Category II;Exp B;Partially Exp,;CI-71.1,Lu=50-0-0 G of NC1/I/ 4)This truss has been designed for greater of min roof live load of 12,0 psf or 1 00 times flat roof load of 38.5 psf on overhangs i r .. �O non-concurrent with other live loads. ��h!� 5)Provide adequate drainage to prevent water ponding. c1Qw (� 6)This truss has been designed for a 10.0 psf bottom chord live load non concurrent with any other live loads * �- �f 7)'This truss has been designed for a live load of 20 Opsf on the bottom chord In all areas where a rectangle 3-6-0 tall by 2-0-0 wide } CC' will fit between the bottom chord and any other members. 1 I 8)Refer to girder(s)for truss to truss connections. r >•,/ LU 9)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift atloint(s)B. 10)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT at it(s)2.This connection is for uplift only and does not consider lateral forces. Q �O,0 32" 11)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along A �� the Top Chord and Bottom Chord,nonconcurrent with any other live loads. R�F�S$IO�P- 12) Graphical purlin representation does not depict the size or the orientation of the purlin along the top and/or bottom chord. I July 26,2019 ®WARNING-Venry design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PA GE Mri-7473 rev.10/03/2015 SEPDRE USE.,Llasign voildfor use onlywlh MiTek©cngnnctors.Th's doon is ttascd only upon pnmmetomsiwrvn.unit is tot0rtindiuiilual hulldln}t canronfinL tlal 2<trUs:r plhin Before wa fha butldmg,ikt arvr rntt*.1 t"tttflylhe,tipplicobday of deplggparLntnlua DW PrIOV'iy I!I6T013t0 thiy d ir'10'"ll Iht'v4nnr fl hulldlnp dn�bn Bracing indicated is to pfavnnt'buekfing'af individual truss web andlor Chord nlerabtusmnly,Addiilefinl tomporaryanrl porm mvnl:btaclnp M ffdk, is always required for stability and to prevent collapse with possible personal infur7 and prispertY domaga Fru oqural g'urdanca rugmdln0 Rio fabrication,storage,delivery,erection and bracing of trusses and truss systems,tell Ati&Ifrprh4pgl�t}r C+lSerin,�D58SiB aifd tdG51,Bu11ding Component Chest Sind.M Ridge Rd Safety Information available from Truss Plate Institute,218 N Lee Street,Suite 312,Alexandria,VA 22314. p®Chesterfield,MO 63017 aob - russ^- "? �russ Type "' - `- '- = Qty p(y---'BUILDING D-ROOF-VINEYARD VIEW 137936957``' 35970R3 T38 Common 3 1 �i -_ _ Job n/ Reference o lio . --- Universal CSm_potlent Corp.;- EAST HAVEN`CT 06512 - — '- — -= '•8.010 s,A6g i,i;2017'M7ek Industnes,Inc,Thu Jul 25-23:16: 7 2019'Pa®tis'1 ID:tIH8I0yf Mg_WdEtlinaV[t)/6lyuNlB0i[GcidvUtN31N0D2EICdSeIiIE4NKHVPOBopz6HusSyuNRY 10 :G10-11 11.513 i 17-'1 U 22-8-2 - r -- =283 4 -33-1 39 10 7__ _, 3�3 5 90 C J7�1—_�46 2-121 / 0 '�5=10=11' I -'033 =517.3 f. - S.i :- 5.7-g r 57�-6-7-3 I -• __510-11 010• Scale=1,76A 3.75 12 5x6 r 28 3x8 6 27 _ _ "`+a 8 3x8 265 - 9 29 6x12 4 I 10 1 f .,. 300 25 30 6x12 3x10 75; 3 „�-1" ✓ I - 115x12 MT18H zzz 23 24 i I . ._ 31 32 13 12 6x12 = 33 22 34 21 35 20 19 36 18 37 17 16 38 15 39 14 40 6xt2 = 2x4 It 5x12 MT18H= 5x8 = 5x12 MT18H = 2x4 11 t 5 10-11 -- _ 11•§-13'- �. 17-1-0 22.02 , y28 3 33-10-71 ., �4 5 7Q 45!}-4.,_ ----_ 5-11341 -- 5 — 57 3 7.g' -- 57-3. 5'7-3'- -7-3 Pale Offsets_[X;Y}» - LOADING (psf) _SPACING- 2-0.0 CSI: DEFL. in (loc) I/deft L/d PLATES GRIP TCLL(roof) 30.0 1 Plate Grip DOL 1.15 { TC 0,60 Vert(LL) -0.62 18-19 >871 240 MT20 197/144 TCDL Snow( /Pg) 38.5/50.6 �` Lumber DOL 1.15 BC' 0,73 Vert(CT) -0.96 18-19 >567 180 MT18H 197/144 BCLL O p I Rep Stress Incr YES WB 0,85 Horz(CT) 0.34 12 n/a n/a Bent__ �010 1 Code IBC2015ITP12014 ' Matrix-S - Weight-200 lb FT=20% IMBER- ._-- ~ ---- v .. -- - - -- - BRACING- )P CHORD 2x4 SPF 2100F 1.8E TOP CHORD Structural wood sheathing directly applied or 2-6-11 ob purlins. _JT CHORD 2x4 SPF 2100F 1 BE BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing. WEBS 2x4 SPF No.2 WEBS 1 Row at midpt 8_18.6-18 SLIDER Left 2x4 SPF No.2 6-0-5,Right 2x4 SPF Not 6-0-5 REACTIONS. (Ib/size) 2=273810-5-8,12=2738/0-5-8 Max Horz 2=77(LC 14) Max Uplift 2=-137(LC 16),12=-137(LC 16) FORCES. (lb)-Max,Comp./Max,Tenq-All forces 250(lb)or less except when shown, TOP CHORD 2-3=-6779/434,3-4=6213/438,4-6=-5342/419,6-7=4357/392,7-8=-4357/392, 8-10=-5342/419,10-11=-6213/438,11-12=-6779/434 BOT CHORD 2-22=-36316291,21-22=-363/6291,19-21=-31615858,18-19=-249/5022,17-18=-245(5022, 15-17=-311/5858,14-15=-36016291,12-14=-360/6291 WEBS 7-18=-105/2042,8-18=-16781127,8-17=01716,10-17=-1064186,10-15=01404, 11-15=-493/53,11-14=0/360,6-18=-1676/127,6-19=0/'716,4-19=-1064186,4-21=0/404, 3-21=-493/53,3-22=0/360 NOTES- 1)Unbalanced roof live loads have been considered for this design. 2)Wind,ASCE 7-10;Vuit=130mph(3-second gust)Vasd=103mph;TCDL=6.Opsf;BCDL=6,Opsf;h=25ft;B=45ft;L=24ft;eave=6ft;Cat II;Exp B;enclosed;MWFRS(directional)and C-C Exterior(2)-0-10.8 to 2-1-8,Interior(1)2-1-8 to 22-8-2,Exterior(2)22-8-2 to 25-8-2 zone;cantilever left and right exposed:end vertical left and,right exposed;C-C for members and forces&MWFRS for reactions shown;Lumber DOL=1.60 plate grip DOL=1 60 3)TCLL:ASCE 7-10;Pr=30.0 psf(roof five load-Lumber DOL=1.15 Plate DOL^=1.15);Pg=50.0 psf(ground snow);Pf=38.5 psf(Rat IF, roof snow:;Lumber DOL=1.15 Plate DOI=1 15);Category II;Exp B,Partially Ezp;Ct=1,1 • 4)Unbalanced snow loads have been considered for this design.. 5)This truss has been designed for greater of min roof live load of 12.0 psf or 1.00 times flat roof load of 38.5 psf on overhangs non-concurrent with other live loads. 6)All plates are MT20 plates unless otherwise indicated. *- 'S� •, 7)All plates are 3x6 MT20 unless otherwise indicated,, 8)This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads-, 9)'This truss has been designed for a live load of 20.Opsf on the bottom chord In all areas where a rectangle 3-6-0 tall by 2-0-0 wide will fit between the bottom chord and any other members., 10)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT at Jt(s)2 and 12,This connection is for ,%�' '�• uplift only and does not consider lateral forces:, `O-09840 -ljj 1)This truss has been designed for a moving concentrated load of 250,01b live located at ail mid panels and at all panel points along A 4 the Top Chord and Bottom Chord,nonconcurrent with any other live loads. TQF�$$10 July 26,2019 4 AWARNING-Verify design parameters and READ NOTES ON THIS AND INCLUDED MiTEK REFERENCE PA GE 111II.7473 rev 1010312015 BEFORE USE i 1 [)`ssfj�rval41[o+uaaa+iy:,�ylihf�ii[c1�,7"rnruinclDo.th;ad�signlhbnaodatily;udou'pemiruteru�hawn;dnuta"tarnnl'ndlviCuathudntn®wippana(,L'nati I• �, �` E "ahaayRy�9pi,I3ot�t�u;U58:dhn6u11bin91iDdC0iypr�u�YrriifgticOappllC4bi[ityoldosrytn"all'rnniotc/cartdi?tGiae+°7wci�pc+a9r�thtea(uhiflrr"intOthD:VWfc11i= r i� CulldlnpdcslOrL,Or0ln0fndlcttidfntaCtoJr+}lhuckdnpat htidualuusdtvcli'wctlror'.rha<dmbindarionly-,hddiltnnallDtnhor0ry'dndFotmbn0olbmttOg+ I 'Tek I ' ,Isbtwaytl're��liDdfbr9labirliytyandiobiDmnicpifopan+Ned!tmu�hJa'riotaenPllnNrymuf,proFQtrydnme86,Forpenomt,OUidnncD�rBnruri>aUf_ - = , 54 fo[�(foim tfan'nvallablo from T Pini(nn �$118 N Lfen 5r j:rSdiia 312-/U9 cQnd n yA i2,"3 OUty,6tlterTn Ds6 8g and©CBi Building Component - Chesterfield,MO 630Rd 1 li job rusB - Truss Type Oty P,y BUILDING D ROOF VINEYARD VIEW 137938958 35970R3 01 Valley 2 1 _ Job Reference(optional)- Universal Component Corp., _ EAST HAVEN'CT 06512• 8.010 s Aug 112017 MITek Industries,Inc.Thu Ji11252-316:2820,19 Page 1 ID uH81G91AM9_WOEtKnavHVNyuWBg-oBXy6quKgg84fOKPBA9wr5dachw6lmcy(mOSOuyuNRX 5.4.6- 34.6 Scale=1 5x6 II 2 Al '\ \ 12,00 12 � q 8_ 7 9 6, 10 5 3 c `.it;:...:-.,....•.i."• •�' -z�:��-'r..r•.r'n„_. - ia-rye .::..w:,,.=,.�i,+`.o`s ......+ •;A._. .et—'G o 4x4 4 12 4x4 1x4 II 0.04' LOADING (psf) SPACING- 2-0-0 CSI. DEFL. in (loc) Ildefl Ud PLATES GRIP TCLL(roof) 300 Plate Grip DOL 1 15 TC 0.48 Vert(LL) n/a n/a 999 MT20 1971144 Snow(Pf/Pg) 38.5150.0 Lumber DOL 1 15 BC 0.45 Vert(CT) n/a n/a 999 TCDL 10,0 Rep Stress Incr YES WS 0,18 Horz(CT) 000 3 n/a We BCLL 0.0 ' Code IBC2015ITP12014 Matrix-S Weight,32 lb FT 20% ,BCDL LUMBER- BRACING- LUMBER- 2x4 SPF No.2 TOP CHORD Structural wood sheathing directly applied or 6-0-0 oc purlins, TOPBOT CHORD 2x4 SPF No.2 BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing. OTHERS 2x3 SPF No.2 REACTIONS. (ib/size) 1=356110-e-4,3=356110-5-4,4=462/10-8-4 Max Horz 1=-113(LC 12) Max Uplift 1=-33(LC 14),3=-33(LC 14) FORCES. (lb)-Max CompJMax Ten.-All forces 250(lb)or less except when shown. TOP CHORD 1-2=-320184,2-3=-320184 WEBS 2.4=-292/49 NOTES- 1)Unbalanced roof live loads have been considered for this design. 2)Wind'ASCE 7-10;VuIt=130mph(3-second gust)Vasd=103mph;TCDL=6.Opsf;BCDL=6 Opsf;h=25ft;B=45ft,L=24ft;eave=4ft;Cat. ll;Exp B;enclosed,MWFRS(directional)and C-C Exterior(2)0-4-4 to 3-4-4,Interior(1)3-4-4 to 54-6,Extenor(2)5-4-6 to B-4-6 zone;cantilever left and right exposed;end vertical left and right exposed;C-C for members and forces&MWFRS for reactions shown,Lumber DOL=1.60 plate grip DOL=1 60 3)TOLL.ASCE 7-10;Pr=80 0 psf(roof live load'Lumber DOL=1.15 Plate DOL=1.15);Pg=50 0 psf(ground snow),Pf=38.5 psf(flat roof snow.Lumber DOL--1 15 Plate DOL=1.15),Category ll;Exp B,Partially Exp.,Ct=1,1 r 4)Gable requires continuous bottom chord bearing. 5)This truss has been designed for a 10.0 psf bottom chord live load nonconcun-ent with any other live loads 6)'This truss has been designed for a live load of 20.Opsf on the bottom chard In all areas where a rectangle 3-6-0 tall by 2-0-0 wide will fit between the bottom chord and any other members, 7)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 ib uplift at joint(s)1,3 8)This truss has been designed for a moving concentrated load of 250.0Ib live located at all mid panels and at all panel points along OF N E, the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 11 t w A��fiES510`SP�' July 26,2019 ®WARNING-Verify design parameters and READ NOTES ON THIS AND INCLUOED MITEK REFERENCE PAGE M11.7473 rev.10/03/2015 BEFORE USE 1 � i tYbs!{{n vrlld ldruse atdy thin Mi7ek2 ecrt t cr Tis d.«-0-Is based Only uperi p5mttw{erS sr r+fi,nn{i is loran IOdlvisb+nl Wong{pn r 9ROnl,n41 fllnr3ftnyrlsml Bafoto t7str.ilia bulH{i(10 dclli{{nrif mart vrmlythe applicability of dnsign�pr,ramttitni mul ilropcllylnsarCar;ltn Rika danlgq 4Sp,tifu a1Lrall y �Y tv lddntp d:slgn,Bracloti ltldicated lt'lo'pinuenl buePft p of individual truss web nrhWpr chord rtinnibem qtly.Addlilanal l0m{s9tarypndgomtonOnl iSmt{n0 { ITek' is alwaystequired for stability and to prevent collapse w1h possible personal injury and proparty dmm�,31 For ty crit Oio,osi 1-89 find di scsl•' fabncabon,storage,de11v4rD',erection and bracing or trusses and truss systems,s oe dN31frP{t qunllry Cdt4dar�SB•8s and 9C81 aullfing Component Chest SwmgM Ridge Rd Safety Information n+roll I e from Truss Plate Institute,218 N Lee Street,Suite 312,Alexandria,VA 22314 `-Chesler0eld,MO 63017 Job W TrlJss __._-TTrT"e '— -- Q YP ty`-�- PIY BUIL'DINGD ROOF 1lINEYARDVI!*W, !, 137938959' 3597OR3 V02 Valley 2 1 Job Reference o (!ontil Universal Component Corp_, EAST HAVEN CT 06512 -- — _ 8.010 s Aug 11 2017 MITek Industdps,'Ino;1714 Jul 25 23'16;29 2019 Pagel tDuH8IG37A�79 `rrQE;KnavHVR�yiJl;43g-GK5KJAvybBGxHYv5;tg90!An15!QUFy6RQm?wKyuNRW 346 6.8-121 34-6 346 Scale,1/2'=1' 44 2 12,00 1z H 6 5 •O 2x4 7 1x4 11 8 2x4 \\ 00.4 6-8-1� LOADING (psf) ' SPACING- 2-0-0 CSI. DEFL. in (loc) Well L/d PLATES GRIP TCLL(roof) 30.0 Plate Grip DOL 1 15 ! TC 0,33 Vert(LL) n/a fila 999 MT20 197/144 Snow(Pf/Pg) 38.5150 0 Lumber DOL 1.15 BC 0.25 VertCT nla - n/a 999 TCDL 10,0 Rep Stress Incr YES WB 0.04 Horz(CT) 0.00 3 n/a fila BCLL 0.0 ' Code IBC2015rTP12014 Matrlk'-S Weight.20 Ib FT=200% LUMBER- -- BRACING- ?P CHORD 2x4 SPF No,2 TOP CHORD Structural wood sheathing directly applied or 6-0-0 oc purlins. -)T CHORD 2x4 SPF No,2 BOT CHORD Rigid ceiling directly applied or 10-0-0 or,bracing —6 rHERS 2x3 SPF No 2 REACTIONS. (Ib/size) 1=230/6-8-4,3=230/6-B-4,4=24416-8-4 Max Horz 1-68(LC 12) Max Uplift 1=-29(LC 14),3=-29(LC 14) Max Grav 1=315(LC 33),3=315(LC 35),4=360(LC 38) FORCES. (lb)-Max Comp./Max.Ten.-All forces 250(lb)or less except when shown. NOTES- 1)Unbalanced roof live loads have been considered for this design. 2)Wind ASCE 7-10,Vult=130mph(3-second gust)Vasd=103mph;TCDL=6.Opsf;BCDL=6.Opsf;h=25ft;B=45ft,L=24ft;eave=oft,Cat 11;Exp B;enclosed,MWFRS(directional)and C-C Extenor(2)zone;cantilever left and right exposed;end vertical left and right exposed;C-C for members and forces&MWFRS,for reactions shown,Lumber DOL=1.60 plate grip DOL=1,.60 3)TOLL,ASCE 7-10;Pr=30.0 psf(roof live load,Lumber DOL=1.15 Plate DOL=1.15),Pg=50.0 psf(ground snow),Pf=38 5 psf(flat roofsnow,Lumber DOL=1 15 Plate DOL=1.15),Category 11;Exp B;Partially Exp.,Ct=1 A 4)Gable requires continuous bottom chord bearing, 5)This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads. 6)'This truss has been designed for a live load of 20.0psf on the bottom chord In all areas where a rectangle 3-6-0 tall by 2-0-0 wide will fit between the bottom chord and any other members. 7)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift at/oint(s)1,3. 8)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads DF al J�yV(P -0 . '0, m• ,[ 'r ' LJ N . O �.. dA -Ogg Ss -�P�:. " July 26,2019 ®WARNING-Verify design parameters and READ NOTES ON THIS AND INCLUDED MrrElr REFERENCE PAGE M11.7473 rev.10/03/2015 BEFORE USE Oes10!i viilld for use airy Wth MiTeM connWas,Thk dbslgn is iaisOd only upon pwkimalurs shorn and is for N)individual building wnq)nMNq;not, ,iilyd�cyatijm aerornul%n,thq'ouitOtrypdct5igrtgrillliar;v¢6fythaapplEgobilityo6dearr�r{parnmvlornond�topsdytnrmpvtdlrrrlfSadnsi{1ryfnWitlrHuvirOU - �" LU11tIilgdAzgn BraJrgindicnredfbloprevnsd'buck4h{joFlhdiv,duarirusswabaridlorctiaedtnvinlardw,fy:AddlOorlartpmporaty`endparmiidntbrachtll -Mitek' ,s always required for stability arid'to prevent collapse with possible personal injury rmd linipaity,dnrnope;FAcpftnnrgl Qv(tiantl,rea8ri)ipg{I)a fabrication,dtnt6ataO;daiivo++,erection and bracing of trusses and truss systems,sr3n r ANSIfTPiTgvagly,Gi[t`etlp;OSti•00 end BC9t Hulldin®Component 16023 Swfn0ley Ridge Rd Safety InforRon Avaj!a fe from Truss Plate Institute,218 N Lee Street,Suite 312,Nexandna,VA 22314:'' Chester leld,MO 63017 Job Truss Truss Tyfie sty Ply BUILDING D ROOF VINEYARD VIEW 137938960 35970R3 V03 Via loy 2 1 .�Ob'i�elet3h1Cf'(0 bonalt - 11niy,6raal CornpDgerlt Corp„ EAST HAVEN CT 06512 8,010 s Auy 13 2017 MITek Industnes,-Inc:'Thu Jul-25 23:16'302019 Pagel I D.uH81G9tAM9_WDEtKnavHVNyuWBg-kWfiXWwaMROovhUnlbCOwtt7ZVeW DitFg4VYSmyuNRV 1.4-6 2.8.12 j — 1-4-6 Scale= 44 2 12,00 12 4 3 6 2x4 ✓i 2x4 Plate Offsets(X,Y)— LOADING (psf) DEFL. in (Ioc I/deft L/d PLATES GRIP TCLL(roof) 30.0 SPACING- 2-0-0 CSI. ) 0 Plate Grip DOL 1.15 TC 0,06 Vert(LL) n/a n/a 999 MT20 197/144 Snow(Pf/Pg) 38 5/50, TCDL 100 Lumber DOL 1.15 BC 019 Vert(CT) n/a n/a 999 Rep Stress Incr YES WB 0.00 Horz(CT) 000 3 n/a n/a BCBCL LL 10_0L 0.0 Weight 6 Ib FT=20%Code IBC2015ITP12014 Matrix-S LUMBER- BRACING- TOP CHORD 2x4 SPF No 2 TOP CHORD Structural wood sheathing directly applied or 2-8-12 cc purlins. BOT CHORD 2x4 SPF No.2 BOT CHORD Rigid telling directly applied or 10-0-0 cc bracing REACTIONS. (Ib/size) 1=118/2-8-4,3=118/2-8-4 Max Horz 1=-23(LC 12) Max Uplift 1=-5(LC 14),3=-5(LC 14) Max Grav 1=291(LC 33),3=291(LC 35) FORCES. (lb)-Max.Comp/Max.Ten -All forces 250(lb)or less except when shown. NOTES- 1)Unbalanced roof live loads have been considered for this design. 2)Wind'ASCE 7-10,Vult=130mph(3-second gust)Vasd=103mph,TCDL=6 Opsf,BCDL=6 Opsf,h=25ft,B=45ft;L=24ft;eave=oft;Cat. 11,Exp B,enclosed,MWFRS(directional)and C-C Exterior(2)zone;cantilever left and right exposed;end vertical lett and right exposed:C-C for members and forces&MWFRS for reactions shown,Lumber DOL=1 60 plate gnp DOL=1 60 3)TCLL'ASCE 7-10,Pr-30.0 psf(roof live load:Lumber DOL=1.15 Plate DOL=1.15);Pg=50.0 psf(ground snow);Pf=38.5 psf(flat roof snow:Lumber DOL=1.15 Plate DOL=1 15):Category 11,Exp B,Partially Exp.;Ct=1,1 4)Gable requires continuous bottom chord bearing, 5)This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads, 6)`This truss has been designed for a live load of 20.Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide will fit between the bottom chord and any other members. 7)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 1001b uplift at joint(s)1,3. 8)This truss has been designed for a moving concentrated load of 250,0Ib live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. pF NE1��, co _ r r y u-1 499433" ti �q�fi�S g10N� July 26,2019 15 BEFORE USE ®WARNING-Verify design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE hill-7473 rev.10/03/20 Oeslgnvabd,forusngnfynllh?1Tnt capnucjosTlcda&Ipntobasedan(yuponpararnatersahaom.anJK1txanInrllv�galbidlilblgcomkonenl,not a1rua 4yhI111j1Belbleuso,`UI4+XuUdtnBdag1gf10,mU6l,v6tIlVUioBp0ll6b1t1tyofdesignpntiimptoranntlptopartgIndopurJltrINt�da3tgnquotheCwe211 b»Tding dosi9n Bme ng lhd aatad iz lopravenl lSickgng of(r ditidunlf us veb andlor Chntd rnnmhurs nnSj F+uIHla Gil to rp rary and pt+fpi q'Wil bracing MOO( hs alvrsys f0 yui ed f a s1NWINy sial lop uuoiil ea16 sse vq)l+noutUv pwnurol injury and property damage.For general guldance regarding the INWF.cuon,storage",idativdr¢,erection and bracing of trusses and truss systems+spa ANSIRPII Quality Cptlotia,OSB-fie and BCSI Building Component 16023 Swingley Ridge Rd Sntaty,informetlon .Alar to from Truss Plate Institute,218 N Lee Street,Suite 312,Alexandria,VA 22314. chesterfield,MO 63017 y Hili Symbols Numbering System A General Safety Notes PLATE LOCATION AND ORIENTATION 6-4-8 dimensions shown in ft-in-sixteenths Failure to Follow Could Cause Property Center plate on joint unless x,y P Y offsets are indicated. (Drawings not to scale) Damage or Personal Injury Dimensions are in ft-in-sixteenths. Apply plates to both sides of truss 1 2 3 1. Additional stability bracing for truss system,e.g i and fully embed teeth. TOP CHORDS diagonal or X-bracing,is always required. See SCSI. Cut '`-" c2.3 2 Truss bracing must be designed by an engineer.For o- 16 4 wide truss spacing,individual lateral braces themselves S ^WEBS: _ may require bracing,or alternative Tor I bracing should be considered. 3. Never exceed the design loading shown and never Ustack materials on inadequately braced trusses, i . �- '0 4. Provide copies of this truss design to the building For 4 X 2 orientation,locate DS C5� H designer,erection supervisor,property owner and plates 0- tiid'from outside BOTTOM CHORDS all other interested parties. edge of truss. 8 7 6 5 5. Cut members to bear tightly against each other., ! 6, Place plates on each face of truss at each I This symbol indicates the JOINTS ARE GENERALLY NUMBERED/LETTERED CLOCKWISE joint and embed fully:Knots and wane at joint required direction of slots In AROUND THE TRUSS STARTING AT THE JOINT FARTHEST TO locations are regulated byANSI/TPI 1. connector plates, THE LEFT. 7, Design assumes trusses will be suitably protected from CHORDS AND WEBS ARE IDENTIFIED BY-END JOINT the environment in accord with ANSI/TPI 1. Plate location details available in MiTek 20120 NUMBERS/LETTERS. software or upoi request. 8. Unless otherwise noted,moisture content of lumber shall not exceed 19%at time of fabncabon. PLATE SIZE PRODUCT CODE APPROVALS 9 Unless expressly noted;this design is not applicable for use with fire retardant,preservative treated,or green lumber. ICC-ES Reports: The first dimension is the plate 10,Camber is a non-structural consideration and is the 4 X 4 width measured perpendicular ESR-1311,ESR-1352,ESR1988 responsibility of truss fabricator,General practice is to to slots.Second dimension is ER-3907, ESR-2362,ESR-1397, ESR-3282 camber for dead load deflection. the length parallel to slots. 11 Plate type,size,orientation and location dimensions indicated are minimum plating requirements. i LATERAL BRACING LOCATION ` 12,Lumber used shall be of the species and size,and in all respects,equal to or better than that Indicated by symbol shown and/or Trusses are designed for wind loads in the plane of the specified. byytext in the bracing section of the truss Unless otherwise Shown. 13,Top chords must be sheathed or purlins provided at output. Use T or I bracing spacing indicated on design. if indicated. Lumber design values are in accordance with ANSI/TPI 1 14.Bottom chords require lateral bracing at 10 ft spacing, section 6.3 These truss designs rely on lumber values or less,if no ceiling is installed,unless otherwise noted.- BEARING Iestablished by others. 15 Connections not shown are the responsibility of others. Indicates location where bearings 16.Do not cut or alter truss member or plate without prior (supports)occur. Icons vary but ©2012 MiTek®All Rights Reserved approval of an engineer; action section indicates joint ^ number where bearings occur. 17.Install and load vertically unless indicated otherwise - ____ - Min size shown is for crushing only. g 18.Use of green or treated lumber may pose unacceptable environmental,health or performance risks..Consult with I Industry Standards' projectengineer before use. ANSI/TP11: Natioral Design Specification for Metal 19.Review all portions of this design(front,back,words and pictures)before use.Reviewing pictures alone Plate Connected Wood Truss Construction. is not sufficient. DSB-89. Design Standard for BracingM i nO $ BCSI: Building Component Safety Information, 20,Design assumes manufacture in accordance with Guide to Good Practice for Handling, �� ANSI/TPI 1 Quality Criteria. Installing&Bracing of Metal Plate Connected Wood Trusses. MiTek Engineering Referen iet:Mll-7473 rev.10/03/2015 SUBMITTAL COVER SHEET I • Vineyard View • GENERAL CONTRACTOR: ARCHITECT: C6niferConifer-LeChase Construction,LLC 205 Indigo Creek Drive BHC Architects 235 LeChasePh: Rochester,NY 14626 Wireless Boulevard Hauppauge, (585)760-5336 NY 11788 CONSTRUCTION Fax: (585)760-5353 CLC Project No. 1971002 Project No. 10002 TYPE OF SUBMITTAL: PRODUCT DATA CERTIFICATION MFGR COMPLIANCE SAMPLE MFGR DRAWING RECORD DOCUMENT COLOR SELECTION x SHOP DRAWING CLOSEOUT DOCUMENT TEST REPORT SUBSTITUTION OTHER SUBMITTAL DESCRIPTION Building Trusses-Building D CONTRACTOR/VENDOR DaVinci Construction MANUFACTURER/SUPPLIER Universal Component Corp. SPEC.SECTION'#&TITLE 061753-Building Trusses . SUB-PARAGRAPH DRAWING NUMBER x FIRST TIME SUBMISSION REVISION NUMBER CONTRACTOR'S STAMP/CERTIFICATION: ARCHITECT/ENGINEER REVIEW STAMP: I HEREBY CERTIFY THAT I HAVE REVIEWED THIS SUBMITTAL, VERIFIED THE PRODUCTS,VERIFIED FIELD MEASUREMENTS WHERE APPROPRIATE AND HAVE COORDINATED THE INFORMATION WITHIN THE SUBMITTAL WITH THE REQUIREMENTS OF CONTRACT DOCUMENTS. THE SUBMITTED ITEM(S)COMPLY'IN EVERY RESPECT WITH THE REQUIREMENTS OF THE CONTRACT DOCUMENTS AND SPECIFICATIONS CONTRACTOR COMMENTS: CONIFER-LECHASE SUBMITTAL NO. 061753-004 BY: Jack Susman Date: 6/4/2019 0 0 U 14'5 3W L 8'8' 31'10 a/4• 14'S 3/4• BEARING WALL LOCATIONS,CONFIGURE _ TRUSSES TO SPAN �-=- F' � BETWEEN BEARING WALLS F17 . . Ft`8 j J (tp FLB rt[va^ -FA.._ � iF 8 F26 I Fat - F35 05 F13 Fa P 1`31 �.....w... F05 Ba o 0 �rtS F2R1 F3'! i Fa;+ F22 F30 -I .. _ Ir43/a• FIB bl F22 fo -•�T• Fs'7 F35 H1� PF2� fa0� Fi1 F22' FaDF6J1'S s/a• 1-3AP12'--..� —� � FJ4.""- D6 t"2• F33<., c'Wau. �.F17 F33 9p y S, FS„ 8a Y F27 Fi't. o "f2 F.7,5tl _ 2'8" F17 bI Fr7 F28 o P r27, 213 g�"t ya 3 ., .....x......_, ... ,_� (�-.w,..._-..-__..�._. w,_;s I Flu [47 k;,^,7 Edi' F75 F23 m �—I 1-9> _ S'1 8 r13 1,23 F... a TRV] F Y8 3/4• F73 FD3 E-23 F2b c g z o mo F i3 F04F2^cEO am— P25oN o sdo$�8 F1JF1n 1'41/2• rt« ❑>w. o�..w � �$`oyq i.,(r� Fu .TiT.ue^ _ Oeam c.ersao`n w.ea = E S IV III b �,p.r^n m^mwe g y K z b III IIII j�l Ilj IIII III IIII 411 ;tea;�•��a,m..c� � p9�2.� III III I 2'8• 14'53/4' 22'71/8' 18'3318^ 14'53/4' 2'0" vm.e2insa,ne q"E 73 11• OTE DRAWI GS ERE n9 8-`om Architect/Builder shall review all truss engineering/layouts and verify all spans,depths,mechanical openings,loading etc prior to truss fabrication CHECKED FOR LOADING rya m e z CRITERIA AND GENERALS ONFORMANCE WITH THE CONSTRUCTION C DRAWINGS y n2 A > 9 a9 v - e 3gpr= i E G Building D,2nd Floor Framing Layout Scale NTS �IFa6lttt�� , ___-- MITek USA,Inc. 16023 Swingley.Ridge Rd— Chesterfield, -- Chesterfield, MO 63017 314-434-1200 Re: 35970F3 Vineyard View Building D 2nd Floor The truss drawing(s)referenced below have been prepared by MiTek USA,Inc. under my direct supervision based on the parameters provided by Universal Component Corporation. Pages or sheets covered by this seal: I37921891 thra I37921926 My license renewal date for the state of New York is January 31,2020. NES GAI July 24,2019 Y_ Garcia,Juan µ IMPORTANT NOTE:The seal.on these truss component designs is a certification that the engineer nam�¢'1s tic4nsed in,the judadjction(s)identiRed; id—thatAhe dsigrts c+51F?lxly.'�yilhfkflStlTPt:1. These,destgnsartPtiesed upon parameters slioytn,'(e:g.�loads;,suppdrts'a dirneriuiotits�shape and'design"cnties},WhTot�`�iprs given to Wet-&TRENC&,'Any protect sp cific ir►I?O matioii in luded'is to iVtiTek's or TRENCO's Customers_i}t�.refcredea purpose arty;=and�tias n�l,tiik�n-into;account In i17� ptepar'ailcn af1fi0d Assigns: Mmk,or't`kEiWbo,has not independeritiy yedfrad the app€l�hilily;ofi€ie,ites�gr��ararrtetarso�zthy;ele�ig€rsforanygarticufartyu€td€ng, beforeusY, She bonding dslgtier`stioutctrrerify° pplicatiilit�rf iles( n`parameters an�,` rop`erty incorporate these:dstgns into the;overall,tarrildlrfg;dasign:p"e�.FtN51�I Pt�;,C€lapter 2. dob '-Truss rrt95TYAe lQty Ply VinisyardV,ew Building D 2nd Floor 137921891 35$74F3 F01 FLt70F2 31RbER- i --= Job Reforenei: nptlan,l) Universal Cornponent Corp., :EAST HAVE11l-CT 06512 :8010's Aug 112017 MI,Tek ipduslnlis,Itic Wed Jul z1_18t39:27201rS'Parc i iD;ni11 4DAttGL-IJvt]7PkIBtlApy`fP!)�1t€a-XQ2t8R 7Z 1058hsg#plrt996aYxa3diB6tlw3oVL',lzyiioLk 2-6-0 p�14, 0 1H1 1�_i Scale=1_ 3x6 FP= Special 3x6 FP= 4x6 li 6x14 = 7x10 MT16H II 6x12 = 6x8 = 1 31 2 32 3 33 4 5 8 7 B 34 9 36 10 36 11 12 3713 IT ? 25 23 26 22 21 20 19 27 18 28 17 29 16 15 3i�'' g 6x12 6x10 — 3x8 MT1BH FP = 4x6 11 7x10 MT1BH = = = — _ 7x10 MT18H = 3x8 MT18H FP = 3x8 II 16.6-14 _ -- _ i-- 19-2.6 -_ 19.7>P,204,1-B-; &7.8 tt•4.1t1 1-4-8 y Ptaie Offsets fiC,Y) _(B 0-3-0 Ed4el [9:0-3-D,0-0-0 10:0-3-4',Ed1�e);j12:0 3 4.I dae1,(14:Edpe,ii 3 0],[15,0-3 0;4 q,,-Ojdlfi 0,1 B:>bdael X8.0-3.0.EJ e LOADING (psf) SPACING- 2-0-0 CSI. DEFL. in (loc) Well L/d PLATES GRIP TCLL 40.0 Plate Grip DOL 1.00 TC 0.30 Vert(LL) -0.25 18 >999 360 MT20 197/144 TCDL 12,0 Lumber DOL 1.00 BC 0,56 Vert(CT) -0.39 18 >644 240 MT18H 1971144 BCLL 0.0 Rep Stress Incr NO WB 0,76 Hor2(CT) 0.07 14 n/a nla BCDL 10.0 . Code IBC2015ITP12014 Matrix-S Weight.319 Ib FT=20%F,11%E LUMBER- � BRACING- TOP CHORD 2x4 SP 240OF 20E(flat) TOP CHORD Structural wood sheathing directly applied or 6-0-0 oc pudins, BOT CHORD 2x4 SP 240OF 2.1E(flat) except end verticals WEBS 2x4 SPF No,2(flat)*Except* BOT CHORD Rigid ceiling directly applied or 10-0.0 oc bracing, 10-16:2x4 SPF 2100F 1,81E(fiat) REACTIONS. (Iblsize) 24=233210-4-6,14=526610-4-6 FORCES. (Ib)-Max,Comp-Max Ten--All forces 250(lb)or less WOeiptwhenshown TOP CHORD 1-29=27.710,13-14=-132/348,2-3=-8269/0,3-4=-826910;4-6=-13811/0,6-8=-13811/0, 8-9=-1'598110,9-10=-1598111),10-11=645310,11-12=-6453/0 BOT CHORD 23-24=014444,21-23=0111342,19-21=0/15981,18-19=045981.17-18=0/171D8, 16-17=0117108,15-16--016453,14-15=0/6453 WEBS 2-24=-4944/0,2-23=014256,3-23=-29110,4-23=-3420/0,4-21=0/2746,6-21=-277/0, B-21=-2404/0,a-19=01424,10-17=01331,9-18=-851264,10-16=-11763/0,11-16=012489, 12-15=0/2827,12-14=-872210,10-1 8=-1 24 310 NOTES- 1)Fasten trusses together to act as a single unit as per standard industry detail,or loads are to be evenly applied to,all plies, 2)Unbalanced floor live loads have been considered for this design 3)All plates are MT20 plates unless otherwise indicated. 4)All plates are 3x6 MT20 unless otherwise indicated. 5)This truss has been designed for a moving concentrated load of 250.0ib live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. - 6)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 oc and fastened to each truss with 3-10d(0,131"X 3")nabs. F NE Strongbacks to be attached to walls at their outer ends or restrained by other means Q_ 7)Hanger(s)or other connection device(s)shall be provided sufficient to support concentrated load(s)5095 Ib down at 16-6 14 on top A � ,0 chord,The design/selection of such connection device(s)is the responsibility of others z 8)In the LOAD CASE(S)section,loads applied to the face of the truss are noted as front(F)or back(B) LOAD CASE(S) Standard r- r 1)Dead+Floor Live(balanced):Lumber Increase=1,00 Plate Increase=1,00 LL! Uniform Loads(plf) ri fU Vert:14-24=-20,1-13=-104 5 •f Concentrated Loads(ib) y Vert 10=-5015(F) p OSd011 �Pess,k� July 24,2019 WARNING-venry design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE MII.7473 rev 10/03/2015 BEFORE USE err Uec:a{imvnl'�I`losueiu'btilywiitl�MlTak"bc6ri$Dwain,Thia'dx'�Fgn�Ifillb4L�UTAyupitnFahnuF?amtriiov°n,Arltlia,fGr�Riti �Pduatbucl�n0�mP4rronl.nat , ri tru5ssyz4'irn; Vat thv balU r{jdu�i4"nrmual va,ifj lira aPolfratir iky afsks r'iiriintalarr�trdProP iy 6rcwnr+ntn fats daa gr,pito llvr o rxul_ txrJtd3ir J-°+n.,E+rr�rap nrisa ni a}a eek±vent bvhrg Jas I�dr,of Ji Ss:vnu nndror cserd recmtibr9w3y.sLdtlsan 9t ten, r.�ry an,i j+�rmnnsm l rr card pVIM('' inirlNiY r¢tyaixotiffiP4Yatni$yand'iova nnnlr� iiow'huo npgroonaain ry`amftuapa�,ydprnagFgnrurtn4rwkhiu�nceiN?rlupts,n. f«L�kgt�n,Accraq$,ge#(Ymyr-etur; nnnti tra ngnJ ttitsaoy aixl It r+4 s-ria- �1N51 I1.avai4iy Cotnria,DS0.39 and BC l SUlldlnp Component 16023 Swmgley Ridge Rd sntbly lnfannatl04 a�aiin$1a frran 7nL45l�tats_ir iuwtp.858 i1:4en.^stren7;SUT#c 312 N�1 i 1{41c YA323t4: - - - - Chesterfield,M0 63017 Job - Truss-- `- - -- Truss Type Qty Plyneyard View Building D 2nd Floor 1 137921892 ; 359701`3 F02 FLOOR GIRDER 1 2_[ h Reference-(optional) Ul1W0tsat;Compotfad1Corp., --EAST HAVEN.CT06512- - - '8:010 s Aug 11 2017 MITek Industries,Inc,'Wdd Jui 24 163929 2019 Page f--- ID-ndiRDAhLEUvQ7Pki63 AvyTyugda-TpAdZ7DpY1it45gBwjG9EUBsHkHnl_MhONHdOryuoLI Scale=1.27.2 Speclal Special Special Special Special Special Special Special Special Special 34 11 8x14 MT18H = Special 3x6 11 Special 6x8 = Special 3x6 11 Special 804 MT18H = 3x6 II 1 17 18 22 19 3 20 21 22 4 23 5 24 25 6 26 27 28 7 I 7t 12 13 I 11 14 10 15 g 6x12 = 16 8 6x12 MT18H = 6x12 = 3x6 11 6x12 MT1BH = _Plate Offsets 2Edne .2-BEd� 141:0-t-0,Edge}Z01r t c `- - -- ; LOADING (psf) SPACING- 2-0-0 CSI. DEFL. in (loo) Vdefl Ud PLATES GRIP TCLL 40.0 Plate Grip DOL 1,00 TC 0.73 Vert(LL) -0.21 10 >885 360 MT20 197/144 TCDL 126 Lumber DOL 1,00 BC 0.59 Vert(CT) -0.34 10 >560 240 MT18H 197/144 BCLL 0.0 Rep Stress Incr NO WB 0,84 Horz(CT) 0.06 8 We n/a BCDL 10.0 Code ISC2015/TPI2014 Matr1x-S Weight"194 lb FT=20%F,11%E 'IMBER- BRACING- - - )P CHORD 2x4 SPF No2(flat)- TOP CHORD Structural wood sheathing directly applied or 6-0-0 oc purlins, BOT CHORD 2x4 SPF 2100F 1 8E(flat) except end verticals.. WEBS 20 SPF No.2(flat)*Except* BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing. 2-12,6-8:2x4 SPF 2100E 13E(flat) REACTIONS. (Ib/size) 12=5119/Mechanical,8=5747/Mechanical FORCES. (lb)-Max Comp/Max Ten -All'forces.250(ib)or less except when shown TOP CHORD 1-12=-610/0,7-8=-99210,2-3-14481/0,3.4=-14461/0,4-5=-1493010,5-6=1493010 BOT CHORD 11-12=0/9105,10-11=0/16557,9-10=0/16557,8-9=0/9606 WEBS 2-12=-10130/0,2-11=0/5981,3-11=-1585/0,4-11=-2289/0,4-10=-68/264,6-8=-1068810, 6-9=0/5924,5-9=-1775/0,4-9=-17g4/O NOTES- 1)Fasten trusses together to act as a single unit as per standard industry detail,or loads are to be evenly applied to all plies, 2)All plates are MT20 plates unless otherwise indicated. 3)Refer to girder(s)for truss to truss connections. 4)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 5)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 oc and fastened to each truss with 3-1 Od(0.131"X 3")nails. Strongbacks to be attached to walls at their outer ends or restrained by other means. 6)Hanger(s)or other connection device(s)shall be provided sufficient to support concentrated load(s)760 ib down at 0-8-0,851 Ib down at 2-4-0,651 Ib down at 3-11-4,851 Ib down at 5-7-4,851 Ib down at 7-3-4,851 Ib down at 8-114,851 Ib down at 10-7-4, 131 Ib down at 11-6-0,109 Ib down at 11-11-12,851 Ib down at 12-34,109 Ib down at 13-7-12,851 Ib down at 13-11-4,and 133 Ib down at 15-3-12,and 875 Ib down at 15-3-12 on top chord. The design/selection of such connection device(s)is the .-of:_ NE responsibility of others.- vV 7)In the LOAD CASE(S)section,loads applied to the face of the truss are noted as front(F)or back(B) LOAD CASE(S) Standard 1)Dead+Floor Live(balanced)-Lumber Increase=1,00,Plate increase=1 AO Uniform Loads(pif) � Ar �Vert 8-12=-20,1-7=-104 Concentrated Loads(ib) Vert:2=-851(F)5=851(1`)17=-760(F)19=-851(F)20=-851(F)22=-851(F)23=-851(F)24=-131(6)25=-961(F=-851,B=-109) t`' o-'f 26=961(F=851,B=-109)28=-1008(F=-875,B=-133) d�_Ssi July 24 2019 WARNING-Venty design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE MII-7493 rev.1010312015 BEFORE USE 1 st pn vlitlif dir u se ap{yivlur Nilek4Uctiv iiaGoks Tl `daa7pa la "'on upon pwametars shown,acid is'far an indv duat huilding rxprywnent not �•` n vuao aybt0ir!,eeft»_otw.um bulldog dor>Oncr rquai yoruy tar applitai81111y cf d¢nign pixiifa and pmpclyincotramle-tltl6 9yiJgn fnta'llin aUaraB-. twlhii ig dosipn,0n�np`liidlcalcd is to fii buckWtp'n'In livldOok W anit drar dtord memllara ohly(�ddltcerl tatnperar�iwd�rifinn>at ptapng AT �� i'sartveyhi6yulleliroratabllltyaitdtn�iavanlcatfnp�4w!tlitwaHtiT4pangtnelinauryaMlfccpeitydcrmngn•Fnrg"uneinl'au}cl'serogan llptti� inbtjcali4n,atatn u duityaryy;a0aft6n mid Wact4mI'Of -28. 5nqqd UUria a` omuseu . ANSIffP17 Duull_ry Cdlario:;Q58$D olid tiGBt 9uiiding Component 161)23 Swingley Ridge Rd i Snfgly(M6rniEt10t1`aNiilinbla UOhITtusS P7ala InslilaCe,2fB N�Cap Sty 1�SSn10 312.A!4%Mdrinl VA Chesterfield,MO 63017 - - ( Job Truss — Truss Type Qty PiyVineyard View Building D 2nd Floor 137921893 35970F3 F03 Floor 1 1 Job Reference_o [tonal) EAST HAVEN CT00512 8.01,0 s AAID11 2017 MITek Industries,Inc.,WW JU124 16.39 29 2019 Pagel Univulsai Camp Ment Corp., ID:nd IRDAhLEUvQ7PkldgAvyTyugda-TpAdZ7OpY11t45gdwjG9EUBx5kLFIBDhONHdOryuoLi i 1 1x3 II 9 2 10 3 1x3 II Scale=11 1x3 11 6 7 5 6 4 3x3 = 1x3 II 3.51-0 (in loo fl L/d PLATES GRIP LOADING (psf) SPACING- 2-0-0 CSI. DEFL. ) Ilde TCLL 40.0 Plate Grip DOL 1,00 TC OA2 Vert(LL) -012 5-6 >369 360 MT20 197/144 TCDL 120 Lumber DOL 1.00 BC 037 Vert(CT) -017 5-6 >265 240 BCLL 0,0 Rep Stress Incr YES WS 0,02 Horz(CT) 0.00 n/a n/a BCDL 10.0 Code ISC20151TPI2014 Matrbc-S - Weight 181b FT=20%F,11%aE BER• BRACING- LUM UMTOP CHORD Structural wood sheathing directly applied or 3-11-0 oc purlins. TOPCHORD 2x4 SPF 2100E 1 8E(flat) except end verticals. BOT CHORD 2x4 SP 285OF 2,3E(flat) WEBS 2x4 SPF No.2(flat) BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing REACTIONS. (Ib/size) 4=235/0-2-4,6=235/Mechanical Max Grav 4=333(LC 10),6=333(LC 7) FORCES. (lb)-Max,Comp./Max.Ten.-All forces 250(lb)or less except when shown, TOP CHORD 1-6=-29210,3-1=-287/0 NOTES- 1)Unbalanced floor live loads have been considered for this design, 2)Refer to girder(s)for truss to truss connections: 3)Provide mechanical connection(by others)of truss to bearing plate at joint(s)4 4)This truss has been designed for a moving concentrated load of 250 Olb live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 5)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 oc and fastened to each truss with 3-10d(0.131"X 3")nails Strongbacks to be attached to walls at their outer ends or restrained by other means 01F NE rn :�� ►',f z �" •_w rte:. o.o 6 oQg' � July 24,2019 Jim P ®WARNING-Venfy design parameters and READ NOTES ON THIS AND INCLUDED MJTEK REFERENCE PAGE MII.7473 rev 1010312015 BEFORE USE w>w a 0eslgn v dW!w rrsr o dy whh h17rS ft eCnndr3nas,Tidsddvign 15 b rhtd,onty Upon pnn:wrcrN shaven;and is,forall Individupi hording carrilrb"On6 no! a lrusd oy8lotn;8afate dsa,ilia hUltlZnq dMJQrWf mae"i Yanly the apnirca Rty Or dO6lprr In.TtlTtal4rH arld prapGiy III&roarala this 40,901141to Uta n ufA tarEidltz0 r1aalGn.araring Irrd coir d is to provrrnt bL Wti ar igdiVlduaf irrzss web�ndlar dlald raatnhCrs onV.flddillona!%rrniparary,artd pormannol bulung- # MiTek' leEarr.nrd4urredtar-clatlrlitynrul.t�iprOvonlcallapscyhthpm:rvlrrnpur..annlipjrirynadprapmlYtlamri90-Fatggeerwmlquldnr>�rrgriruln(l7ni pl16023 'fnlrr(catian,ctmaga.otfnlary,ernciirpff nfltl ti}atlacf2 co ttpsau3,wsd Ua6sS¢'+!vri?.,>Cv- RP:3l,7Pl1.L�n_!tty licit^_cte.O3t3.89 and IIC,6l Sulldlnp Component ¢ Chesterfield.MO 61301 Rd Safgtylnteimotion aVoflabbllnrtanlTru aPlntolaatluta,•2%eN!LraSUg41`3akto3t:;/lcxandri3;Vr1.2231., ^Y doE1 Tdlss. - T,4`�Type Qty_ Fly Vlitoyard Vlmv Building D 2nd Floor - 137921894 359703' F04 FLOOR GIRDER 1 i -a-:lob Ritfetonce a genal)_ Unlvaar M Coalpdnenl Corp„ EAST HAVEN CT 06512 - — 8.010 s Aug-11.26;17 MiTEk industries,Inc, Wed Jul 24 16:393,1,2019 Dago 1 ID ndIRDAhLEUvQ7PkiBgAvyTyugda-PSINzp234fyaJ0_a27ldKvGBIY71Dx7 rhmkSkyuoLg 1 t-3 Q 0(7l fR r 2.60--- 1 1i� Scale=127.9 1.5x3 I I Special 1.5x3 II 6x6 = 4x12 = 1.50 II 4x4 = 3x6 FP= 1,50 ]I 4x8 = 1Sx3 II 1 27 23 28 4 29 5 30 6 31 7 8 32 9 33 10 - i 6 2+ 21 19 18 22 17 23 16 15 24 14 25 13 12 26 1• 5x6 I I 3x6 II 3x6 II 46 11 3x6 11 3x6 FP= 6x10 = 5x6 11 6x6 = 3x8 MT18H FP = 16-1-6 Plate Offsets.(X,Yj:- K_'0-1-13;Edael_L6:0=1-B;Edges(14,0.3.0&Q-01,[15:0.3 O,Edge)I f16 0-1-8,Edde1 - LOADING (psf) SPACING- 2-0-0 CSI. DEFL. in (loc) I/deft Ud PLATES GRIP TCLL 40,0 Plate Grip DOL 100 TC 0.82 Vert(LL) -0.15 15-17 >999 360 MT20 197/144 TCDL 12.0 Lumber DOL 1.00 BC 0.47 Vert(CT) -0.24 15-17 >798 240 MT18H 244/190 BCLL 0.0 Rep Stress Incr NO WB 0.64 Horz(CT) 0.03 11 n/a n/a BCOL 10-0 Code IBC2015/TP12014 Matrix-8 Weight-191 Ib FT=20%F,11%E, �fNBER. -- ------'- - _- _ _ --_ - - --- --- - - '-BRACING- OP CHORD 2x4 SPF No.2(flat) TOP CHORD Structural wood sheathing directly applied or 6-0-0 cc puriins, BOT CHORD 2x4 SP 240OF 2.OE(flat) except end verticals. WEBS 2x4 SPF No.2(flat) BOT CHORD Rigid ceiling directly applied or 10-0-0 or,bracing, REACTIONS. (Ib/size) 20=3015/0-2-4,11=1719/0-2-4 FORCES. (lb)-Max,Comp./Max.Ten.-All forces 250(ib)or less except when shown, TOP CHORD 10-11=-274/0,2-3=-3319/0,3-4=-3319/0,4-5=-7621/0,5-6=-7621/0,6-8=-5427/0,B-9=-5427/0 BOT CHORD 19-20=0/3319,18-19=0/3319,17-18=08935,15-17=0/8935,14-15=0/7621,12-14=0/7621,11-12=0/3019 WEBS 9-11=-3392/0,9-12=0/2706,8-12=297/0,6-12=2454/0,2-20=4588/0,2-19=0/2527.4-17=0/412,3-la=-262/577, 4-18=-6265/0,4-15---1462/0,6-14=01774 NOTES- 1)Fasten trusses together to act as a single unit as per standard industry detail,or loads are to be evenly applied to all plies 2)Unbalanced floor live loads have been considered for this design 3)All plates are MT20 plates unless otherwise indicated 4)Provide mechanical connection(by others)of truss to bearing plate at joint(s)20,11 5)This truss has been designed for a moving concentrated load of 250.Olb live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 6) Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 oc and fastened to each truss with 3-10d(0.131"X 3')nails. Strongbacks to be attached to walls at their outer ends or restrained by other means. 7)Hanger(s)or other connection device(s)shall be provided sufficient to support concentrated load(s)2831 Ib down at 4-3-8 on top chord. The design/selection of such connection device(s)is the responsibility of others 8)In the LOAD CASE(S)section,loads applied to the face of the truss are noted as front(F)or back(B) ( r LOAD CASE(S) Standard !`C�a 1)Dead+Floor Live(balanced):Lumber Increase=1,00,Plate Increase=1_00 -,GAO - Q Uniform Loads(plf) -9 Vert.11-20=20,1-10=-104 * " Concentrated Loads(lb) , Vert-4=-2751(F) W UJ Alka , °FFs sk'Q�� July 24,2019 ®WARNING-Vmfy design Parameters and READ NOTES ON THIS AND INCLUDED rAITEK REFERENCE PAGE M11-7473 rev.1010312015 BEFORE USE. iQqufOgNnthi far uaq Drib vdth t iifk uit7 crux:.rim diti�inii Itc�aKr oltty upt+n pwolji unt sh6wq,, riot OlNG5 cy5{Un'.96fgfd'UBd;niO Udl[dlhdeeigpe,'r,musl vonry QioOpplloah11fly of duoltgi pornmotors;$hd prytpOQY tnCacjwinla ihl,deatOn(nto,ihttinJUri�l ��YY hui(di�0 daesOl11iii,9mdnn ind�mt a fr topfoYam twcf/trip of hidividc�I lrhss wn6 andru;dl®fd mnuiUar3 raky.AddfU�nal rompoinry end purma�Ibiaz0d tars nullity 01 (olNdvantCollupLnvdtit passihio porsonol In]urysnd utnpnr dmm�g0 FgrRgo?al guidlrnca reggnllgglon;t:prgilR.dal(v0cy;aro01(onOndiulciiuj G iia osgnifUb9$s/slerlirr,sOlr A9omponent 16023 sw(ngley Ridge Rd i?dldtylnrormttUon uvalL+lilulro�+?TriisSFietninnUtule 2ta:fV.LcuSIleal.Spila3i2 Ngxnndd0.VA223i4; Chestertleld,M063017 Jab rtussTypa Qty Ply Vlneyarif View Budding D 2ndFloor137921895 347dF3 [russ OS FLOOR GIRDER °Z - Jab Reference o rlioiial] Universal Component Corp_, EAST HAVEN CT 06512 8,010 s ARg ii 1.2017 MiTal(Indust dN,Ir c WEd Jlil 24 76:39:32 2010.Page'1 ID:ndIRDAhLEUvC17PkiBgAvy?lyugda=tOtmB93bry•fR>12nlbrps 7OSyEdyf51!74K►Mt?FyooLr i 2-6-0 1-1-14 Scale=19 Special 1_.5x3 I I 5x8 = 6x6 = 3x3 I I 4x4 = 4x4 = 3x6 FP= 18 30 9 x3 I I 4x8 = 3 1 11 1 26 2 3 27 4 28 5 29 6 7 8 X.1. 10 x3 1 — - — — a v 21 19 18 22 17 23 16 15 24 14 13 12 25 6x8 3x6 II 10x10 = 3x6 II 3x6 II 3x6 FP= 6x10 = 5x6 ll 3x6 11 3x8 MT18H FP = r - - _ 3-1-2 -_ 7-1-2 16 _ 3.1-2 - - — -— 4.4.0-09.1=1a31 Plate_ O_ffsels fX,Y)'=_t2:r, u��:a1.>.Eag�;t5'a�a8 Edael (6 0 1-8 EdgD] 114:0-3 0 a4�,rJT.04-12,Eel.110-3 n,a0.0]- - LOADING (psf) SPACING- 2-0-0 CSI. DEFL. in (loc) 1/deft Lld PLATES GRIP TCLL 40 0 Plate Grip DOL 1.00 TC 0.54 Vert(LL) -0.17 15-17 >999 360 MT20 197/144 TCDL 12.0 Lumber DOL 100 BC 0,95 Vert(CT) -027 15-17 >724 240 MT18H 197/144 BCLL 0.0 Rep Stress incr NO WB 0.68 Horz(CT) 0.04 11 nla n/a Weight:169 It, FT=20%F,1i%E BCDL 10.0 Code IBC2015fTP12014 Matrix-S LUMBER- BRACING- TOP CHORD 2x4 SPF 210OF 1-BE(flat) TOP CHORD Structural wood sheathing directly applied or 6-0-0 oc purlins, BOT CHORD 2x4 SPF No.2(flat) except end verticals. WEBS 2x4 SPF No.2(flat) BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing REACTIONS. (Ib/size) 20=2993/04-6,11=1749/0-2-4 FORCES. (lb)-Max Comp./Max.Ten.-All forces 250(lb)or less except when shown. TOP CHORD 1-20=-264/6,10-1 1=-27410,2-3=-590210,3-4=-928410,4-5=-9212/0,5-6=-782810,6-8=-556210,8-9=-556210 BOT CHORD 1 9-20=015 9 0 2,18-19=0/5902,1 7-1 8=015 902,15-17=Of7B2B,14-15=017828,12-14=0/7828,11-12=0/3090 WEBS 2-20=-659910,2-19=0/1967,9-11=-3472/0,9-12=012778,8-12=29011,6-12=-2533/0,6-14=01729,4-17=-318910, 5-17=011 544,5-15=-678/0,3-18=2185/0,3-17=0/4603 NOTES- 1)Fasten trusses together to act as a single unit as per standard industry detail,or loads are to be,evenly applied to all plies. 2)Unbalanced floor live loads have been considered for this design 3)All plates are MT20 plates unless otherwise indicated 4)Provide mechanical connection(by others)of truss to bearing plate attoint(s)11. 5)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 6)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 oc and fastened to each truss with 3-10d(0 131"X 3")nails. Strongbacks to be attached to walls at their outer ends or restrained by other means. 7)Hanger(s)or other connection device(s)shall be provided sufficient to support concentrated load(s)2823 Ib down at 4-5-10 on top chord.The design/selection of such connection device(s)is the responsibility of others 8)In the LOAD CASE(S)section,loads applied to the face of the truss are noted as front(F)or back(B). NE LOAD CASEO S) Standard P� O ' �- 1)Dead+Floor Live(balanced) Lumber Increase=1.00,Plate Increase=1,00 ��A �=/� Uniform Loads(plf) Vert:11-20=-20,1-10=-104 * i Concentrated Loads(ib) Q r Vert 4=-2743(8) ¢)!2,~ Iti tR i tiJ. 0-0860 �Ca pQFESS10amok July 24,2019 ®WARNING-Verfry design parameters end READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE M11.7473 rev!0/0312015 BEFORE USE �• ,Qtnlgri Vend}cr uoe only with ASITr k142.moswdlri Tho,de:Iliit"bnoe4'only upon potnRol em rh¢Vnp 9nU I�'IW mtlnJlvtdrrel bu+lrYn7J caryipananl,qol 'niruss`ayIldI.,Bofurbuno,tbn'buildShgii4 nurmvclyonryIRnaPPl +hxityp,donpnmeln.�,grid{*.r4phrlylnuory'aa9vthl•idOriltJn6rictthebvo*a0 Irrih}hr0+!eol'jn, BrcriY�lridtcdled&tcMQ�'A�t txlrkl�np o1 ndJvulnnl rnlz=s ar:b sndtard meisi6cealy;Additlnnsl IOmpamy ad pernwnont tu4c`•n;l rmlnbirit , P.M.domRge.._ twill rrerul gurd9nty ru}g8rthiHi Oro tntvlcntiun,atorOHg.dntivary,o c t ad xnd L;�nl rOp!tNs os and b, Yst3naa.seo MtBtrTPl1 Cunllty cdterio,DSB 89 and Bes)Building Component 18023 Swingley Ridge Rd snrofy ln(armntlon avn4ahte lrom TN65 Ftnto lnslinR0,2" 4"'L e1 5ir4o 317,AoxnndAn.+rA 74, chesterfield,MO 63017 JabTrus s - Truss Type ,:Qq "fly — VfnayardVle1w Building-D 2nd Floor-' - i 137921896 359YCF3: Fos Floor Girder 1 2 J&Reference taptionall Universal Component Corp., _EAST-iiA_uEN CT,OOS12 - " 8.010 s Aug 11201 rMITek industdes,,lnd.-Wed Ju124-16.39.33 2019 Page l ID•ndIRDAhLEUvQ7PklBgAvyTyugda-LaPBOV3KcGCIZ18y9YK5PKMU1MYshuYGJ FrxcyuoLe Scale=1.21,7 Special Special Special'_,y _._-._ Special 1x3 11 Special 48= Special 1x3 II 3x3 = Special 4x8 = Special 1x3 II d 14 15 2 16 3 17 18 19 4 20 5 21 22 23 6 W -- x " 10 48 = 11' 9 12 B 36 = 13 7 48 48 = 12-11-12 I Plate Offgets LX, LOADING,(psf) SPACING- 2-0-0 CSI. DEFL. in (roc) I/deft L/d PLATES GRIP TCLL 4d.0 Plate Grip DOL 100 TC - '1,00 Vert(LL) '-0;28 9-10 >555 360 MT20 197/144 TCDL 12.0 Lumber DOL 100, BC 0.96 Vert(CT) -0.38 9-10 >401 240 BCLL OA Rep Stress Incr NO WB 0,51 Horz(CT) 0.05 7 n/a n/a BCDL 10.0 Code IBC2015/TP12014 Matrix-S i' Weight:402 lb FT 20%F.11%E IMBER- BRACING- )P CHORD 2x4 SPF No.2(flat) TOP CHORD Structural wood sheathing dirdotly applied 4r 6-0-0 oc purlms,. .JT CHORD 2x4 SPF No.2(flat) except end verticals WEBS 2x4 SPF No.2(flat) BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing. REACTIONS. (Ib/size) 7=2855/Mechanical,10=2785/Mechanical FORCES. (lb)-Max.CompJMax.Ten.,-All forces 250(lb)or less except when shown TOP CHORD 1-10=-432/D,6-7=-512/0,2-3=-6375/0,3-4=-6375/0,4-5=-6347/0 BOT CHORD 9-10=0/4299,8-9=0/6347,7-8=0/4282 WEBS 5-7=4859/0,2-10=4878/0,5-8=0/2344,2-9=012356,3-9=-1047/0,4-8=-102610,4-9=-2491273 NOTES- 1)Fasten trusses together to act as a single unit as per standard industry detail,or loads are to be evenly applied to all plies. l 2)Refer to girder(s)for truss to truss connections 3)This truss has been designed for a moving concentrated load of 250.Oib-live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 4)Recommend 2x6 strongbacks,on edge,spaced a1 10.0-0 oc and fastened to each truss with 3-10d(0.131"X3")naris. Strongbacks to be attached to walls at their outer ends or restrained by other means,- 5)Hanger(s)or other connection-devices)shall be provided sufficient to support concentrated load(s)511 ib down at 0-&12,509 Ib down at 2-4-12,503 Ib down at 4-0-12,503 Ib down at 5-8-12,503 Ib down'at 7-4-12,503 lb down at 9.0-12,and 503 Ib down at 10-8-12,and 519 lb down at 12-4-12 on top chord.The design/selection of such connection devices)is the responsibility of others. 6)In the LOAD CASE(S)section;loads applied to the face,of the truss are noted as front(F)or back(B), LOAD CASE(S) Standard. 1)Dead+,Floor Live(balanced):Lumber Increase=1.00,Plate Increase=1.00 F: S Uniform Loads(pif) Vert:7-10=-,20,1-6=-104 - ` .��, 'G/��j�iiQ,�j:`,• Concentrated Loads(lb) Vert 2=-503(F)14=-511(F)16=-503(F)17=-503(F•)19=503(F)20=503(F)21=503(17)23=-519(F) , it -� •� f ,w Ozqeo °Fessmo, July 24,2019 p WARNING-Verily design parametem and READ NOTE50N THIS AND INCLUDED MITEK REFERENCE PAGE MIL7472 re v.10103126IS aEFORE USE. a p/rctOn valyl f0ru,aontt tiylllr',RtT6! onnngcio+s.Thi Ee$tltjn is tiaziigonlyup M pniaU9duc btsiYl+n,arils ldt,anEadWldGHI intNditS""Cofgpprwul,tjal', allussdy0tum N aptptalaGmaM►TLInl}idofivr�y.. iuciia�e1!'7.�Qgt�f'If Quollly Grttarlo,O6&fi8 ailu BC$1 BUlfdl'np Component 16023 Swingley rLdge Rd $dt4Syt11,(aIt15PIlun�aY,71(plrtq�ItOnlTrussP4detry�tltetn,2t9f�t,f-ad'artre6t;'Su1to312.At0uaneldp,VA'a281Q�; Chesterr�eld,M069017 Job cuss TfussType - Qty Ply vnteyoard vie rt&dlding D 2nd Floor 137921697 arc 7DF3. F07 FLUOR GIRDER 1 2=Job Rgfiige d c 11o1,La11,- Universal Component Corp., EAST HAVEN CT 06512 8.010 s Aug t1 2017 MTek Industnes,Inc. Wed Jul 2.1-16.39.3'12019 Page 1 to ID ndIRDAhLEUvQ7PkiBgAvyTyugda-gmzWcr4yNaK9Asi9!GrKxYuirl_zQIPQXe7033yuoLd Scale=1.21 1,5x3 II Special 15x3 11 5x8 — 5x8 = 1.5x3 II 4x4 = 3x6 FP= 1.5x3 11 4x8 = 1.5x3 II 1 26 2 3 27 4 28 5 29 6 7 8 30 9 31 10 ' 21 19 18 22 17 23 16 15 24 14 13 12 25 6x8 = 3x6 It 3x6 11 4x6 11 3x6 11 3x6 FP= 6x10 = 5x6 I I 5x6 11 3x8 MT18H FP = J 3.1.2 1 13-2-6 Plate Offsets' 1'4 (2:0=!•8 Ed a6:0.1.9,[d9Q]3(f4 0"'s"0 4 d Ol (15'0.3•D Ed vl ('18'0-3.4 Edael LOADING (psf) SPACING- 2-0-0 CSI. DEFL. in (loc) I/deft L/d PLATES GRIP TCLL 40.0 Plate Grip DOL 1.00 TC 0.80 Vert(LL) -016 15-17 >999 360 MT20 1971144 TCDL 12.0 Lumber DOL 1,00 BC 0.59 Vert(CT) -0.2615-17 >741 240 MT18H 197/144 BCLL 0.0 Rep Stress Incr NO W8 0.66 Horz(CT) 0 03 11 n1a n1a Weight:170 Ib FT=20%F,11%E BCDL 10.0 Code IBC2015frP12014 Matrlx-S LUMBER- --f--- - BRACING- TOP CHORD 2x4 SPF No.2(flat) TOP CHORD Structural wood sheathing directly applied or 6-0-0 oc purlins, BOT CHORD 2x4 SPF 2100F 1.8E(flat) except end verticals WEBS 2x4 SPF No.2(flat) BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing REACTIONS (Ib/size) 20=2948/0-4-6,11=1738/0-2-4 FORCES. (lb)-Max.CompJMax Ten.-All forces 250(lb)or less except when shown. TOP CHORD 1-20=-27010,10-11=-274/0,2-3=-5775/0,3-4=-577510,4-5=-773410,5-6=-7734/0,6-8=-5504/0,8-9=5504/0 BOT CHORD 19-20=0/5775,18-19=0/5775,17-18=0/9186,15-17=0/9170,14-1 5=or7734,12-14=0/7734,11-12=0/3058 WEBS 2-20=-645710,2-19=0/2242,9-11=-3436/0,9-12=0/2749,8-12=-296/0,6-12---2493/0,4-17=0[720,4-15=-1601/0, 6-14=0081,3-18=0/658,4-1 8=464010 NOTES- 1)Fasten trusses together to'ac(as a single unit as per standard industry detail,or loads are to be evenly applied to all plies, 2)Unbalanced floor live loads have been considered for this design 3)All plates are MT20 plates unless otherwise indicated. 4)Provide mechanical connection(by others)of truss to bearing plate at joint(s)11. 5)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 6)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 oc and fastened to each truss with 3-10d(0.131"X 3")nails. Strongbacks to be attached to walls at their outer ends or restrained by other means 7)Hanger(s)or other connection device(s)shall be provided sufficlent to support Cancentroted loads)2761 Ib down at 4-5-10 on top chord The design/selection of such connection device(s)is the responslbliityaf tethers. 8)In the LOAD CASE(S)section,loads applied to the face of the truss are noted as front(F)`or back(B). �{ 01F NE LOAD CASE(S) StandardCa/l V 1)Dead+Floor Live(balanced)-Lumber Increase=1.00,Plate Increase=1,00 RC��J�� Uniform Loads(plf) Vert 11-20=20,1-10=-104 * A +a1 Concentrated Loads(lb) Vert'4=-2681(B) �r,��t �) W 4`` W O July 24,2019 ®WARNING-Verify design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE,Mt1.7473 rev.10/03/2015 BEFORE USE � Ront�n+HiGd ta'i Irad'pnlyv Iib VlTnictl4onntMo s 7h dsalltn 4 boned only upon purainarur ahonn,and la for an 1114,;tial bullpiny onmponnnt,,nal �a Guaa a Istmr+.Butore one,:nv uupmng dagq;!w{meat Vadty11F4 appUGabiGlyoi doetBn pnr?matnr and p3opnlyblcoiiwt:tic 031.a dnaiyrin?o Wo nvnrn8 6�31kfno4aclom Orndr�Jlndlcptritlata{;tv'att tw�ft!n �!LttlJrJt9 dlrv�+�tbnntfForcwtdtnnmbctarnly.,nzdlllwwltamporaryand amm�nontfvndnu MITOW hulrivrragvlrodin'elnbWtpnndtopin, enlctN,inpanwn+ppsatptopslsrnnitnjuryandFrapnisyd0mo0n,ForgonlfpnSifenre3nr gfgdlC fdl;r;enttara,alor0ro,delrvory,nrocJRn and tijatunp 0I SNS9ns h13t!I1WE Dy"ui4+��tltl,san 'AtiSlrTt?It Qunl:ty Crttarin•OS$�99 ntld BCSi Buiftl3np Component { Chest Sield, y 6301 Rd Sataty lntotmayor+ avnlin Ic trent Truas`F3af0 t3rxtthrt4:2}b 9.L'art S1rge1- (h"a1,^filnxnndrin;Vh21 iSd: �r Chesterfield, 63017 Job- ^_ cuss ` " Truss TypeOty Ply Vlaleyald Vlew$Ulldlnll D 2nd Floor' It - 137921898 35970F3 F08 Floor Girder 1 RaForence;fapUonall s Universal-Ccmponent•Gorp„• '-EAST-HAVEN CT 065,12' - 8,010 s Aug 11 2017 MITekJItlduBlries',Inc:Wed Jul 24-16;39;362619'Page 1 ' ID:ndIRDAhLEUvQ7PklBgAvyTyugdam95G1W6CvBbtQAsXqhuolz 5VZa3uFK1?yUVBxyuoLb 26-0 -•+ —2-5 12 Scale=1:21,7 F-,.. ., Spacial ..-- Special 1x3 II Special 48 = Special 1x3 11 Special 1x3 II Special 4xB = Spemal 1x3 II 4 14 15 2 16 3 17 18 19 4 20 .5 21 22 23 B i! 9 10 4x8 = 11 9 12 B 4x6 = 13 7 4x6 = 4x8 = LOADING (psf) SPACING- 2-0-0 CSI: F DEFL. ^in (loc)_ Udell L/d PLATES GRIP TCLL 40.0 Plate Grip DOL 100 TC 060 Vert(LL) -036 9-10 >430 360 MT20 1971144 TCDL 12.0 Lumber'DOL 1.00 BC 0.99 Vert(CT) -0.47 9-10 >331 240 BCLL 0.0, Rep Stress Incr NO WB 0.51 Horz(CT) 0.05 7 n/a n/a BCDL 10.0 Code IBC2015/TPI2014 Matrix-S Weight:95 lb FT=20%F,11%E 0 UMBER- BRACING- - OP CHORD 2x4 SPF 210OF 1 8E(fiat) TOP CHORD Structural wood sheathing directly applied or 6-0.0 oc purlins, BOT CHORD 2x4 SPF No,2(flat) except and verticais„ WEBS 2x4 SPF No.2(flat) BOT CHORD Rigid ceding directly applied or 10-0-0 oc bracing REACTIONS. (Ib/size) 7=2847/Mechanical,10=2776/Mechanical FORCES. (lb)-Max Comp./Max.Ten.-Al for6a250 Ob)or less except when shown. TOP CHORD 1-10=-431/0,6-7=-513/0,24=28342/0,3-4=-6342/0,4-5=-6342/0 BOT CHORD 9-10=014263,8-9=0/6342,7-8=0/4266 WEBS 5-7=4841/0,2-10=4861/0,5-8=0/2405,,2-9=0/2384,3-9=-1033/0,4-8=1031/0 NOTES- 1)Fasten trusses together to act as a single unites per standard Industry detail,or loads are to be evenly applied to all plies., 2)Unbalanced floor live loads have been considered for this design, 3)Refer to girder(s)for truss to truss connections. 4)This truss has been designed fora moving concentrated load of 250DIb live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 5)Recommend 2x6 strongbacks,on edge,•spaced at 10-0-0 oc and fastened to eaeh.trusswlth 3-10d(0.131"X 3")nails Strongbacks to be attached to walls at-thelr'fluter ends or restrained by Vow-yRqan-: 6)Hanger(s)or other connection device(s)shall be provided sufficient 16-support concentrated load(s)569 lb down at 0-8-12,567 lb down at 2-4-12,567 ib down at 4-0-12,512 Ib down at'5-8-12;518 Ib down at 7=4-12,567 Ib down at 9-0-12,and 567 Ib down at 10-8-12,and 571 Ib down at 12-4-12 on top chord._The design/selection of such connection device(s)is the responsibility of others, 7)In the LOAD CASE(S)section,loads applied to the face of the truss are noted as front(F)or back(B). LOAD CASE(S) Standard - `,QF NEI' 1)Dead+Floor Live(balanced):-Lumber Increase=1.00,Plate Increase=1.00 Uniform Loads Vert 7(P0,20,1-6=-104 Concentrated Loads(lb) Vert 2=-501(8)14=-509(6)16=-501(B)17=-501(B)19=-501(8)20=501(6)21=501(B)23=-517(8) t t` Q 10 Lu ARS ssk"' July 24,2019 ®WARNING-Veru destgr parameiers and READ NOTES ON THIS AND INCLUDED d1ITEK REFERENCE PAGE MII.7473 rev.1010312015 BEFORE USE. Y ; Ar�Ittavdttdf6rui+tbctyviQiAUTok�I: nIn tm�r thidtld�pn,w,"K. aoiy,olwnP�r�tgasraxltawp,iriltia(nfan;lrid�idUal"cullr}Ingwnnpananibeiiif: a itusoA;ktotn,9afoin uno, bb mld' dartfpnar mu31 veltfy(nH apptlralotky t t design ptimR{uuus aoa praavty inc�rpnrm{d Jib,datFgri lnto,[ho 6Vgrhe_ Dull4ing'deslpn.prasGtgtndlcoredtstoprc4enthGekUngprlamNdualudas- atiruld/ar.elldrdmi}tnUar gnfy_lufdjttongllpf}tpartu- 0Pnrman6ptC?ndeg 'lsplwgyarequlrgdfal•,±:MhilitY,RndbnrrrvonS,ooriepstrw4(hywanrtiicpatgaml�ln(yr_ndiipsntIII lSyifi:III F,a�oftamie rL-Lnrccreg ingtiV - lniteknif0n.!txABL/t1GIIVa,q:9roclf6n,a+xitxadngofrn;sdeanndlned5gynidlnn;su�f ANSIfTPJi,tluglltyClSlorin,DStl•Bga11dBCSfBplldtngComponont 18D235vAngleyWdgeRd Safutylntormatton.mntlhpta'frc{jt.Trus,fhet0_Iiglthttc,2tg,tA`Lcesimal.Sutienitait�".VA223t3. - — Chesredleld,M063017 - Job Truss Truss Type Qty PIY Vineyard View Building D 2nd,Floor 197921699 �5�74F3 F09 FLOOR GIRDER 1 2 _ Jnb Retaren__A final UniVdrsui Component Carp„ EAST HAVEN CT 06512 8,474s Aut 111,2017 MiTek Indusirles;Inc:;Wad Jul 24 16,39T7;614 f'a9e,11 ID:ndiRDAhLEUvo71ski6gAvyTyugda,FL1(E57gq V(k1JRkOOPt'LA*Oi; WaiiDrD29c*4 a 2-6-0 1-40 1-6-2 I Scale=1 2 Special 1 5x3 II 6x12 = 3x3 It 3x6 = 4x4 = 3x6 FP= 1,5x3 If 4x8 = 1 5x3 II 1 24 2 25 3 26 4 27 5 6 7 28 8 29 9 19 17 2D 16 15 21 14 22 13 12 11 23 6x8 = 3x6 II 10x16 = 3x6 I I 3x6 11 3x8 MT18H FP = 6x10 = 5x6 I I 3x6 FP= 16 d-2 9-8-2 Plate Oifs_ets_(X�Y1,=_4[ 4-s aJ,L&.Q.-1-8,Edge1, 13:0-3•a.M;D LOADING (psf) SPACING- 2-0-0 CSI. DEFL. in (loc) I/dell Ud PLATES GRIP TCLL 40.0 Plate Grip DOL 1,00 TC 0,61 Vert(LL) -0-16 14-16 >999 360 MT20 197/144 TCDL 12.0 Lumber DOL 1,00 BC 0.66 Vert(CT) -028 14-16 >696 240 MT18H 197/144 BCLL 0,0 Rep Stress Incr NO WB 0,72 Horz(CT) 0.03 10 n/a n1a Weight.169 Ib FT=20%F,1 f%E BCDL 10.0 Code IBC20151fP12014 Matrix-S LUMBER- BRACING- TOP CHORD 2x4 SPF No 2(flat)*Except* TOP CHORD Structural wood sheathing directly applied or 6-0-0 oc purlins, 1-6.2x4 SPF 210OF 1 BE(flat) except end verticals BOT CHORD 2x4 SPF 2100F 1,8E(flat) BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing WEBS 2x4 SPF No 2(flat) REACTIONS. (Ib/size) 18=3300/0-2-4,10=179010-4-6 FORCES. (Ib)-MaX.COrripJMax Ten -All fofcds 250(lb)or less except when shown TOP CHORD 1-18=-278!0,9-10=-27310,2r3=-969614,3-4=-9626/0,4-5=-822310,5-7=-567510, 7-8=-5675/0 BOT CHORD 17-18=0/6248,16-17=0/6248,14-16=0/8223,13-14=018223,11-13=0/8223,10-11=0/3150 WEBS 2-18=-6985/0,8-10=-354010,8-11=0/2837,7-11=-287129,5-11=-3088/0,5-13=011054, 3-16=-332810,2-16=014520,4-16=0/2053,4-14=-959/0 NOTES- 1)Fasten trusses together to act as a single unit as per standard industry detail,or loads are to be evenly applied to all plies. 2)Unbalanced floor live loads have been considered for this design, 3)All plates are MT20 plates unless otherwise indicated, 4)Provide mechanical connection(by others)of truss to bearing plate at joint(s)18, 5)This truss has been designed for a moving concentrated load of 250,01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads 6)Recommend 2x6 s"ngbacks,on edge,spaced at 10-0-0 oc and fastened to each truss with 3-10d(0.131"X 3")nails- Strongbacks to be attached to walls at their outer ends or restrained by other means. 7)Hangers)or other connection device(s)shall be provided sufficient to support concentrated loads)3138 Ib down at 4-2-8 on top ��OF"� jam,r chord. The design/selection of such connection device(s)is the responsibility of others. t'1 B)In the LOAD CASE(S)section,loads applied to the face of the truss are noted as front(F)or back(B), NA GAFjC/ LOAD CASE(S) Standard 1)Dead+Floor Live(balanced):Lumber Increase=1,00,Plate Increase=1 00 Uniform Loads(plf) r- Vert•10-1B=-20,1-9=-104 W' Concentrated Loads(ib) 0 1, Ve3=-3058(F) rn� Vert pSSIQNA� + July 24,2019 ®WARNING-Verrfydestgn Parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE AIII-7473 rev.1010312015 BEFORE USE WIN �, Dtslgn,vniid,trtusu Only tvk0111170b connecicro.thio dliOfln 14;horod,mlyy,iijn a[ami�tnrs shaym,sntl'14 twon Indlyidual bid dlna'caruponanl,not t a trues syslwn:Buioi1)tuo,III bWid'ma da�ianc�nimt V0 lily oto amlicami y of dertgn yoranrotdrn and property Incorp Talo Ihfa.4009n Into trio 0v6rall htriiding,desslpr;iliac ng lnd°cpttti is 14Proydirl,tru krinp pt ndMddnl ihlsssrmb at soar ciFartf Int be+3 et�1Y.I�Jrlillary(I Inrnp4rary amI permanent tuatlnQ is iNw�ryr.,ro+itin:d rnr�inttllay and to vmvta'l vobpr.,•%4W passtbio poro0ribl 111,ury.ancl'proporldomac�4.For ganatrdgttldanGq rognr4fin0 flus faanatuon,olcrogv.dofivory.eJaa;an and MOrirsg qt irdsscg anti du3u Byyinnia, lad__ A.R.TYP11 Quality cdletin,DBMS---ul QCSt Uuadi!sq Component � 16023 Swingley Ridge Rd -Snroly forarmii1lom amilable vow' ns Pinto li>-b uta,218 M Lea Siren/.5uhc 312,/Vmeandria-'VA22314. $�Chesterfield MO 63017 Job, russ Truss Type - Qty`- ply VJi1@yprd View Building D 2t{tt Fit1Uf 137921900 35878F3 Flo FLOOR GIRDER 1 __ 2 Jabil Relererierio ila'rnTl - Universal Component Corp.,, EAST;HAVEN CT 06512---"--" - -`-" - - _-' `-8,01115'Atrg i t 2017'M17afk,I6dualr14'Irir_Wed 4u)2416 39M_20'l9Tage-1 va td)RDAhL I)ti12ij 7P)u� Y171605RdIGf1'0Y5Y[G 03FiWN1ylzty005C3zcCgy66LZ_ 2-6-0 Or 1-3-0 2-4-8 19-10 I Scale=1:28.9 2x4 II Special 1,5x3 II 6x8MT1SH = 56 = 04 = 4x4 = 3x6 FP= 1,5x3 11 4x8 = 1,5x3 II 1 26 2 3 27 4 28 5 29 6 7 8 30 9 31 10 ,JMI ff „ m , 21 1918 22 17 16 23 15 24 14 13 12 25 8x8 II 3x6 II 6x6 = 3x6 II 3x6 II 6x10 = 5x6 II 5x6 11 3x6 FP= 3x8 MT18H FP = 16-8-4 - - -- -�_ Pta,e Offsets"(X.Y.) [2 Q R=B'Edoe] (3:0-i�Fl 0 0=01 LOADING (psf) SPACING- 2-0-0 W CSI. DEFL. in (loc) Well Ud PLATES GRIP TCLL 40,0 Plate Grip DOL 1.00 TC 0,63 Vert(LL) -018 15-17 >999 360 MT20 1971144 TCDL 12,0 Lumber DOL 1.00 BC 0,58 Vert(CT) -0,28 15-17 >698 240 MT16H 1971144 BCLL 0.0 Rep Stress Incr NO WB 0,75 Horz(CT) 0.03 11 n/a n/a BCDL 10.0 Code IBC2015ITP12014 Matrix-S Weight'195 lb FT 20%F,11%E UMBER- -BRACING- DP CHORD 2x4 SPF 2100F 1.8E(flat) TOP CHORD Structural wood sheathing directly applied or 6-0-0 oc purlins, BOT CHORD 2x4 SP 2400E 2,OE(flat) except end verticals: WEBS 2x4 SPF No 2(flat) BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing REACTIONS. (Ib/size) 20=3349/0-4-6,11-184710-4-6 FORCES. (Ib)_Max.Comp./Max,Ten.-All forces 250(lb)or less except when shown-,t TOP CHORD 1-20=-270/0,10-11=-273/0,2-3=-6530/0,3-4=-6530/0,4-5=-10262/0,5-6=-8614/0,6-8=-5892/0,8-9=-5892/0 BOT CHORD 19-20=0/6530,18-19=08530,17-16=0(10262,.15-17=018614,14-15=0/6614,12-14=0/8614,11-12=0/3261 WEBS 2-20=-730110,2-19=012423.9-11=-3663/0,9-12=0/2957,8-l2=-285f7,6-l2=-3043/0,3-18=0/895.4-18=-5117/0. 5-17=0/1852,5-15=-888/0,6-14=0/940 NOTES- 1)Fasten trusses together to act as a single unit as per standard industry detail,or loads are to be evenly applied to all plies. 2)Unbalanced floor live loads have been considered for this design 3)All plates are MT20 plates unless otherwise Indicated. - 4)This truss has been designed for a moving concentrated load of 250,01b live located at all mid'panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 5)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 oc and fastened to each truss with 3-1Od(0 131"X 3")nails. Strongbacks to be attached to walls at their outer ends or restrained by other means. 6)Hanger(s)or other connection device(s)shall be provided sufficient to Support concentrated load(s)3223 ib down at 4-4-10 on top chord The design/selection of such connection device(s)Is the responsibility of others. - 7)In the LOAD CASE(S)section,loads applied to the face of the truss are noted as front"(F)or back(B) LOAD CASE(S) Standard 1)Dead+Floor Live(balanced).Lumber Increase=1,00,Plate Increase=1.00 Uniform Vett 11P20=-20,1-10=-104 Concentrated Loads(lb) ! Vert:4=-3143(B) * •� r: ' CC + W, �RafiES S oN�� July 24,2019 i ®WARNING,Verlty;desrgn parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE Nit-7473 rev.10/_3/2095 BEFORE OSE: - l ditd(I "I d auuaa_Ey&Yah'L'eotdrti'una ttiuriaitrth/gdodlilner,ouerywii�tivrrappticaElityoidaalpn-ria!ameteisaadpronnrjt,IricosnarltaWsdaNOjlrntn,ihnpagnh twrt�l {isi8n;'8_*1 Odtcalnct ld to MgvenUad;ilirig 4111id[atdunl tiva wab dridl9r;c9rard r•,`cfithcis anly.;l�d U�aat tol�poraty and phimtinont braang �(�'eil�_ 'isalwayarnv�tedtoFdla�lify-wrdtooraw,nCcntlmliaFirvntllpas�Weperaonati4Nry-,andnranayty,damo9a;P,n1`4r?9Am►Outdnnras,recarifmnq+a; fOpp'coifoa;�laragO.dalNery;eiOil(•onaridluacri8ofdut3esaadtitrastXslur�.,.aee AN�tRPllqudtityCHtatio;t1S688eadgC918ulhtlnQComponent 16023SwingleyRdgeRd 'safety alorm6fton a6aUnbl®frOirt:Yrllsn Plakd inytlluta;2!$N.'L.ae Speal.SEAQ 312,Alexandria,VA 22314,-' � ' ' ' Chesterfield,MD 63017 Job Truss Truss Type my Ply Vbleydrd View 8 Iditj9 D 2nd Floor �9 137921901 3�g7pF3 F11 Floor Girder 1 2 JOb RCfetttnca{upilanal-_ Universal Component Corp., EAST HAVEN CT 06512 8,01t),s'Aug 11 201'/MiTttk tndttstrles,Inc. Weil Jt1124 i6.39:392o-19 Page d Q;ndlRlil+►iLEU4i;?PiciBgA4ytYu�tda%ltiknPlti'BRC6z5Hdb6V1nRV8hGXNtnfy5a109WhgIGyu0LY Scale=1'2: Special Special Special Special 1x3 11 410 = Special 1.5x3 II Special 1.50 II Special 4x10 = Special 1x3 II 4 Speaal 21 22 5 23 6 3 18 19 20 1 14 15 16 2 17 10 4x10 = 11 9' 12 .0 4x6 _ 13 7 4x10 = 4x6 = 3.4,10 -13.4-10' Ptale Olfsetsµ(X Y� _(7:Etitje.0-3.81.-(830.1-S.Edgisl;i9:0-1•II,Edye` 10:EsiDB t3 t.8 - - - in loc I/deft L!d PLATES GRIP DEFL. LOADING (psf) SPACING- 2-0-0 CSI. ( ) TCLL 40,0 Plate Grip DOL 1.00 TC 0,94 Vert(LL) -0.31 7-8 >520 360 MT20 197!144 TCDL 12.0 LumberDOL 1.00 BC 0.73Vert(CT) -0.46 7-8 >343 240 CT BCLL 0.0 Rep Stress Incr NO WB 0.63 Ho� ) -0.05 10 n/a n/a Weight:98 Ib FT=20%F,11%E BCDL 10-0 Code IBC2015rrP12014 Matrix-S LUMBER- BRACING- TOP CHORD 2x4 SPF 2100F 1.8E(flat) TOP CHORD Structural wood sheathing directly applied or 6-0-0 oc purlins, BOT CHORD 2x4 SPF 2100F 1.BE(flat) except end verticals WEBS 2x4 SPF No,2(flat) BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing, REACTIONS. (Ib/size) 7=3162/Mechanical,10=3247/Mechanical FORCES. (lb)-Max,Comp 1Max.Ten.-All forces 250(lb)or less except when shown. TOP CHORD ' 1-10=-56510,6-7=-333/0,2-3=-788510.3-4=-7885/0,4-5=-7886/0 BOT CHORD 9-10=0/4952,8-9=0/7885,7-8=0/5272 WEBS 5-7=5983/0,2-1 0=-662010,5-8=0/3033,2-9=013379,3-9=-1392/0,4-8=1437(0 NOTES- 1)Fasten trusses together to act as a single unit as per standard Industry detail,or loads are to be evenly applied to all plies 2)Unbalanced floor live loads have been considered for this design., 3)Refer to girder(s)for truss to truss connections. 4)This truss has been designed for a moving concentrated load of 250.Olb live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 5)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 oc and fastened to each truss with 3-10d(0.131"X 3")nails Strongbacks to be attached to wails at their outer ends or restrained by other means. 6)Hanger(s)or other connection device(s)shall be provided sufficient to support concentrated load(s)598 Ib down at 0-6-12,594 lb down at 2-2-12,594 Ib down at 3-10-12,546 Ib down at 5-6-12,527 Ib down at 7-2-12,572 Ib down at 8-5-12,594 Ib doom at 9-2-12,and 594 Ib down at 10-4-12,and 594 Ib down at 12-0-12 on top chord. The design/selection of such connection device(s) is the responsibility of others. 7)In the LOAD CASE(S)section,loads applied to the face of the truss are noted as front(F)or bade(B) of NE�.y LOAD CASE(S) Standard 1)Dead+Floor Live(balanced):Lumber Increase=1.00,Plate Increase=1,00 ,JPS�'AC�9�X, Uniform Loads(pif) Vert:7-1 0=-2 0,1-6=-104 �+ Concentrated Loads(lb) Vert 4=-527(F)14=545(F)16=-527(F)17=-527(F)18=-527(F)20=-527(F)21=527(17)22=-527(F)23=-527(F) Wrn t�• z 2�0� 0,--080 ociN �QpEss%0`0 July 24,2019 ®WARNING-Verfry design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE M11.7473 rev 10/03/2015 BEFORE USE upon paand 17 fur d¢'IndWto3i bio n �• t)os,�n,w.dld,lru use only with M17alsm�0nhtcliva.lhx duflgn L bnad enlfl rv:ntliara shown, dl a Com rm 1 A¢ R,not a trona¢y5tctn.6ofWn"dsc-Oio O¢iGlinB d¢,#yno:mustvnn(y U±¢nppllcahti'Qy'¢f tlos'n pwumvlxvsand t iopRdY Inc�[ticir:+le alis datilOr Inlo,lhc wcrnii_ tt p�; tuft npdayf,t,6rav�Jdld wit7lctap C.Kibler;�otl, :Lr^itS4^tYCb�nflnrLAJr,MSersa�Y.'AddllF¢nnitenipaarynnd)esrnuanrattbrawrp 14,+giTek• is11, otwnyt;iegvrodto,¢luliii6lyand toptovCrn!'wtiuysn,wdrtyossiWoporsonldinjury andyrapfldy iafl*3•FOtttcn¢fit d d0313.8,�rUtracsi 16023swin le RidgeRd fabdcNion.ofaaflv"de[rueryry IIMCIICn rind t`rAitnD of llus is iitr0 huFssy31ant3.see- -ANsUMI QUM ty Crud- 3.D3D•89 and SCSI Buila1ng Component B Y SMoty informotion'tivalinSrl4 from Tfu3s Ptnth tn¢iltuta.218 iV!Lan S114nt.b4{to �{2,Nuxwsdiio,Vn T1524;-- - Chesterfield,100 63017 JobSntsS truss Type - Qty Ply Vineyard View 001ding D 2nd Floor 137921902; 35970F3 F12 Floor 1 1 Jali,Refirence,optlobal) - Universal Component Carp,,, EASTHAVEN'C708512' --- 8,0i0:9'Aud1120f7MiTek,IndijGWd3„Ino, W04Jp12416:39A02019_P5ge-1- " ' Ili:ndlRQQhLEUpo7Pk(BgAvyTyugd��witnsuJ)zQSJunAt3Wyk6p8rjkA2Gy6vtwaSiHiyuoLX 2-6-0 0 1-0-8 Scale-1/2'=1' 1x3 11 3x6 = 1x3 II 3x3 = 1x3 II 3x6 = 10 II 1 19 2 20 3 21 4 22 5 23 6 24 7 w IN t, 14 12 15 11 16 10 17 0 18Sll 4x4 1x3 II 44 = 1x3 II 3x6= 4x4 = - - 14.3 B` Plate Of(Set f'(�Y] 1-8j,'111:04-8:Ed9je_ 3 EdSe40-1 R1 - - - - - - -- - LOADING (psf) SPACING- 1-8-0 CSI. DEFL. in (loc) I/deft Ltd PLATES GRIP TCLL 40.0 Plate Grip DOL 1.00 TC 0,52 Vert(LL) -0,34 8-9 >504 360 MT20 1971144 TCDL 12.0 Lumber DOL 1.00 BC 6,53 Vert(CT) -0.42 8-9 >405 240 BCLL 0.0 Rep Stress Incr YES WB 0.28 Horz(CT) 0.02 8 n1a n/a BCDL 10.0 Code IBC2015frP12014 Matrlx-S Weight,62 lb FT=20%F,11%E UMBER- _ BRACING- JP CHORD 2x4 SPF No.2(flat) TOP CHORD Structural wood sheathing directly applied or 6-0-0 oc purlins,, BOT CHORD 2x4 SP 285OF 2.3E(flat) except end verticals. WEBS 2x4 SPF No.2(flat) BOT CHORD Rigid ceding directly applied or 10-0-0 oc bracingr REACTIONS. (lb/size) 13=732/0-4-6,8=73210-4-6 FORCES. (lb)-Max,CompJMax.Ten.-All forces 250(Ib)or less except when shown,- TOP CHORD 1-13=-27110,7-8=-271/0,2-3=-1831/0,3-4=-183110,4-5=-1809/0,5-6=-1809!0 BOT CHORD 12-13=011 179,11-12=011179,10-11=0(1831,9-10=011631,6-9=011133 WEBS 2-13=-1 33110,2-12=01300,2-11=0(762,3-11=254118,6-8=1 28610,6-9=01767,5-9=316(0,4-9=-2431282 NOTES- 1),Unbalanced OTES- 1),Unbalanced Ijo0e,llve toads Have been consider ed for this design, - 2)-thla"i5 has-been desighed,itira moving Concentrated load of 250.DIb Ave located at all mid panels and at all panel points along 1640,p Chord and EI[lam Chard,noncancurrent v:llii any rather live loads, 3)Recommend 2x6 strongbacks,on edge,dpabed of 10-0=0'oc at7d fastened to each truss vinth 3-10d(0 131"X 3")nails. Strongbacks to be attached to walls at thalr outdr ends or restrained by other means. o� N�A o P c�„ •i w ILIs 9a = slgNP July 24,2019 Y/1RJIi�It7.Yeril��t+ipn pdr.�nterm;and PrAll J:O7E'�4?N t7ffS�tlllj iYJ4tflilL'A btfitf(R$FSRE�dCS PdG>:',A}IJ.Td:.!tvv.10R4I;10JSkiFFPr�,UGC t3esl6nvgndlvi,esnoifyv/dtiht7aY;+�3amnsct>�rs,TI+S¢Gi�lpnl�hase�aNy,ilFanlurr.Ur�ulduE0.titrHP,andlsmrnnludlwddatbuadJngcamlwaant;not 'a UuKs'syrltun;Uelota usu,Iho ttolldlhg daetgrkor,MUtt dnlity_iho uppr,bOtt�ty afdotdpn pnmmntsut!uitQlarapnry rncnraihln II�;Jtk3lgn hdo th0,av6:a11' bldldln$dnalgn,0rncjnpiddtcalnaiafoprunrfuthurckllnp,gfihdeitlup4trus,weualtdlnr.chnrdmrntic+soply Addlpo9rllompwauyocufpairaannnbbracigp ; MiTek' lsnlwny5requlrad,tr:.>EluhWlyard+iipreyorilcofltlp9ov81Jr`rrdssWaprorao�udinjuryand'niopndyNnmMo.roe oneratpuidoncCM91"Uh4+ 1" I fobairprlgn,siorftk dnlNerynrmc on and bmanp ajtmasso and if,Usa tyrtdtn:,zue •XNl�I1TPl1 quopty Ciltor(n;09H•89and BCSI 6o8ding Corytponent 16023 Swingley Ridge Rd Snlnly tntotm'nttditrivnda6Jo to+n.7[usa P1etc In9l+WIc..218 N.!ee SVcat.SC4sc 3i2.'Naxnr�rfo,V/�2231d,-' _ �.Chesteifield,MO 63017 - russ Type Qty Ply inuyafd View Building D 2nd Floor 3011 runs137921903 35970F3- F13 I,[ LOOR 1 _ - , ob_Refis soca 0 Urine; --_ Universal Component Corp„ EAST 14AVEN-CT 06512 8,010 s Aug-11 213,17 MITe84nduslfts,Inc. Wed JUT 24 16:39:47 2010Page f' •1DindIR,DAIiLG_UvQ7PhI9gA" 'ui1da.-67u94EALk)DA%�)d ACTylt011 vOPwZYOS8EBGp9Yu0LW Scale=1.315 4x4 = 15x3 II 3x10 = 1.5x3 II 4x4 = 1.5x3 II 3X6 FP= 1.5x3 II 3x10 = 1,5x3 11 1 22 2 23 3 24 4 25 56 7 6 26 9 27 10 Ci 17 16 20 15 14 13 12 21 11 1 19 4x6 11 3x6 FP= 6x6 = 5x6 II 5x6 11 6x8 = 3x6 FP= 3x6 it - Plate Offsets(X'.Yj- (6:0.1-$.Edoel"(14:0 30,0.0.0] f15'.Q•3 O,Edglej -- _ LOADING (psi) SPACING- 1-8-0 CSI. DEFL. in (loc) Well Ud PLATES GRIP TCLL 40.0 Plate Grip DOL 1.00 TC 0 A9 Vert(LL) -0.16 15-17 >999 360 MT20 1971144 TCDL 12.0 Lumber DOL 1.00 BC 0.50 Vert(CT) -026 15-17 >846 240 BCLL 0.0 Rep Stress]nor YES WB 0.37 Horz(CT) 0,03 11 n/a n/a Weight 92 Ib FT=20%F,11%E BCDL 10.0 Code IBC2015(TP12014 Matelx-S LUMBER- BRACING- TOP CHORD 2x4 SPF No,2(flat) TOP CHORD Structural wood sheathing directly applied or 6-0-D oc purlins, BOT CHORD 2x4 SPF No,2(flat) except end verticals. WEBS 2x4 SPF No,2(flat) BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing, REACTIONS. (db/size) 18=938/04-6,11=938/Mechanical FORCES. (lb)-Max CompJMax.Ten.-All forces 250(lb)or less except when shown: TOP CHORD -1-18=-270/0,10-11=-270/0,2-3=-2673/0,3-4=-2673/0,4-5=-320810,5-6=-320810,6-8=-266310,8-9=-266310 BOT CHORD 17-18=0/1585,15-17=0/3171,14-15=0/3208,12-14=0/3208,11-12=0/1579 WEBS 2-18=-1781/0,2-17=0/1222,3-17=-29310,4-17=-56018,4-15=-2191301,5-15=-4091378,9-11=-177410,9-12=0/1218, B-12=-294/0,6-12=-684132,6-14=-4531453 NOTES. 1)Unbalanced floor live loads have been considered for this design. 2)Refer to girder(s)for truss to truss connections,. 3)This truss has been designed for a moving concentrated load of 250,01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads, 4)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 oc and fastened to each truss with 3-10d(0.131"X 3")nails. Strongbacks to be attached to walls at their outer ends or restrained by other means, 'C -OF NE Y- �P 14A tu July 24,2019 I®WARNING-vewy design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE 11111.7473 rev.10/03!2015 BEFORE USE � _pesl0n,ttaln{Ica usa wrly v�utt V'J7ak�3 chrtnai%ata.Tido da53eJd to L�tCruJ egty Upon,parsn;otore thnwn,and td 1w at)ittoivirtuad auBdtAO egrtlpanenl,oat a inrss sy Am,B91arn use.,tho 66ddma desipnar mmol van Iha«nMle rlilNc/btdustnn tl;in.mtoGirs antl ltruptlriy lna�+poni!a it a daJ@n L710 p a ovbr�ll - �JI��IC «4'crilc0np dc.tpq Bractnp 4nant3d tR to plovap(hockUna o1,Individ'u0I irUsa'wab n+ld.+ot eh2r4 Mombarz only ndddlo±v+l tamt>ornry and permanentkmagp ;eGukc l tar strh t t;as^1a�evRnt m tapsa�Mni tr34rsitdn pera4oni t n ry and ntrj any do tiu}o.Foth nnerd t guidance 89 Lin nit thn. Ulidcnti�n;zitmrspe,dalWdry,creutan'tiisd b1pUt+9 d Uusse�attd ItuoY ay6tama,boa- ,ANSUTPIi,Qdality'Critona 088419 and SCSI 13ufldln0 Component Chest Sield, y Rdga Rd aatoty Informotion avnilahtR/rbm Truss plate i�lirvta,218 N•Lea SueoL 5utrn,312,AlaxanclN�,VA&23f4. _ Chesterfield,MO 63017 Job — .Truss - - Truss Type - - -- ply"-- Py "VlnGyard View Suilding,D.2nd 3597OF3 IF15 Floor 1 1 I37921904 ' tYoterence(optional) Universal Component Corp., EAST,HAVEN CT;06S12• — -- --- - 8.010 s Aug 1.12017 MiPek ln8ustriesrintz.4Ved Jul 24 16,39A2 2019 Page 1 ID.ndiRDAhLEUvQ7PkiBgAvyTyugda-bJSYHaAzV1LO85KhBx7CGEE9m kelOrbNuxpLbyuoLV I 2-6-0 Scale=1 27,7 1.5x3 II 3x6 = 1,5x3 II 4x4 = 44 = 3x6 FP= 1.5x3 II 3x6 = 1,5x3 II 1 21 2 22 3 23 4 24 5 6 7 25 8 26 9 - w rr~ 9 17 15 14 13 18 12 19 11 20 10 44 = 3x8 = 3x8 MT18H FP = 1x4 It 1x4 11 3x8 = 44 - ---___- - - — -1 — - - - - -) - - 166.-3 Plate.0itset"s{X,Y}»_ [,4:0-1 B; eL(5:0%14Edgej� LOADING (psf) SPACING- 1-8-0 CS1. DEFL In (loc) I/deft Ud PLATES GRIP TCLL 40,0 Plate Grip DOL 1 00 TC 049 Vert(LL) -0.34 15-15 >572 360 MT20 197/144 TCDL 12.0 Lumber DOL 1.00 BC 0,53 Vert(CT) -0.43 15-16 >452 240 MT18H 2441190 BCLL 0.0 Rep Stress Incr YES WB 0;31 Horz(CT) 0,03 10 n/a n/a BCDL 10.0 Code IBC2015rrP12014 Matrix-S Weight,70 Ib FT=20%F,11%E LUMBER- BRACING- TOP CHORD 2x4 SPF No.2(flat) TOP CHORD Structural wood sheathing directly applied or 6-0-0 oc purims, CHORD 2x4 SP 285OF 2.3E(flat) except end verticals IS 2x4 SPF No.2(flat) BOT CHORD Rigid ceding directly applied or 10-0-0 oc bracing. REACTIONS. (lb/size) 10=835/Mechanical,16=83510-4-6 FORCES. (lb)-Max CompJMax,Ten,-All forces 250(Ib)or less except when shown. TOP CHORD 1-1 6=-27010,9-10=270/0,2-3=-217910,3-4=217910,4-5=-2466/0,5-7=-2179/0,7-8=-2179/0 BOT CHORD 15-16=011323,13-15=0/2465,12-13=0/2466,11-12=0/2466,10-11=0/1323 WEBS 2-16=-150110,2-15=0/972,3-115=-304/0.4-116=4611160,8-10=-150110,B-11=01972,7-11=-30410,5-11=-461/160 NOTES- 1)Unbalanced floor live loads have been considered for this design 2)All plates are MT20 plates unless otherwise indicated, - 3)Refer to girder(s)for truss to truss connections, 4)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels,and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 5)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 oc and fastened to each truss hath 3-10d(0.131"X 3')nails. Strongbacks to be attached to walls at their outer ends or restrained by other means. OIFNEty.Y r- - � tea• Q w y0.090d9� l4� July 24,2019 { ®WARNING.Verify design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE Mll-7473 rev.!0!03!2015 BEFORE USE Design valid for use only with MITek®connectors This design Is based only upon parameters shown,and is for an Individual building component,not �• a truss system.Before use,the bulldmg designer must verify the applicability of design parameters and,properly incorporate this design into the overall NNW budding design.Bracing Indicated is to prevent buckling of individual truss web and/or chard members only,,Adddional temporary and permanent bracing IY[��.�te' is always required for stability and to prevent collapse with possible personal injury and property damage,For general guidance regerdmg the ' fabrication,storage,delivery,erection and bracing of trusses and truss systems,see ANSIrri ll Quality Criteria,DSB-69 and SCSI Budding Component i 16023 Swingley Ridge Rd Safety Information available from Truss Plate Institute,218 N-Lee Street,Suite 312,Alexandria,VA 22314, Chesterfield,MO 63017 job Truss Truss Type Qty Piy VOfeyOrd'Vjew Building D 2nd Floor 137921905 3887&3 F16 Floor Supported Gable 1 1 i __ _ Job Relorenca(apdonal) -Unwersal Component Corp., El1ST HAVEN CT 06512 8.010 s Aug 11:2017 M7ek1ndustrics,InC.Wed Jul 2b 16'3973 2019 Page 1 ID.hdl§f)1 hLEUv07Pk1BgPvyTyugtb-ZVOvrV,wBbFl TllFvtllWRtlRfof FOAElxo cYoI tilyuoLU 1 1x3 II 9 2 1x3 II 10 3 1x3 II Scala 1: i 19 J. �. �K�Y.L...~`�'-' ,�=��i��x!�U.°.�tx`k'rvrvpA� Y>�-et:�>�rKe•YA-`��`�x✓'��'�3'i '��TS^ 'xy P�i .1,r�`F'jYt�' {f'ax.�c:_:yff Iyn�•:f t'f r�N4.yr� 6 j 5 8 4 1x3 li 1x3 I 1x3 11 2.11.6 Udefl Lld PLATES GRIP LOADING (psf) SPACING- 2-0-0 CSI. DEFL. in (loc) TCLL 40.0 Plate Grip DOL 1 00 TC 0.18 Vert(LL) n/a n/a 999 MT20 1971144 TCDL 12.0 Lumber DOL 1.00 BC 0.19 Vert(CT) n/a n/a 999 BCLL 0.0 Rep Stress incr YES wB 0,03 Horz(CT) 000 4 n/a n/a Weight 10 Ib FT=20%F,11%E BCDL 10.0 Code IBC2015rrPI2014 Matrix-S LUMBER- BRACING- TOP CHORD 2x4 SPF No 2(flat) TOP CHORD Structural wood sheathing directly applied or 2-0.6 oc purlins, BOT CHORD 2x4 SPF No.2(flat) except end verticals. WEBS 2x4 SPF No.2(flat) BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing. OTHERS 2x4 SPF No.2(flat) REACTIONS. (Ib/size) 6=72/24-6,4=51/2`-4-6,.5--15412-4-6, Max Grav 6=276(LC 10),4=264C 12),5=305(LC 11) FORCES. (lb)-Max.CompJMax Ten.-Ail forces 250(lb)or less except when shown. TOP CHORD 1-6---263/0,3-4=-258115 WEBS 2-5=-276/0 NOTES. 1)Gable requires continuous bottom chord bearing 2)Truss to be fully sheathed from one face or securely braced against lateral movement(i.e.diagonal web). 3)Gable studs spaced at 1-4-0 oc 4)This truss has been designed for a moving concentrated load of 250.0lb live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 5)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 oc and fastened to each truss with 3-10d(0 131"X 3")nails,, Strongbacks to be attached to walls at their outer ends or restrained by other means. �01F GgRc�q Lu 9�'ESS1o��'� July 24,2019 ®WARNING-venfy design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE 01-7479 rev.1010312015 BEFORE USE. rao Drlstgivvarid lot ttso oniy,61h M{owcapnocicra.7hic deaipnir hog a+Y}yupan Rammofar�nitoYm,phd ii,rw int lralflriihutl L^�lld3rzg {umom"I a tntsa SpNitrm,Bu{dre Use,III Lulkiing da9i0ner mus!��r�ty ine,appll60011ty at d'�qn pamatoiota and preparly picor0iblo 0418 design In 0 iho m oral/ IiulldinryC�akin.'8nctrgin&dntedlaloprovanlottcWn`ilindivldunl4uss veb utdlarchoidmainbcroanty,ldrUlinn1111flniponcryulti3 rriunonitvnrJtjO �T�!( iaal,omysroqutrad,forslviaMyAwl+,uronventcollopsnwi0:pawnihiopcmnnallnla=yendprcpertydamdga Foxijonnudguidance repainglnn16023 letxlcatbn,67Cn.�,081ivp7p„onJc:bn and tMind orhuSSos and uuss'syatexna,enc -ANSiI[PIi�9ap1 ry Crltnryn,W''A•5�antlUCS1 fl_ulitjlnp Compononr � Chesterfield,lMO 6301 Rd -s�fatp lnfarmullon`jvIllablo t(&#Tnj5r$R v Intdiutc,2164.1ao Street,SuRa 312.Af iyand9a VA-22314, - - _ Jd sTrus s Truss Type _ Qty Ply Vineyard View Building D 2nd Floor 137921906 359.10F3' F17 FLOOR 7 1 Job Reference_foot(onall- - Universal Component Corp.,, EAST,HAVEIQ CT,06512 —"-T' — i8.0t0 s Aug 11 2017 MTek Industries,Ipc,WdVJfil24 16:39:44 2019 page'1+ ID.ndiRDAh LEUvQ7PkiBgAvyTyugda-Xha IIFCDOebkNOT41Mi gLfJSRnPumuXugCQwQUyuoLT I 2-6-0 0 P Scale=1 36.3 1.5x3 ll 3x6 FP= 1.5x3 II 48 = 1.64 II 4x4 = 1 5x3 II 4x4 = 1.54 II 4x8 = 1.5x3 II 1 24 2 25 3 26 4 27 5 6 28 7 8 29 9 30 10 31 11 � 1 20 18 17 21 1615 22 114 13 23 1 5x6 11 600 = 3x6 FP= 4x6 II 3x6 FP= 6x10 = 5x6 II 4x6 It 2041=$'_ -- - — 4 Plate Offsets�X,Y1= 115:0-3 O.Etlge] 116'0 3•U Edas1 - =---- =— - — LOADING (psf) i SPACING- 1-8-0 CSI. DEFL. in (IDc) I/defl L/d PLATES GRIP TCLL 40.0 Plate Grip DOL 1.00 TC 0.60 Vert(LL) -027 16 >923 360 MT20 1971144 TCDL 12,0 Lumber DOL 1.00 BC 0.61 Vert(CT) -0.42 16 >594 240 BCLL 0.0 Rep Stress Incr YES WB 0.43 Horz(CT) Q.05 12 n/a nla BCDL 10.0 Code IBC2015/TP12014 i Matr)x-S Weight 104 lb FT=24%F,11%E LUMBER- _ — _`- BRACING- -P CHORD 2x4 SPF No,2(flat) TOP CHORD Structural wood sheathing directly applied or 5-3-0 oc purlins, CHORD 2x4 SPF No.2(flat) except end verticals,: iS 2x4 SPF No2(flat) BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing REACTIONS. (Ib/size) 19=107610-4-6,12=1075/0-4-6 FORCES. (Ib)-Max.Comp/Max Ten -All forces 250(lb)or less except when shown TOP CHORD 1-19=27010,11-12=-270/0,2-3=-320810,3-4=-3208/0,4-5=-4285/0,5-6=4285/0, 6-7=-428510,7-9=320810,9-10=-3208/0 BOT CHORD 18-19=0/1853,16-18=0/3978,15-16=0/4285,13-15=0/3978,12-13=0/1853 - WEBS 2-19=-2082/0,2-18=0/1522,3-18=-292/0,4-18=-866/0,4-16=-85/564,5-16=-3181178, 10-12=-208210,10-13=011 522,9-113=29210,7-13=-866/0,7-15=-85/564,6-15=-318/178 NOTES- 1)Unbalanced floor live loads have been considered for this design 2)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads, 3)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 oc and fastened to each truss with 3-10d(0 131"X 3")nails, Strongbacks to be attached to walls at their outer ends or restrained by other means, n 5 col _0'68-01D July 24,2019 WARNING-Verify design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE M11.7473 rev.10103/2015 BEFORE USE. ,paslgn VnOdtra usb nnlywgM h4tTa, r;Rmcctcrs.l7vrs nlOsign Is'bcvsed Keil uprifl PvaUtnelerssh04ln,dnd 19 kr an IddivlddUuq[tdln COnINneni;1101' tilry5aekalrni8010' Utln,Illypllldiiy1d061gnnFTnU64vonfyUReppltaitillyafdag%On nimotelaandpropMiyirtw orniuIidt,dtiU InterthuCVer1g. waa(nnde�an.B(nrartgSndicatcdi0toatoWr4ttirk1ln(at titivdonitrus atibestJlvrdwiilntiirttiei3oidy:AddlUvhallo'mp»ruyahgpe'tmelta0thndng t' ��' tS uiwayraqui!rd[or dtabUity ulyd tnprovci,fcaiiuysscfiv gr tws titu yoreunut u,iu y'nnd ulanom/dnmoga Sargvnern4qufrlgncv,tcgaWu p Bla fadrrivvl!n;n!vragv,ddt vcuyXraretfinn onQ,hnen of IteS3 eS 6116 nUST"by91tlt11U,eco AN51ffM1 Quality Crltorla;DSB•S9 and BCel Bulld�n0 Comvonent j" 16023 Svnngley Ridge Rd Bnfjffy 1pformnflon i{vnE, krM,T1vs5 PIn1e ina)hltc 218 tV,Lve Stronl.Saila 312;/lfcxnlnfr(a;VA 72314. - _ j Chester<eld;M0 63017 Jobs—toss Truss Type Qty P,iY 'Vineyard View Building D 2nd Floor 137921907 35970F318 FLOOR 11 1 Job Reference o tionall Unweraal Component Corp., EAST HAVEN CT 06512 l 8 070 s Aug 11 2017 MITek Industries,Inc. Wed Ju 24 16,39.46 2019 Page 1 ID ndIRDAhLEUvQ7PklBgAvyTyugda-T4127xETYGrScidSQn38R4OpPb4WEn7BIWv1UMyuoLR 2-6-0 0-0-6 Scale=1, n 1 5x3 11 3x6 FP= 1,5x3 II 4x8 = 1,5x3 II 4x4 15x3 II 44 = 1 5x3 11 48 = 1.5x3 II 1 24 2 25 3 26 4 27 56 28 7 8 29 9 30 10 31 11 ZE x1 0 '7 17 21 16 15 22 14 13 23 $2 20 18 — = 4x6 I I 3x6 FP= 6x10 = 5x6 11 5x6 11 6x8 3x6 FP 4x6 II 20.9.6 - Plate Offsets(X,Y)�- [15:0. 4-dgejL i6{�0-3=0.gd - LOADING (psf) +� SPACING- 1-8-0 CSI. DEFL in (loc) I/defl L/d PLATES GRIP TCLL 40,0 Plate Grip DOL 100 TC 0,57 Vert(LL) -0.26 16 >944 360 MT20 197/144 TCDL 12.0 Lumber DOL 1 00 BC 0,60 Vert(CT) -0.41 16 >608 240 BCLL 00 Rep Stress Incr YES WB 0.42 Horz(CT) 0,05 12 n/a n/a Weight-104 Ib FT=20%F,11%E BCDL 10.0 Code IBC2015/TP12014 Matrix-S LLIMBER- BRACING- TOP CHORD 2x4 SPF No2(flat) TOP CHORD Structural wood sheathing directly applied or 5-4-10 cc purlins, BOT CHORD 2x4 SPF No-2(flat) except end verticals WEBS 2x4 SPF No,2(flat) BOT CHORD Rigid ceding directly applied or 10-0-0 cc bracing REACTIONS. (Ib/size) 19=1067/0-4-6,12=1067/0-2-4 FORCES. (lb)-Max Comp./Max Ten -All forces 250(lb)or less except when shown TOP CHORD 1-19=-270/0,11-12=-27010.2-3=-3172/0,34=-3172/0,4-5=-4218/0.5-6=-421810. 6-7=-4218/0,7-9=-3172/0,9-10=-3172/0 BOT CHORD 18-19=0/1835,16-18=0/3925,15-16=0/4218,13-15=0/3925,12-13=0/1835 WEBS 2-19=-206210,2-18=0/1502,3-18=-293/0,4-18=-846/0,4-16=88/541,5-16=474/309, 10-12=-2062/0,10-13=011502,9-13=-293/0,7-13=-846/0,7-15=-881541,6-15=-474/309 NOTES- 1)Unbalanced floor live loads have been considered for this design 2)Provide mechanical connection(by others)of truss to bearing plate at joint(s)12 3)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 4)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 cc and fastened to each truss with 3-10d(0 131"X 3")nails. Strongbacks to be attached to walls at their outer ends or restrained by other means. ?- NE(y �q gyp' Q rn "txo.tta- ti• L �-PEssiVN July 24,2019 ! t ®WARNING•Ver)fy design parameters and READ NOTES ON THIS AND INCLUDED N11TEir REFERENCE PAGE M7f•7473 rev.10103I1015 BEFORE USE. DaolDlt vHld,fnfteac mtlyrtillt,tlicL•Y.+F.luinncttnrs.Tti!tt iigW3n,Ir;bases/eittyUtr�Rntmidnr.'ahouln,and'ii ler ivy lndlvlilunl ttulWGTg'wmpW�nnt,nal p Uusb eyatmn.8aforo tree.ilio building dc—signor proal vc•+1[Yy tiro nppitcocllkydrdpeihil Imr[Enimiers and blopwly Ina:olpnr,No OIL-, Inio thnovmnll' e'��C bustdipq der lin:SrnrinD fnninated 1310 proGcnt bbOlIng n7 indlvldval ifd[.:ymb andfpr thpid mrmharg en[y.Addillan.'d Iempd Mtyand ptumanentb[atisrli �v� is aftvl,yp reg0tid roi atetAaltY'oarl to pra;.�ac�1 Uilinpsow7dl posdiblc petsbnni In1uN pndpsontnty dnaut9e-Fsn'0i7:crd1 guldnn:rr ragn[dx[fi ilio - fabrxauw,,sio,aDo,delivery.orecikat and Indng,61Irassnc and live;s s[umn,red ANSOTPH QilnOty Crhetin,060-89011d SCSI8uildlnp Component Chest Swid.M Ridge Rd Snlety Inrcmtatton nvadnbto tzp'm`fntsg Plata Inrtlwtt;218:J:Lee St[aai.Sulfa 312.Atexandno.'OA3:G`st$, d Chesterfield.MO 63D17 i. Job Truss- — Truss Type Qty - Vhi©Yard View Building D 2nd Floor 137921908 5970F3 F19 FLOOR 3, 1 _ JJab Relererke o tionai _ Unlvutsdl CoarpCneltiCo`rp.," EAST HAV1 IV..CT085f2_: - - - 1 _.4-'[3.010 s;Aug 112017 M1Tek,,Indusfrkts;Nrie.;Wed'JUI24 16:39747 20112 Pape 1— = iDtndlRtlAhLi`U+i07PWEQA TInisjsf zGFOKHE63 r1EsCt Uat[zHi!Wnc%GgK}i4valpyuot0 Scale=1.24.3 1x3 I4, 3x6 — 1x3 14 3x3 = 1x3 II 34 = 1x3 II 1 17 2 18 3 19 4 20 5 21 6 22 _ 7 - _ < ;.. it 13 11 14 10 15 94x6 II 16 46 11 6x6-= 3x6 11 46 11 -Plate Offsets'(X.Yj= LOADING (psf) -SPACING- 1-8-0 CSI. DEFL. 'in (ioc) I/deft Ltd PLATES GRIP TCLL 40.0 Plate Grip DOL 100 TC 0.50 Vert(LL) -0.15 8=9 >999 360 MT20 197/144 TCDL 12.0 Lumber DOL 1,00 BC 0.44 Vert(CT) -0.19 8-9 >882 240 BCLL 0.0 Rep Stress Incr YES WB 0,28 Horz(CT) 0.02 8 n/a n/a 'BCDL 10.0, Code IBC2015tTP12014 Matrix-S' Weight:71 Ib FT=20%F,II%E LUMBER- 'BRACING- � - CHORD 2x4 SPF No.2(flat) TOP CHORD Structural wood sheathing directly applied er 6-0-0 cc purlins, ' 'CHORD 2x4 SPF No.2(flat) except end verticals _.3S 2x4 SPF No.2(flat) BOT CHORD Rigid ceiling directly applied or 10-0-0 cc bracing. REACTIONS. (lb/size) 1 2=7 3 210-4-6,8=732/0-4-6 FORCES. (lb)-Max.CompJMax.Ten.-All forces 250(lb)or less except when shown. . TOP CHORD 1-12=-270/0,7-8=-27010,2-3=1 88210,34=-1BB2/0,4-5=-1903/0,5-6=-190310 BOT CHORD 11-12=011183,10-11=0/1903,9-10=0/1903,8-9--011199 WEBS 2-12=-1329/0,2-11=0(786,3-11=-307/0,4-1 1=-271/279,6-8=-1347/0,6-9=0/791,5-9=-255/33 NOTES. 1)Unbalanced floor live loads have been considered for this design. 2)This truss has been designed for a moving concentrated load of 250.01b live located at all mid_panels and atall panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads, 3)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 cc and fastened to each truss with 3-10d(0.131"X 3")nails Strongbacks to be attached to walls at their outer ends or restrainedby other means. NE . �4,GARcz-U,9 W, Z 080Qg�' 'tai sst.9 � July 24,2019 AWARNiNO-Vertty design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE M11-7473 rev,10/03/20fir BEFORE USE. LtralgnVnlLq,fcru opnlyivllti;NllakC'ecrinarto�lldrs;�oatgpimbnsddaitlp;Uponparamutpnaanami;ogltiAloranfndiridu�+tto�jilRakcorPanaM.nuC 0:'. :iku3msyfitmic'Bofarauao;ltlehugdinpdns(gp9rrni{s(,r`oFJdt4aD{�Itc�Ntyof,dnflpnp�r„innluiGanUpruneAytncap0tlllaUdadnsip,ilnW_thuovartill,. , ;6uIlcNrgdsipn.gnclitp ndlfutndtsta!'aUcnlhu6�atln0o tndlvdtuit'uusayrpbnndfareTsaidmemlwPsonlY,'Addilibll�(t0mpgrRry,mid,psmmnorttu.AN6B, -MiTek, ;tan'r�vn+Aaraquk€vltdr lffW t�ta,pinvgn"lcwllpPsuLtilhPoatuhluP�3op0lin/uTyandproparC lnir 1EI-fiadrpyciritPurame-sard4c'!n %tn6ncnll�n;yiQrahe del:ygiy maellunandlua tpolllu sUtldln075yelsma„eoo Y NSItiPItQ!)DillyCritatirt gS6•&9andUCSTBuI({Bng,Component Sw[ngley 3017 t 'Sptnty Infeimetlon.�aivdllnhtd trbm Tiw'.ri f}lato'tnsUtula;213 Ns tze Stre+l45{alta 3t2,N9xnrtdila;WiC223{�. • , Chealerpeld,MO 63D17 Job russ Truss Type Qty 1ply Vineyard View Building D 2nd Floor 137921909 3597OF3 [F20 Floor Supported Gable 1 1 11.b Reference(optional) Universal Component Corp., EAST HAVEN Gr U6512 8.0!10 s Aug'L1 2017 MITek Industries,Inc,; VedJul24 16:39,48 2019 Page 1 ID:ndIRDAhLEUvQ7PkiBgAvyTyugda-PTppYdFk4t5AsOnrXC5cWVTF2PtRinpUlgO7ZFyuoLP Scale=1 1.50 ll j 20 2 21 3 22 4 23 5 24 6 7 _ tLi I(Jp 1 t > 1 ;4 I " } :t j`__ I ,"'_—_ r�i;:,"y,:Jai"- 'vt.' .�s�'c'-x _�`+ .. �. fr�. , y.,r`T✓3•'.�n,Yii,�,*e."�`..`r.'_','._..'�`sr yp.a .e.,* ,C r^ "1v.4-.,.."�J�• • v.._'r:�,; 14 154f 13` 16 12 17 11 18 a 10� 19 9 8 1x4 II LOADING (psf) SPACING- 2-0-0 CSI. DEFL. in (loc) Udell Ud PLATES GRIP - TOLL 40.0 Plate GripVertLL p DOL 1.00 TC 0.18 Vert(LL) n/a n1a 999 MT20 197/144 TCDL 12.0 Lumber DOL 1.00 BC 0,19 Vert(CT) n/a n/a 999 BCLL 0.0 Rep Stress Incr YES WB 0,03 Horz(CT) 0.00 8 n/a n/a Weight 26 Ib FT=20%F,11%E BCDL 10.0 Code ISC20151TPI2014 Matrix-S LUMBER- BRACING- TOP CHORD 2x4 SPF No.2(flat) TOP CHORD Structural wood sheathing directly applied or 6-0-0 oc purlins, BOT CHORD 2x4 SPF No 2(flat) except end verticals. WEBS 2x4 SPF No2(flat) BOT CHORD Rigid ceiling directly applied or 6-0-0 cc bracing. OTHERS 2x4 SPF No.2(flat) REACTIONS. All bearings 7-0-6. (lb)7 Max Uplift All uplift 100 lb or less atioint(s)14,9 except 8=-14B(LC 20) Max Grav All reactions 250 Ib or less atjoint(s)8 except 14=274(LC 22),13=312(LC 23),12=308(LC 24), 11=308(LC 25),10=311(LC 26),9=329(LC 20) FORCES. (lb)-Max Comp./Max.Ten.-All forces 250(lb)or less except when shown. TOP CHORD 1-14=-262/11 WEBS 2-13=-281/0,3-12=-27910,4-11=-279/0,5-10=-28010,6-9=-279/35 NOTES- 1)All plates are 1x3 MT20 unless otherwise indicated 2)Gable requires continuous bottom chord bearing. 3)Truss to be fully sheathed from one face or securely braced against lateral movement(i e,diagonal web) 4)Gable studs spaced at 1-4-0 cc. 5)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift atjoint(s)14,9 except Qt=1b)8=148. 6)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads 7)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 oc and fastened to each truss with 3-1 Od(0 131"X 3")nails. Strongbacks to be attached to walls at their outer ends or restrained by other means. 'OF N E PV , w in nva-4BOOg1 July 24,2019 ®WARNING-Verdy design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE M11.7473 rev.10/03/2015 BEFORE USE Gc:;%n v3ld lor,usa ontywBb bti talo c 41'etttor.U'S dgsinn Ip brand pnlyuPert pnmmilara zhown m is 10of eri IndivIdil ri Lulltl410:65Lp0n0111,nos t" n,ttu,1 w�su:m.Bhfnro usu,lhe 4J9d5t9Onslpn6i must varlP/the oppiicoblilly of ddagf,parnrnbWra Mut pt6pefly lnu:roaain W ditamn Into 1ha'Ornzli 1 bulkllnp Ensign, Bracrng(nu eafad in to p rural tacklLtp pl tnSwtddunl tntss Yrpb agdlar ctt0rd memlm s rd1Y•A talariai lornl p er%;uxl permatant t id tg # MiTe<+ r�ss atwny3 ragwred far nmta7ay orrf to pravurd eultnpso tsiUr palslbin pwsonol Inlb,yard prgpyAy dauatla. Fntiggnanorut'�utdmrte regntd;seg lho fatXlLtl500'storage,dariva aratLnn and braying pf,tru:ses'and•Ittrsa 6y4tum0,soa AN3trrPll thiailty Crltaria;os4,ao aid BCsi Btdiding Component Chest Sield, y Ridge Rd Snfoty Irdorynalron ovhlla,tu,fiam Tars"°:Plata Ins1Tr+!a.210 N.Lea Street Sirho 312,Ainxundria,lfA 22314; t Chesterfield,MO 63017 runs -- Truss Type " l Qty -Pis/ - VilioYard View$uildlhg 0,20d Floor - 137921910 35rJ70F,3 F21 Floor Supported Gable 1 1 ' ___ _ Jeb FZafarenee ya`ticnal - Universal Component Corp., ',EASTHAVEN CT 06512 —1 _ — 8;010 s Aug-11 2017 MgeR_Nr uslrlimj Inc.,Wed Jul 24,16'-,39A9'2019Page 1 ID ndlRDAhLEUvQ7PklBgAvyTyugda-tfNB12GMrBD1 U9M15vdr21OQlaDoE3dU7h5hyuoLO Scale=1 20,1 1.5x3 I I 1x4 30 2 31 3 32 4 33 5 34 6 35 7 36 8 37 9 38 10 3 : 4 — ;.n�' :^rfr'�v':_ �+�`.,3�drs?cf.`.t*�'L�� .�'a`a.•,�< e�-t 2;e?i�;�`'�1`��c,;`ice;"u r,.>'�-`s* .?�x+�.r:_+s l° *.`�"."i k..v"; r��, ^. ,,.A,t s'vyS 'St` 'i�* .�.;4 20 21 19 22 16 23 17 24 16 25 15 26 14 27 13 26 12 29`- 11 1x4 II LOADING (psi) SPACING- 2-0-0 CSI. DEFL. in (foc) Vdefl L/d PLATES GRIP TCLL 40.0 Plate Grip DOL 1 00 TC 0.18 Vert(LL) n/a - n/a 999 MT20 197/144 TCDL 12.0 Lumber DOL 1 00 BC 019 Vert(CT) n1a - n/a 999 BCLL 0.0 Rep Stress Incr YES WS 0.03 Horz(CT) 0.00 11 n/a n/a BCDL 10.0 Code IBC2015/TP12014 Matrix-S Weight 42 lb FT=20%F,11%E LUMBER- - _--- _ - -_ BRACING- 'TOP CHORD 2x4 SPF No.2(flat) TOP CHORD Structural wood sheathing directly applied or 6-0.0 cc purlins, CHORD 2x4 SPF No.2(flat) except end verticals: 3S 2x4 SPF No.2(flat) BOT CHORD Rigid ceiling directly applied or 6-0-0 cc bracing, IERS 2x4 SPF No.2(flat) REACTIONS. All bearings 11-11-8 (lb)- Max Uplift All uplift 100 Ib or less at joint(s)11 Max Grav All reactions 2501b or less atjolnt(s)except 20=275(LC 31),11=274(LC 40),19=310(LC 32),18=308(LC 33),17=309(LC 34),16=309(LC 35),15=309(LC 36),14=309(LC 37),13=309(LC 38),12=309(LC 39) FORCES. (lb)-Max CompJMax.Ten,-All forces 250(lb)or less except when shown. TOP CHORD 1-20=-263/10,10-11=-263112 WEBS 2-19=-28010,3-18=-27910,4-17=-27910,5-16=-27910,6-15=-279/0,7-14=-27910, 8-13=-27910,9-12=-280/0 NOTES- 1)All plates are 1X3 MT20 unless otherwise Indicated 2)Gable requires continuous bottom chord bearing 3)Truss to be fully sheathed from one face or securely braced against lateral movement(i.e.diagonal web), 4)Gable studs spaced at 14-0 cc. 5)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift at joint(s)11 6)This truss has been designed for a moving concentrated load of 250 Olb live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 7)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 cc and fastened to each truss with 3-10d(0 131"X 3')nails Strongbackd to be attached to walls at their outer ends or restrained by other means GA�er-9 C}'A 1 � R k Q' W ° SSV-- } July 24,2019 TIN Z Ron WARNING-Verify design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE Mk-7473 rev.10d43120158EFORE USE G1eslEln v{iiJlf tar ugtran�rvlh htjtRk�canr:cta.�,'ftii�dLK1J+n�traur9 rrntyulicvt parnmet3a;E$tinwn,cilia 11 faran krt�iFvldun!t<LudStg ecnrdandhf,'nnt .tt Gan�syttNm.8n7aia ulsn,dig yul6itGt�do?�9ntlrmuai`va�ifl lhlfapp!'iraLiTfity z{da2lgnbaamlhare_nnd prtlUarFtr incorparnta tF4y,dypiAri Fptalj+a��nt}Ii I^ bu id t>EidesFga.0rarnq,klaFlcaFedt�roprfr�ent bactdlnp of rndFunS ir�rss tictb gndlnFdiai mamliarsonty,"J�dditfortlYt{a pnaary and paupannftt;ifwataa � �� Isafary.re4uito0tptsfnNllty,ar•+tJisprgvnaisoAop!ova�lilSdeeJlilrtard�FlnJu+tafufprdpati3rtlntntiga Foranerar9udartcttraguidurgtita ' fdtKFcdilort.Storage.dgl�lgry nre[Aan Writ/tl'ruG(np 4fUVSLa4 ar dtRlsabyf temd. /UI5lartt Quaply_CriltlrinF 01#9'9 aa46GSF BuUdin9 Component � 16023 Swingley Ridge Rd ;SafeiylitfamrnlMan avapdh)utaanS`TrisvPttaait�eA�litUtd,218N,`LtlOSlydlrl,8u1ta91Z,AtaXaririnn,VA2231� '+ -" Cheste�eld,M063017 Job rues - —Truss Type =Qty - Ply Vineyard View Building D 2nd Floor b Ref (oottonall 137921911 35970F3 F22 Floor 10 1 ` .Joerence UIGV(JrSal Cdm¢lirtelll Corp., EAST HAVEN-CT 08512 _ - _ 8,010 s Aug 11 2017 MITek Ihddst4z*UtG pkat Jul _16-395020119 Page 1 = ID ndIRDAhLEUvQ7PkIBgAvyTyugda-MrxZzJH_cULu5JxDfd84bwZWxCTWAdtnDBtEd7yuoLN 2-6-ID�-�---i I-4 Scale=1' 150 11 3x8 = 15x3 11 44 =44 = 3x6 FP= 1.5x3 11 3x6 = 1.5x3 I I 1 21 2 22 3 23 4 5 24 6 7 25 B 26 9 17 - - � 15 14 18 13 12 19 11 20 -� 4x4 ' 3x8 MT18H FP = 1x4 I I 3x6 = 44 = 3x8 = 1x4 II Plate Offsets,' ,Y - 3"0,?�g E epi 5:Q Mcg°Edi[fIO:EdtSesO-18� (16:C-d9e 0 i 81 - LOADING (psf) SPACING- 1-B-0 CSI; DEFL. in (loc) I/deft Ltd PLATES GRIP TCLL 40.0 Plate Grip DOL 1.00 TC 0.47 Vert(LL) -0 34 10-11 >566 360 MT20 197/144 TCDL 12,0 Lumber DOL 1,00 BC 0.53 Vert(CT) -043 10-11 >448 240 MT18H 244/190 BCLL 0 0 Rep Stress Incr YES WB 0,31 Horz(CT) 0.03 10 n/a n/a BCDL 100 Code IBC2015(rPi2014 Matrix-S Vvq Weight 701b FT 20%F,11%E LUMBER.— - — -^ - BRACING- TOP CHORD 2x4 SPF No,2(flat) TOP CHORD Structural wood sheathing directly applied or 6-0-0 cc pudins, BOT CHORD 2x4 SP 285OF 2,3E(flat) except end verticals, WEBS 2x4 SPF No.2(flat) BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing_ REACTIONS. (Ib/size) 10=826/0-2-4,16=B2610-2-4 FORCES. (Ib)-Max,Comp,/Max Ten,-Ali forces 250(lb)or less except when shown, TOP CHORD 1-16=-270/0,9-10=-27010,2-3=-2147/0,3-4=214710,4-5=-242010,5-7=-2147/0,7-8=-2147/0 BOT CHORD 15-16=011307,13-15=0/2420,12-13=012420,11-12=012420.10-11=0/1307 WEBS 2-16=-1483/0,2-15=0/953,3-15=-30210,4-15=-436/166,8-10=-1483/0,B-11=01953,7-11=-302/0,5-11=-436/166 NOTES- 1)Unbalanced floor live loads have been considered for this design. 2)All plates are MT20 plates unless otherwise indicated 3)Provide mechanical connection(by others)of truss to bearing plate at joint(s)10.16. 4)This truss has been designed for a moving concentrated load of 250-01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads, 5)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 cc and fastened to each truss with 3-10d(0.131"X 3")nails Slrongbacks to be attached to walls at their outer ends or restrained by other means, b1F NEW o %. . : � cc .� .• , w LU, July 24,2019 .r ®WARNJNG-Verity design pa2meters and READ NOTES ON THIS AND INCLUDED M17EK REFERENCE PAGE M11.7473 rev.10/03/2015 BEFORE USE. �� S bnalgti NIN lrxuse'+snly ttiilh MITey9rlytpEc:r€,1h6 da¢Ign is 6ani)elonly upon paraipaLdfs dtmtyn-and Is for an Individual building component,not + n[rhea 6yatdm Before UBtri the budding d'vaTpnor count verffy the,pp0cabll ty of design paranv t x;i and properly Incorporate this design Into the overall �g btitldinp deslaq,Braaihp Inttf'raled is to yiFOveratn chfng 0( idividool Was web andfor chord members only.Additional temporary and permanent bracing § f iTek is always required for slabildy and to prevent collapse win possible personal injury and property damage.For general guidance regarding the fabd°ahon,storage,delivery,ereclion and bracing of trusses and truss systems,see ANSIrrP11 Quality Criteria,DSB-88 and SCSI Building Component i 16023 Swmgley Ridge Rd Safety information available from Truss Plate Institute,218 N Lee street,Suite 312,Alexandria.VA 22314. g Chesterfield,MO 63017 itrb, tits tUtuTYPe- — pty -i:P[Y V(neyatd Vtew Building D 2nd 1 ttrer 137921912 l lnitrofsil(, Corp., EAST HAVEN-.CT O6y12 _-_,_ -- 8,Oi4,5 Aug 11, U17 MITak ltldtiawo,lnu.,W44'Uul'24 1&_39;512419 Paged =_ IC3;t�dl(tDQ6l.�Uvt?78�ifj,'gAvyTYtiijdtkg2VXAfHCNbT�j�'WADI<CJ77�hUr<izfv43•NRv�Aayuo]:M Scale=1.2U 1.5x3 II 3x6 = 1 5x3 it 4x4 = 4x4 = 3x6 FP= 1.5x3 II 3x6 = 1.5x3 II 1 21 2 22 3 23 4 24 5 6 7 25 8 26 9 19 1� 17 15 14 13 18 12 19 11 20 4x4 3xB = 3x8 MT18H FP = 1x4 II 1x4 11 3x8 = 4x4, ( - - - - - 16•3.tS �_j6-__Lk 16:ErtgEo=zit - -— LOADING (psf) SPACING- 1-8 0 CSI. DEFL, in (loc) 1/deft L/d PLATES GRIP TCLL 40,0 Plate Grip DOL 1.00 TC 0,49 Vert(LL) -0,34 10-11 >572 360 MT20 1971144 TCDL 12,0 Lumber DOL 1,00 BC 6.53 Vert(CT) -0.43 10-11 >452 240 MT18H 244/190 BCLL 09 Rep Stress Incr YES WB 0,31 Hotz(CT) 0.03 10 n/a n/a BCDL 10.0 Code IBC2015/TPI2014 Mat*-S Weight:70 lb FT 20%F,11%E LUMBER- ^~v F- - - -BRACING- " "CHORD 2x4 SPF No.2(flat) TOP CHORD, Structural wood sheathing directly applied or 6-0-0 oc purlins. CHORD 2x4 SP 2850E 2 3E(flat) except end verticals 3S 2x4 SPF No,2(flat) BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing REACTIONS (Ib/size) 10=835/0-2-4,16=835/0-4-6 FORCES. (lb)-Max Comp./Max.Ten -All forces 250(ib)or less except when shown TOP CHORD 1-16=-270/0,9-10=-270/0,2-3=-2181/0,3-4=2181/0,4-5=-2469/0,5-7=-2181/0,7-8=-2181/0 BOT CHORD 15-16=011 3 24,13-15=012469,12-13=0/2469,11-12=0/2469,10-11=0/1324 WEBS 2-16=-1502/0,2-15=0/973,3-15---304/0,4-15=-462/160,&10=-150210,8-11=0/973.7-11=304/0,5-11=452/160 NOTES- 1)unbalanced floor live loads have been considered for this design. 2)All plates are MT20 plates unless otherwise indicated., 3)Provide mechanical connection(by others)of truss to bearing plate at joint(s)10. 4)This truss has been designed for a moving concentrated load of 250,01b live located at all mid panels and at all'panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 5)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 oc and fastened to each truss with 3-10d(0.131"X 3")"nails Strongbacks to be attached to walls at their outer ends or restrained by other means. E71 ta, ` W El 0 Fes S July 24,2019 _41 11 w 1 AWARNING-Verify design parameters end READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE MI1-7473 rev.16/03/2015 BEFORE USE I� fOnvniPd`talurttiantywthMTStd?clintrauka:Ciiarluat q.tstwsadantyUanitnr3nralarratiown;ondiuJaroriitdiVidUnlUullsfrat}'wtnppttialr,aa}, " farsbnd io a tn.afadmta(tr,#i't3 kkk _ allruanayreiglr,;Sataroueo;ttm,brutrlrng'da�ir�hitrnluri{tti�arH"t(a+6pt3lfuty6{drxsitlnplratr:lr ,Av_� t?,!fy'.. �. tFr+fntq�mauanll t+07dlr+n d?�9R*&aainn indicarod ic,la pm+(ant�hUCklIPt7 at ndlvideat truss viatr Ltt:lei,thrud mcrribdca only:,lvf�filterwt�rJiaper�e�,/snd purnuulaift hrbdng ( ��C�i�, 'Is u4unys"rnRulredtri5labiGtyand[PDravantc�ilapais7AthpbslilvPoradaofiajbryn+rdMagadyttl{wmann<FarGenprgi pri(danc�r,tsmsrdlnplha i ;,fa(ldaalion,atrn4@v;delisecy;areafwn`and htactng`af ttussom and Uutl3xy',3}N.r,"F Said-_ ANSUTPti quolity'Critad�tf3&84 aArE 4CSI9UIId3nq Component C16hest Sleld, y Ridge Rd 'Safely 1111afmalttttF'a'i t tie knm't`iUfiS pldt�InSBtUla,Z18 td:L6651reat.5u(to 312./Uexardda,Vh2?3q�1. '--�,, Chestedild,MO 63017 -- =7OF3 toss "Truss Typa Qty ply Vineyard View Bwldmg D 2nd Floor137921913 F24 Floor 3 1 Job Reference(optional) Universal Component Corp,. EAST HAVEN CT 06512" 8.010 s AUg 112017 MiTek Industries,Inc..Watt Jul?A,16-39 52 2019 Page'1 I D:ndIRDAhLEUvQ7PkiBgAvyTyugda- IE3J0_IE86ccLd5cm2AYgLewvOCxebf3gSMLiOyuoLL 1-3-0 1 1x3 II 12 2 13 3 3x3 = 14 4 1x3 II Scale=1 1x3 11 1x3 11 9 7 10 6 11 > 30 3x3 3-11=0 - = 3.11.0'- LOADING (psf) SPACING- 1-8-0 CSI. DEFL. in (loc) I/deft L/d PLATES GRIP TCLL 40.0 Plate Grip DOL 1'-00 TC 025 Vert(LL) -D.02 7-8 >999 360 MT20 197/144 TCDL 12,0 Lumber DOL L00 BC 0.28 Vert(CT) -002 7-B >999 240 BCLL 0.0 Rep Stress Incr YES WB 0,04 Horz(CT) 0.00 5 n/a n/a Weight 19 Ib FT=20%F,11%E BCDL 10.0 Code IBC20151TP12014 Matrix-S BER- - BRACING- LUM UMTOP CHORD Structural wood sheathing directly applied or 3-11-0 oc purlins, CHORD 2x4 SPF No.2(flat) except end verticals:, BOT CHORD 2x4 SPF No.2(flat) WEBS 2x4 SPF No.2(flat) 80T CHORD Rigid ceiling directly applied or 10-0-0 oc bracing. REACTIONS. (Ib/size) 8=196/Mechanical,5=196/0-2-4 Max Grav 8=320(LC 7),5=320(LC 11) FORCES. (lb)-Max.CompJMax.Ten.-All forces 250(lb)or less except when shown, TOP CHORD 1-8=261/5,4-5=-26115 WEBS 2-8=-261/0,3-5=261/0 NOTES- 1)Unbalanced floor live loads have been considered for this design 2)Refer to girder(s)for truss to truss connections; 3)Provide mechanical connection(by others)of truss to bearing plate at joint(s)5 4)This truss has been designed fora moving concentrated load of 250 Olb live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 5)Recommend 2x6 strongbacks,on edge,spaced at 10-0.0 oc and fastened to each truss with 3-10d(0.131"X 3")nails Strongbacks to be attached to walls at their outer ends or restrained by other means O N yY b J� July 24,2019 - ` Owl" 7 WARNING-vertry design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE Mll•7473 rev 10/03120 fS BEFORE USE. � DO'S;tllYeRlht ~lue only+vhh,y7ekfu canttett�s,7f�d�1gti E�bdvod`drtlq U¢otiµntametnrr r!luwtl,dnd3s tot,u0 in[i vidurit huPdlnp crit,lt?rvcliti 0 boas lantenl Nfile uxe;(hahldlaing 0lilp0!,murt vont'Ora gpja raGNE{y 61 d9alpn pammakd_y rind timptily 1116VPMIFI lits'08'yix fnlu;ltu uulriutl =bvllu�nq r'ef�8n•Brat"�"p hpdfialfldl>:17tprdvatl,4 bu:lrAng rir tnwytvhtu,1l tros'sv,^ebldi '` 4td momhd an1yF.'AddHl9nnt Icmluclrep 01)d p6m, inn1 tiras3ng fiTe�(* is-GlW6 rdgti[r 1 Ir f I�UJiry and t0;pr!rvari) It pori Whit r g3? a W';Is itrt ug Py my1 Prapen Idnrrmgnm su nr�1(S" r tRgntaing tllg ftuuiuii ori:stomps,dotnrory.arocinn arse uFacrM of vus�,e"s ariv t;u5s 5y5ui;nv,tea:. ry=L`1'NO'-n!!:yr•.�eyrlLict�C!j.ylAgpyi'rna;,3l afi5tdirip Qomoopenl 160235wingley Ridge Rd "5afolytnrgrmattnn Available lro/nT;umPlate Imt;llilo.218.httoo S[trial.$oaw3#?.Atainndtta,V1,:13iQ,, _ - - - N-f{ CheslemelMd,M063017 !i Job, cuss Truss Type - CtyP�{RV slVineyard View Building D'2nd Floor 137921914 35976F3 F25 Floor 8 1 a�=-�-:-- Universal Component Corp„ ;EAST.HAV_EN CT 06512 ti.010 s Aug 11-2017 MiTek Industries,Inc.-Wed Jul24 16:3953 2019 Page 1 ID ndIRDAhLEUvQ7PkiBgAvyTyugda-mQdibKJsvPkTynfoKlhnDYB11QUDN_aDv65uESyuoLK ,f -2$41' j, Scale=127.0 1.5x3 II 3x6 = 1.5x3 II 4x4 = 4x4 = 3x6 FP= 1;5x3 ll 3x6 = 1.5x3 II 1 21 2 22 3 23 4 24 5 6 7 25 8 26 9 �`- _ 1. . 17 15 14 13 18 12 19 11 20 4x4 3x6 =3x8 MT18H FP = 10 Il 1x4 II 3x8 = 44 ^, - -- --- 16-3-0 _ .-. P ake Offsets7C( ,'Y)- t[ `p"1-BrEd1 E� 5:0'1- .eclg flu; a 1•ElIs416:Eda®0=]-Br - LOADING (psf) SPACING- 1-8-0 CSI. DEFL. in (loc) I/deft Ltd PLATES GRIP TCLL 40,0 Plate Grip DOL 1.00 TC '0„48 Vert(LL) ' -0.34 15-16 >571 360 MT20 1971144 TCDL 12.0 Lumber DOL 100 BC 0,53 Vert(CT) -0.4310-11 >451 240 MT18H 244/190 BCLL 0,0 Rep Stress Incr YES WB 031 Horz(CT) 0.03 10 n/a n/a BCDL 10.0 Code IBC2015rrP12014 Matrix-S Weight,70 ib FT=20%F,11%E LUMBER- BRACING-: - 'CHORD 2x4 SPF No;2(flat) TOP CHORD Structural wood sheathing directly applied or 6-0-0 oc purlins, F CHORD 2x4 SP 285OF 2.3E(flat) except end-verticals, _8S 2x4 SPF No,2(flat) BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing REACTIONS. (Ib/size) 10=833/0-4-6,16=83310-2-4 FORCES. (lb)-Max Comp./Max Ten,-All forces 250(lb)or less except when shown TOP CHORD 1-16=-270/0,9-10=-270/0,2-3=-2173/0,3-4=-217310,4-5=-2458/0,5-7=-217310,7-8=217310 BOT CHORD 15-16--0/1320,13-15=0/2458,12-13=0/2458,11-12=W2458,10-11=011320 WEBS 2-16=-1498/0,2-15=0/968,3-15=-304/0,4-15=-456/161,8-10=-1498/0,8-11=0/958,7-11=304/0,5-11=-456/161 NOTES- 1)Unbalanced floor live loads have been considered for this design. 2)All plates are MT20 plates unless otherwise indicated. 3)Provide mechanical connection(by others)of truss to bearing,plate at joints)16, 4)This truss has been designed for a moving concentrated load of 250,01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 5)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 oc and fastened to each truss with 3-1Od(0.131”X 3")nails Strongbacks to be attached to wall&at their outer ends or restrained by other means, It,f f mf y(P �v 01 July 24,2019 ®WARNING-Verity design parameters and'READ NOTES ON THIS AND INCLUDED,MITEK REFERENCE PAGE M11-7473 rev.1010312015 BEFORE USE. �� s flualanvardlormr,only vAli tnruii(Wrr fKsvin:anrtts't4r TlnitWfddnibutlN6geornpcvranl,na4 I 'dlttn,arEr5nritfvfniltwctlt6Saapryhf"opQt niray•nka'sugiplttalinift,yfa4!cernuhg�s+lWqnla'tfi,d,l•dlNlcjanfEtaGtarupt"litltfasgl`iftnt7ldgurdn}ufarPlarrrflltma�hirftitatunrltu'grnaup;aatt3duHielr&tumtfvtpvBa#sa.Uos#iifatTp4ip'aR8mItnbliWinrvolJdif'drtillrtaapmuAppsfrtSlsxsnrfss/rlOsyusintlnlifftwba,ysfmMoftij[,vd?Inzrened3+ntVf1pnd2.rtd;fr'h,;-'a d=1 niOicnlrartd�ty#af_{mdraAbiaaRANbVdrAsd2T (apmpnjly blugrporOlnr.ImliJa tdaitg�apr4n,fntq hiiaia, Mrrtrnit I N(rly:Addlfianaf,fhrVnninqnnwtejtirneh9 a.Forgoamalgurddfoad HQuallyCtf±f0:tSi-SBand BCStBuiligComponent 16023Swinglef yRidge Rdyjeia+ ?314. _ - Chesrerfeld,M083017sypap" nyNLilokl �g}J Hiss "` '= nI`ssTvpa' — "- Pry PN :Vineyard View Budding D 2nd Floor 137921915 3687F3 F26 FLOOR, ' 1 Job Reference optional Universal Component Corp„ _(EAST HAVEN 06512 - - '' $iDt0 s Aug 11 2017 MiTek Industries,Inc.v0a-1112416:39:54 2019 Page 1 ID:ndIRDAhLEUvQ7PkiBgAvyTyugda-EdB4ogKVgjsJaxE7uTC0lm)C3ps36STMBmrSnvyuoLJ 2.6.0r 0-11-14___� i Scale=1' i 1x3 Ih 4x4._ !1x3"II 1x9 11 1 14 2 15 3 16 4 17 5 18 6 9 12 B 4x6 II 13 x7 4x6 1� 4x6 11 4x6 11 Pieta OffsetsXS`3� tt3;0 S 0.1 d9e]�IaC►?3 b,Estq>� -- _ - LOADING {psf) SPACING- e'-0 CSI. 60 'in (loc) Ildefl Ud PLATES GRIP TCLL 40.0 Plate Grip DOL 1.00' TC 0.47 Vert(LL) D.16 9-10 >853 360 MT20 197!144 TCDL 12,0 Lumber DOL 1.00 BC 0,4Vert(CT) -0,19 9-10 >707 240 BOLL 0.0 Rep Stress Incr YES W8 0?1 Horz{CT) OA1 7 nla rda Weight-57 lb FT=2D%F,11%E- BCDL 10.0 - Code IBC2015/TPf2014 Matrix-S LUMBER- ._ -- - BRACING- ' TOP CHORD 2x4 SPF No 2(tlat) TOP CHORD Structural wood sheathing directly applied or,6-0-0 oc purlins, BOT CHORD 2x4 SPF No 2(flat) except end verticals: WEBS 2x4 SPF No.2(flat) BOT CHORD Rigid ceding directly applied or 10-0 0 oc bracing. REACTIONS. (Ib/size) 10=587/0-2-4,7=587/Mechanical FORCES. (lb)-Mak;Comp4Max Ten.-All f6rces-,250(lb)or less except when shown,- TOP CHORD 1-1 0Fa=10,6-7=-270/0,2-3=-`!29610,3-4=-1296/0,4.5=-1296/0 BOT CHORD 9-10=0/§6'4.-6-9=0/1296,7-6=0/904 WEBS 2-10=-1015/0,2-9=01487,5-7=-1015/0,5-8=0/487 NOTES- 1)Unbalanced floor live loads have been considered for this design. 2)Refer to girder(s)for truss to truss connections. 3)Provide mechanical connection(by others)of truss to beating plate at joints)10. 4)This truss has been designed for a moving concentrated load of 250,01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 5)Recommend 2x6 strongbacks,on edge,spaced at 1D-0-0 oc and fastened to each truss with 3-10d(0 131"X,3")nails. Strongbacks to be attached to walls at their outer ends or restrained by other means. ;CC:1 NEVSS �aessiv �`�. July 24,2019 i ®WARNING=Vetfry design parameters and READ NOTES ON THIS AND INCLUDED MITEKREPERENCE PAGE M11.7473[eV'10/0312095 BEFORE USE a G 'fiv Uitfrj�irtgOlyfjlihAllTgk�zUnrt cWrs.fhtl iippWliq ifdAi4YUpasp lmdibib lfi0ttvn►:+ttdNtt,UHB4tlltrfien'IgGlyfdU61[u1(cdltzQextrwip�tlwor.3h , ' =ntrtitYl3enrar'8alcrdUbc,tpaDvtldJrtjd¢4"p±�CiFnasivi�dry,the,aP4d!r��i{tlyotdu�lBnpnrtunclvr$,andp'rppntl?+faia�rymr4b1}ttlttluxpirfnln _ tyvf)drspd Iqn Hra�irG3eW3cei£nft111GJ aRtlW tli'nthitlividenl,tfiissscehmttlidfdiefAtdninbbfSbpty,./i3dfiidnpltniq'poibryuadpurrnraantfsrncttag MiTe(' ls`cF�uyuloEtut<d[orslrt�lrliYsindSaptpLcrttSrdtlluicsntn,poselbapd3gn4ti)uryictld�rits�aty4'.imagoti± tmwbiittnnwtsmingrho-, 'f41y1iWtl0aystdtsa#r, '+`> -:'• I �'B�?d + ttiitlz�l'31w7�^' ` It-t'i5)tFPfl'tl'�ciRy Citt4tta;sl&f &P a`t?d'BC;9t au11i11aq Component 16023Sley 0Rd :SDfoty',ltNamldUaD.IJ4A11a�arrom7nrss btdtnalltiiia,�35HfVi1.3ti31ia4t.5uita392f�exntuf8n,lj1.^.23s!i,", - chesterreldela,Mo6363o17 - -- :Job Truss Qty—Pty` lnoyartf View Buirdtng D-2nd Floor ' 137921916 , 35970F3 F27 FLOOR 8 1 ]TrussType _ _ Jobitoferencc(oplionait Universal Component'C,aip., EAST HAVEN CT 06512 - - -----8A10 s Aug 11 ZOf7,MiTaY Industries,Inc:Wed Jul 2416:39:55 2019 Papa'P ID ndIRDAhLEUvQ7PkiBgAvyTyugda-ipkS00K7R1 AC4pBSAjFlzGNpDCGrviWMPa7JLyuoL1 - 2-6-0 - i 1-0-6 Scale=1.19.6 1x3 II 44 = " ` " 1x3 II . 1x3 II -4x4 = 1x3•II 1 14 2 15 3 16 4 17 5 18 6 qq 1 11 9 12 8 46 II 13 7 46 II 46 11 46 11 t - -- - . -- 11.0.6 _ _ Plflte-Offsefs(X,Y};x(8:0-3=0 'e 9:0.3.0 Edgel_--_-._ _ __-- _-- ---- ---- LOADING -_-LOADING (psfl SPACING- 1-8-0 CSI. DEFL. in (loc) I/deft Ud PLATES GRIP TCLL 40.0 Plate Grip DOL 1.00 TC 0.47 Vert(LL) -0.16 7-8 >849 360 MT20 197/144 TCDL 12.0 Lumber DOL 1:00 BC 0.43 Vert(CT) -019 7-8 >704 240 BCLL OA Rep Stress Incr YES WB 0.21 Horz(CT) 0.01 7 n/a n/a BCDL 1010 Code IBC2015ITP12014 Matrix-S it Weight,57lb FT 20%F,11%E LUMBER- BRACING- TrIP CHORD 2x4 SPF No2(flat) TOP CHORD Structural wood sheathing directly applied or 6-0-0 cc purlins, CHORD 2x4 SPF No2(flat) except end verticals. is 2x4 SPF No.2(flat) BOT CHORD Rigid ceiling directly applied or 10-0-0 cc bracing REACTIONS. (Ib/size) 10=58910-2-4,7=589/Mechanical FORCES. (Ib)-Max.Comp./Max Ten.-All forces 250(lb)or less except when shown,' TOP CHORD 1-10=-270/0,6-7=-270/0,2-3=1304/0,3-4=-1304/0,4-5=-1304/0 BOT CHORD 9-10=0/908,8-9=0/1304,7-8=01908 WEBS 5-7=1020/0,2-10=-102010,5-8=0/490,2-9=0/490 NOTES- 1)Unbalanced floor live loads have been considered for this design. 2)Refer to girder(s)for truss to truss connections. 3)Provide mechanical connection(by others)of truss to bearing plate at joint(s)10. 4)This truss has been designed for a moving concentrated load of 250.0lb live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 5)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 cc and fastened to each truss with 3-10d(0.131"X 3")nails Strongbacks to be attached to walls at their outer ends or restrained by other means OF NEtI vPNiGA��i�q�', 4`0.080�`�� Aq�FEFSsio--�'., July 24,2019 4 ®WARNING-Verify design parameters and READ NOTES ON THIS AND INCLUDED MITER REFERENCE PAGE MIi-7473 rev,l0l031201S BEFORE USE { Doa1gn,%Mr4loru8e anlq witll Mirek�itaanrienera. atl(jn c lta&7lt aiyupri pamniatciti shUWn,and iz far a f l0ri vliSufJ btil(s1ipp8g o0mp±tiietlt ntil L hus4syamm_Ealctu oils,ilio buildnpifaslgnor trntbt}wity,,hi6 5pplta7bl1q alddalGn pili uhigwrs'a�w propGly ncorhsoritalh{a daalgn into tiha ovnra(i b0dinadnislAq.,0:adngiriftAtodistopa agtbudtlin6of{lndliddaihucwebandrruchotdma.'nhnrdrnly.Addificnalldmpignyandpedtottxa4a' �`j�k- 16 ulv;rys ke&'al for rta111'ty nrid lepruvgt i cikluple W,UipoailMe pmsohuf l'njuiyand omputt'dnrjmpa."Far ga stat gu:aan�o tooifn10191hp fahiioatioh 5lraaaggn:dol vety.'acacllan Bad lxOGing of t�u8uus Ond ours ay7tnm9;soa ' �NSIMPIt Cuullly C#iatia.DS6-S9 and Ml Bulldlti0 Component 16023 Swmgley Ridge Rd Snfaty Infmmoltap rvnilnblgfrohlr Ttues PIM4lnatllute,2118 ftLee Stroot 5nito 312,Nnzsnddu,VA 22314., ` Chesterfield,MO 63017 russ hiss Type - Qty ply Vineyard View Building D 2nd Floor „ 137921917 35970F3 F2B �LOOR 3 = 1 Job Reference(optional) Universal Component Corp., -EASTHAVEN-CT 06512—-- 8.010 s'Aug 1'12017 Mi7a:k Industries,Inc,Wed Jul 2.11639:571 2019 Page 1 ID ndIRDAhLEUvQ7PkIBgAvyTyugda-eCsCRIMNyeEuROzaZbmlNOLhWltvJjNpgj36NDyuoLG ! - - 2•sfl - --� '' 1�l r 1-7-6 o-NB Scale=1.7 2x4 II 15x3 If 44 = 1.50 II 1,5x3 II 4x8 = 3x3 II 412 = 1,5x3 = 1 19 2 20 3 21 4 22 5 Z3 6 24 7 25 8 14 1�1 15 12 16 11 17 18 9 4x6 II 4x6 II 6x6 = 6x10 6x8 = = 11.7.8 11 16-1.6 9t 0 —=-! } - - 11-7-8 - U & 4.4-6 Plate Otfseit$iX Y1=-' 16:0-1-8,Edue],j11'0-1-8,Edge, 12.0-3.0 Edp LOADING (psf) SPACING- 1-8-0 CSI. DEFL. in (loo) I/dell L/d PLATES GRIP TCLL 40.0 Plate Grip DOL 1.00 TC 0.58 Vert(LL) -0 16 12-13 >879 360 MT20 197/144 TCDL 12.0 Lumber DOL 1.00 BC 0.49 Vert(CT) -021 12-13 >647 240 BCLL 01) Rep Stress Incr NO WB 0.58 Horz(CT) -0 01 1 D n/a n/a Weight*82 ib FT=20%F,11%E BCDL 10.0 Code IBC2015/TP12014 Matrix-S LUMBER- _ BRACING- TOP CHORD 2x4 SPF 2100F 1.8E(flat) TOP CHORD Structural wood sheathing directly applied or 6-0-0 oc puriins, BOT CHORD 2x4 SPF No.2(flat) except end verticals, WEBS 2x4 SPF No.2(flat) BOT CHORD Rigid ceiling directly applied or 6-0-0 oc bracing. REACTIONS. (Ib/size) 13=213/0-2-4,10=222610-3-8 Max Uplift 13=172(LC 4) Max Grav 13=460(LC 3),10=2226(LC 1) FORCES. (lb)-Max.Cornp./Max.Ten.-All,forces 250(lb)or less except when shown. TOP CHORD 1-13=:267d2.8-9=-892/0,2-3=•737!'1180,3-4=-737/1180,4-5=737/1180,5-6=0/3325, 6-7=013323 BOT CHORD 12-13=-4841641,11-12=-1180f737,10-11=-2248/28,9-10=-187110 WEBS 6-10=-301/2,2-13=-721/544,5-10=-1874/0,2-12=-782/149,5-11=011496,4-11=-334!0, 7-9=0/2060,7-10=-1814/0 NOTES- 1)Unbalanced floor live loads have been considered for this design. 2)Provide mechanical connection(by others)of truss to bearing plate at joint(s)13 3)n/a 4)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 5)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 oc and fastened to each truss with 3-10d(0.131"X 3")nails. Strongbacks to be attached to walls at their outer ends or restrained by other means, O� N E w 6)CAUTION,Do not erect truss backwards vj GARC LOAD CASE(S) Standard �'� �� !9' 1)Dead+Floor Live(balanced):Lumber Increase=1.00,Plate Increase=1.00 Uniform Loads(plf) I Vert 9-13=17,1-8=-87 T ' C1 Concentrated Loads(lb) W Vert:8=-800 m a'I tJJ �O.;0$0®g� �C9 CS S l OSP~ July 24,2019 �r WARNING-Verify design paramerers and READ NOTES ON THIS AND INCLOOED MITEK REFERENCE PAGE M11-7473 rev 1010312015 BEFORE USE Oa it n4nlld to:usa e:1ly%Qh tATo4&nildl.lar Silo dothln m bDhed etily'upori'parans5 ars vhovm:and is tnr nn Indh tduol huGdlntl aomponcnt not "a in+ssay3,ta"L Befora esa,tho buddlrsg dasrpnbr,mugi Yoniy Bio,apptlwtitlity,o(doelt}11 plv imoiGs nrid{pa{s+lrly rncnJponta Ihla desrgd I+iW'iha avw ill �� iwildfnBdo;illri Bra:n44ssditntadtatn;acvahthusJ{ngotirdt�duaibura+vetiendlm'chardmemuumonly.A+lthhansltompomryandporm ilf, rrxtsp lis umayarresult-Wfor stabilit yamisapyVjgntr.Nlnpsevnthpat;%IW;Tp i annl, urya,t attydpmaga Fm enFt�]purdanccrc�mdvlrythe rAkltltilrtln.blara�U.CPWdry mese on4,nd InarJng al ini 4;and hugs oy�stnmlY.eco ARSlrri'lt Cunl�ty Critoria,oSB•89 and BCSI 0411ding Component Chest Swild,M Ridge Rd Safety infor±nation-evo3aLirttrcm7ruor, laloln0lute,x18N. et,51roa4Suita312,A1exxindria.VA2231.1. ChesrerBeld`M063017 IJob runs iTrass,Type laty ply lVftigyatfl View BU11ding a 2nd Floor II" {4k 137921918 �35970F3 1F29 Floor Supported Gable 11 `` _ Idb'Reffiiencb{opuaoal, - Univeroa!Component Corp., -EAST HAVEN,6,06512 -- '- $:010 sA11g 1,1 2017 MiTeklndushEes,the 00 Jul 24,16:39!59 2019'Pagb 1 iD;iictlRQILhLE�lvc]7(klegiivyf)+ut d0=4n?st?Oil4lFUck l7yti{lanS(i`ft8Ggd01imX5kiy DS6yuuLE 6-Ne Scale=126 6 1 41 2 42 3 43 4 44 5 45 6 46 7 47 8 48 9 49 10 50 11 51 12 52 13 cy, 'a 2B 4 14 �i+,"�,'� AS:� rsh_,�=` - ---`=��"N..a.-�-='s'=,�`_x-`.':�.+ xr__Kui`z.�� _ 1.�1'_.n°�'- .irErG.a-�1r1.c... =z,• `+.,'';`'_'S_�S.a ^�r�^ _ - --`-`•-_ 27 29 26 30 25 31 24 23 32 22 33 21 34 20 35 19 36 18 37 17 38 16 39 15 40 14 3x6 FP= 3x3 = 16-1-6 - LOADING (psf) SPACING- 2-0-0 CSI. DEFL. in (loo) 11defl Ud PLATES GRIP TCLL 40.0 Plate Grip DOL 1.00 TC 0.18 Vert(LL) n/a n/a 999 MT20 1971144 TCDL 120 Lumber DOL 1.00 BC 0-19 Vert(CT) n/a n/a 999 BCLL 0 0 Rep Stress Incr YES WB 0.03 Horz(CT) 0,00 14 n/a n BCDL 10.0 Code IBC2015ITP12014 Matrix S Weight:56 lb FT=20%F,11%E LUMBER. - - _ - BRACING- TOP CHORD 2x4 SPF No 2(flat) TOP CHORD Structural wood sheathing directly applied or 6-0-0 oc purlins, "T CHORD 2x4 SPF No.2(flat) except end verticals. is 2x4 SPF No.2(flat) BOT CHORD Rigid ceiling directly applied or 6-0-0 oc bracing. ERS 2x4 SPF No.2(flat) REACTIONS. All bearings 16-1-6.- (lb)- Max Grav All reactions 250 Ib or less at tolnt(s)except 27=276(LC 40),14=276(LC 52),26=309(LC 41),25=309(LC 42),24=309(LC 43),22=309(LC 44),21=309(LC 45),20=309(LC 46),19=309(LC 47),18=309(LC 48), 17=309(LC 49),16=308(LC 50),15=311(LC 51) FORCES. (lb)-Max.CompJMax.Ten..-All forces 250(lb)or less except when shown. TOP CHORD 1-27=-263/10,13-14=-259/12 WEBS 2-26=-280/0,3-25=-279/0,4-24=-27910,5-22=-27910,6-21=-279/0,7-20=-27910, 8-19=-279/0,9-18=-279/0,10-17=-279/0,11-16=279/0,12-15---280/0 \ NOTES- 1)All plates are 1,5x3 MT20'unless otherwise indicated. 2)Gable requires continuous bottom chord bearing. 3)Truss to be fully sheathed from one face or securely braced against lateral movement(i.e.diagonal web): 4)Gable studs spaced at 14-0 oc. 6)This truss has been designed for a moving concentrated load of 250,01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 6)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 oc and fastened to each truss with 3-10d(0.131"X 3")nails, Strongbacks to be attached to walls at their outer ends or restrained by other means.: 7)CAUTION,Do not erect truss backwards ! or �f7 E1tiW�9 LU � UJ' `�� '.•0804�� li�C7 R�FESSI4�A July 24,2019 WARNING-Verify design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PA GE M117473,rev.10!03/2015 BEFORE USE rill Raatpn 4UI1/M ubn aNyit4ih t!1 tndmnnuctcr Thls'd6$tpn bn6ed only upon pammdWrs shay n:end ivtoc e2FndWtduv{huCSr.9 rnmpcerrsnl not I r Intvssystvm.BOfans usn ,Ulv bt![IdlnO tl!�ignvr mugt vonfyiha appticpvtl(tyof dmlipn�nmtltars and jaapr;tty Inrolpori(r;hls;dnsigra in[l�1�overall tngptiritj Cti�pn.•0rrcinq Indlr+rfClri tlfyrevont hti.-Iillnn ul htillyieival Utiss we5 ertdror Cticrd+tirimherm nh!y.-A'ddi!(ok;3l lnmpororyand pamtnncntbraung -MiTiNc, l5 n{itVft6 tet<Ulttld,fOr Gtt!bii�y OYId la¢revenr CInp6e V+ilh pahlannulJnjury and property damage,For genemt guidance regardingthe - . rpbrlra on UlntagU,dalivety,nre,1�uud iKa L p a1 trod nS and Uvsa 41�Ifm�i.are ANSIrTPl1 Cuallty CrttaHn,056 e9 and BCaI Building Component Ghost S Ridge Rd Snlnty'intoininttvn aJailnhta iroiri'.Trurs P1nfv lltistilute;218 t�Gev;fiirr;vl,Stih4312,Alexandria,VA 22314. Chestertield.eld,MO 631017 JobTtuss Truss Type Qty Ply Vineyard View Building D 2nd Floor _ 137921919 35970F3F30 Floor 6 1 Joli Reference;opflonall Universal Comp Mit C01p_ FJ\ST HAVEN CT 06512 8.010 s Aug 11 2017 MITek Industries,Mr,.,Wed Jul 24 16:40.01 2019 Page 1 ID ndIRDAhLEUvQ7PkiBgAvyTyugda-Xz6lG3PuotkKw?HLoRgfXEWODeD5FcdOILlKW?yuoLC 2-6.0 ) 0 Scale=1 1,5x3 II 3x6 = 1.5x3 II 4x4 =4x4 = 3x6 FP= 1,50 11 3x6 = 1,5x3 II 1 21 2 22 3 23 4 5 24 6 7 25 8 26 9 � t 17 15 14 18 13 12 19 11 20 m 4x4 = 3x8 MT18H FP = 1x4 II 3x8 = 44 3x8 = 1x4 11 16.0-14 Plate Offsets(X - [4:0.1-8,Edae1 [5:0 1-l3,Edg� 1�O:Ed9e 0 LOADING (psf) SPACING- 1-8-0 CSI, DEFL. in (loc) I/deft L/d PLATES GRIP TCLL 400 Plate Grip DOL 1 00 TC 0,47 Vert(LL) -0.34 10-11 >565 360 MT20 197/144 TCDL 120 Lumber DOL 1.00 BC 0,53 Vert(CT) -043 10-11 >447 240 MT18H 244/190 BCLL 00 Rep Stress Incr YES WB 0.31 Horz(CT) 0.03 10 n/a n/a BCDL 10-0 Code IBC2015/TP12014 Matrix-S Weight 7D Ib FT=20%F.11%E LUMBER- _ BRACING- TOP CHORD 2x4 SPF No,2(flat) TOP CHORD Structural wood sheathing directly applied or 6-0-0 oc purlins, BOT CHORD 2x4 SP 285OF 2.3E(fiat) except end verticals WEBS 2x4 SPF No 2(flat) BOT CHORD Rigid ceiling directly applied or 10-0-0 cc bracing. REACTIONS. (lb/size) 10=824/0-2-4,16=82410-24 FORCES. (lb)-Max Comp/Max.Ten -All forces 250(lb)or less except when shown. TOP CHORD 1-16=-27010,9-10=-270/0,2-3=-213810,3-4=-213810,4-5=2408/0,5-7=-2138/0,7-8=-213810 BOT CHORD 15-16=011303,13-15=0/2408,12-13=0/2408,11-12=0/2408,10-11=0/1303 WEBS 2-16=-1479/0,2-15=0/948,3-15=302/0,4-15=-4301168,8-10=1479/0,8-11=0/948,7-11=30210,5-11=-4301168 NOTES- 1)Unbalanced floor live loads have been considered for this design 2)All plates are MT20 plates unless otherwise indicated,- 3)Provide mechanical connection(by others)of truss to bearing plate at Joint(s)10,16:, 4)This truss has been designed for a moving concentrated load of 250.OIb live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads- 5)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 oc and fastened to each truss with 3-1 Od(0,_131"X 3")nails. Strongbacks to be attached to walls at their outer ends or restrained by other means OF NEdy GA,qCZ; p�� 3 cc ^ C W 11.1 July 24,2019 �WARNINO-Verify design parameters and READ NDTES ON THIS AND INCWDED MITEK REFERENCE PA DE MII.7473 rev!0/03/2015 BEFORE USE j ■�/ Dhalon 4Wfiif eine only w1lir MITZ"kOtGmit cam Tltia if Wlin t=bmd dAlyupon 04111ulorn3h"n,add 18 fci;on 1A0410ilnl tnaldlgg comjronen not 4 Y! a Itunvoythm;Bofulo oso,'Ito&biIldri+g'do5l3nermW vorniy ih3appii atpaty of dealgn paamotpA aTd pmpmiy lrtcatpgrnie Ifil'l ddr an 1pin Ilie Ogarall d _ I—rekt bbadlnn daal6n, Bradn 71r tdeulyd trip cvOld t u�rrtlg t711pifivldt nt 3ntr�wrh andlor`choN lnombcra only.AddtionM Imirit nary and PalmMonf bracing � is`nwaf4ttfigiitrid far stabietytiod 10 ptmanl eouppsn widr posaltfo petconal injury and property damage,For general guidance regarding the in ticnlron-gt0*Opo.dnlwOty,bipSt 0-Mid iiaCng Of ttdssns aru!Utas sym:ott S,b a ANSIRPII Quality Criteria,DSB•89 and BCSI Building Component 16023 5wingley Ridge Rd 3droty lnrOmsallotl aYal1ob70 IrOM Ttuss'Plate ItworiAe,218 M:L6v 6trool,Solla 312,Alexandna,VA 22314 �— -' Chesterfield,MO 63017 Job Truss Truss Type Qty Pty V68-yard View Budding D-2nd Floor' 137921920 t;35970F3 F31 FLOOR 3 1; Jeb Reference fogUonaq _ Universal Component Corp„ EAST ftl4 M C7,06512, '8,010sWub 11 2017 MITek In'du"strles,-Inc.Wed Jul 24;iB:40:15?20i9 Pag ID:ndIRDAhLEUvd7PklBgAvyTyugda-?9f5UPQWnAsBX9rXMBMu4S3YL2a4_dYz?nt3RyuoLB L 2-6-0 1-1-8 1-6-14 I 0 N6 Scale=1 27„7 2011 . 1,5x3 It 4x4 = 1.50 II 1.5x3 11 4x8 = 3x3 11 4x12 = 15x3 = f 21 2 22 3 23 4 24 5 25 6 26 7 27 8 16 17 14 18 13 12 19 11 i^ 20 9 46 II 46 II 3x6 FP= 3x6 FP= 6x10 6x8 = 6x6 = 41.9.0' 1St td. LOADING (psf) SPACING- 1-8-0 CSI. DEFL. in (loc) I/deli L/d PLATES GRIP TCLL 40.0 Plate Grip DOL 1.00 TC 0.58 Vert(LL) -0,15'14-15 >879 360 MT20 1971144 TCDL 12.0 Lumber DOL 1.00 BC 0.49 Vert(CT)' -0.21 14-15 >648 240 BOLL 0,0 Rep Stress Incr NO WB 0.58 Horz(CT) -0 01 .10 nla n/a BCDL 10.0 Code ISC2015rrP12014 Matrix-S Weight 81 Ib FT=20%F,11%E LUMBER- - - ®RACING- CHORD 2x4 SPF 2100F 1.BE(flat) TOP CHORD Structural wood sheathing directly applied or 6-0-0 cc purlins, CHORD 2x4 SPF No.2(flat) except end verticals 3S 2x4 SPF No.2(flat) BOT CHORD Rigid ceiling directly applied or 6-0-0 cc bracing., REACTIONS. (Ib/size) 15=217/0-2-4,10=221810-3-8 Max Uplift 15=167(LC 4) Max Grav 15=462(LC 3),10=2218(LC 1) FORCES. (lb)-Max Camp/Max Ten,-All forces 250(lb)or less except when shown; TOP CHORD 1-15=-267/2,8-9=-89210,2-3=-743/1161,3-4=-74311161,4-5=-743/1161,5-6=0/3288, 6-7=0/3286 BOT CHORD 14-15=-475/644,12-14=-11611743,10-12=-2218/38,9-10=-187010 WEBS 6-10=-300/4,2-15=724/534,5-10=-1864/0,2-14=-771/153,5-12=011485,4-12=-33210, 7-9=0/2058.7-1 0=-1 78 410 NOTES- 1)Unbalanced floor live loads have been considered for this design 2)Provide mechanical connection(by others)of truss to bearing plate atjoint(s)15. 3)n/a 4)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 5)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 cc and fastened to each truss with 3-10d(0.131"X 3°)nails. Strongbacks to be attached to walls at their outer ends or restrained by other means 6)CAUTION,Do not erect truss backwards ©ii NE LOAD CASE(Sj Standard , 1)Dead+Floor Live(balanced),Lumber Increase=1,00,Plate Increase=1,00 CO Uniform Loads(pif) Vert-9-15=-17,1-8=-87 < Concentrated Loads(lb) +' t •' X, Vert,8=-800 C7 RdP SSI"- July SI”-July 24,2019 mew ®WARNING-Verify design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE 1111-7473 rev.10/03/2015 BEFORE USE g Dav{gn} i d-for fisc nplytsdti4 fifiTe[ pyinttrms rfifa dpNpi(t2 tiritnirl antq upnrt pfitapintars agrrr"undis frX till Itidtv{ddal tullAta�C m►1d011ptt1fR) �c .o trusx uy;.iynr;6ifrenr udr,Bus bvlidtliq;di�lppa(iiluat viulry dta ppplieirhWty ut ddml�+mrd+nptnr8 en¢•ptopctiy tne5mtirtttrs.ihts deaipq Into Uiar overop &ui�l(n0'dozlg+tl�@rac(nq,indi:alei!to to Rra+Jdnt huckFfap"of firli�ddual tnFsp'kv�b ondrnr diprdroarri6erc,Doty:Flddipannttompidnry`and pnrrnanMtt fir��ilp, ,��'��` 6fi?rtirrays,'rvgit:a+lf�rrtnl113ytitsdtaprovi.nte#llsp?�§i�{illi'sslty4ttj?eicorptl�,utygnit�+ragWtydG`mirgu,,�N`rjnis4fel,gdtdoncarngt+rdlnplhiz,.__ , rnfalcbt(an ste�n$�n.daP+dryy u[ac�ort;and14P0e d/'trtaysem 0rxlltiriSl uy9 Ornu:§eS "' ANSlfri't{gnplity Qrifottp,t)Sii$9 artd BC^�l Blaldinp Component 16023 Swingley Ridge Rd ,ruSC6ry Igfonnption-xYeiiOhld,(tumTn{aY P{a!>aIC[1�1(tdr<l2t$rd.ted SVes�r;�tala 312,1Vax^nnr�,11A 7?3fd_ Chesledield,MO 63017 ,rues Truss Type Qty —Ply i ln�syurd Vlew Bwlding D 2nd Floor 137921921 3597OF3` F32 Floor Supported Gable 1 1 5D>>Rze[n rtd-fop8oiial). Universal Component"Corp, EAST 14A'VEN CT 06512 8,0 s AUg 11 2017 MITek Iridu OS,InC.Wert'U 2 '042019 pade, �1 ID'ndIRDAhLEUvQ7FklBgAvyTyugda-xYnsv5RmJo6vnT?wTZON9tB ?rLBSOmrRJG 7JyuoL9 0-N6 Scale=1 1 4 41 2 42 3 43 4 `44 5 V 45 6 46 7 47 8 48 9 49 10 50 11 51 1252 13 284 r"�`-`` '3`E4'r'- _^"^'�-'•- y �"" � `" �� a-fry—�;" '*r t`•at '^ '`;h.'`r'r`s",:..`�i`...�_x.� r�i 1`zK,�^,..F,•.4.J,,.`.a..,.wt'..f-a;,�.�s':... - ='x�.`A 40 14 27[a Y29 28 30 25 31 24 23 32 22 33 21 34 _ 20 35 19 38 18 37 17 38 16 39 15 3x3 = 3x6 FP= " - - - — 16-0714 - _- - LOADING (psf) SPACING- 2-0-0 CS1. DEFL. in (loc) Udell L/d PLATES GRIP TCLL 40.0 Plate Grip DOL 1.00 TC 0,18 Vert(LL) n/a n/a 999 MT20 197/144 TCDL 12,0 Lumber DOL ' 140 BC 0.19 Vert(CT) n/a n/a 999 BCLL 0.0 Rep Stress Inca YES WB 0.03 Horz(CT) 000 14 n/a nla Weight-56 ib FT=20%F,11%F BCDL 10.0 Code IBC2015(rP12014 Matrix-S LUbiABER- BRACING- TOP CHORD 2x4 SPF No.2(flat) TOP CHORD Structural wood sheathing directly applied or 6-0-0 oc purlins, BOT CHORD 2x4 SPF No2(flat) except end verticals. WEBS 2x4 SPF No2(flat) BOT CHORD Rigid ceiling directly applied or 6-0-0 oc bracing. OTHERS 2x4 SPF No2(flat) REACTIONS. All bearings 16-0-14 (Ib)– Max Grav 42)24=309(LC 4)lb,22e309(LCoin44),21=309(LC 45),20=400),9(1L4C 46)(19=309(LC 47)(184310)9.2(L5C 48), 17=309(LC 49),16=308(LC 50),15=31 0(I_C 51) FORCES. (lb)-Max.Comp./Max Ten.-All forces 250(ib)or less except when shown. TOP CHORD 1-2i=-263/10,13-14=-259/14 WEBS 2-26=-280/0,3-25=-27910,4-24=-27910,5-22=-279/0,6-21=-27910,7-20=-27910, 8-19=-279/0,9-18=-279/0,10-17=-279/0,11-16=-279/0,12-15=-280/0 NOTES. 1)All plates are 1.5x3 MT20 unless otherwise Indicated. 2)Gable requires continuous bottom chord bearing. 3)Truss to be fully sheathed from one face or securely braced against lateral movement(I e.diagonal web). 4)Gable studs spaced at 1-4-0 oc 5)This truss has been designed for a moving concentrated load of 250 01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with'any other live loads. 6)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 oc and fastened to each truss with 3-1 Od(0.131"X 3")nails, Strongbacks to be attached to walls at their outer ends or restrained by other means 7)CAUTION,Do not erect truss backwards .OF t� Ix, W til ��F�S 51 pNQa. July 24,2019 ®WARNING-Verlfy desiyn parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAOE•MII.7473 rev,1010312015 BEFORE USE ®� ! Oi%gtai),6hlWtu",u%c only VilthWTeROc0ruldbtcrsTbKduOlpnIahascd011Y Pmmater3stto�s7ucgdTafaratnin*dualbvu[Il cInti�oavoro• - "=JtfP by'etLi@'falarrt,PSP�tPoRiniaflil4QdGN0narYn4t�ivArifytAadppt{cnt11117yd1d£tllt{jti'3>�pfi0ip'riandplPpu+tylnCtrpdrbiel3df{d�gniriteUIGQ�Pri1l1 - mi is#3lwtlyp,fe9niftldf{rr plat:(5fi+nnditi r+rrrnnt rz&14zflsa 5rrih turClbLo,PnraPini in(uryaMi fF?PPtY'Hami�JP,FPYgrnetn[ntMlptL"»re8"aznhrg tttn_ tekrrtcntk n,#1Pal3Dfe.duooty,elerklPn and t ddnO t f trusses a xt Uu45 ayLtP�r+�, ae ;A iSt i gdt AuaUty Cruor)!•038 07 Sqd<@1„Bullatng Component 16023 Swingley Ridge Rd ScIPiylnlotRta3inn'-riti:d�IQfrPnM17zu�F!lPlgktsPtl7td 238N.i:+sn5uuet;Sulfas3:LAinua�ddu,VA�22at4,- _ - Cheste�eld,M063017 _-_-- Truss - Truss Type Qty PFJ Vineyard VtawBulldhiq D 2nd Floor'-- - - -- 137921922 35S7pF3`' F33 FLOOR 9 1 _ oU Reference fo tlonaf - Universal Component Corp., -',EAST,HAYEN CT 06512 8.010 s Aug i1:201TMiTek Industries,Ihc.-"Wed Jul-24 16'40:0520.19 PDga,1' iD ndiRDAhLEUvQ7PkIBgAvyTyugda-QkLE6RSO45EmOda61 Gvc14h4EFbNBQ?_f2?XfmyuoL8 Scale=1 20,4 1x3 11 44 = 1x3 If 1x3 IIS 4x4 = 1x3'II 1 14 2 15 3 16 4 17 5 18 6 - - 1,1II/ 11 9 12 8 46 11 13 -7 46 Il 46 11 46 11 12.0.2-.- --- --- —-— - - - - - - -- _ Plate Offsets(X,Yj•- [9:0-3 O,EddeL`i9:11-3.O;EtSus3 - _ � - - =---- - - - - LOADING (psf) SPACING- 1-8-0 CSI. DEFL. in (loc) Ildefl L/d PLATES GRIP TCLL 40.0 Plate Grip DOL 1.00 TC 0,47 Vert(LL) -0.18 7-8 >810 360 MT20 197/144 TCDL 12,0 Lumber DOL 1.00 BC 045 Vert(CT) -0.21 7-8 >673 240 BCLL 0,0 i Rep Stress Incr YES WS 0.22 HOrz(CT) 0.01 7 n/a n/a BCDL 10'0 Code IBC2015/TP12014, Matrix-S i Weight:•59lb FT 20%F,II%E LUMBER- BRACING- TOP CHORD 2x4 SPF No.2(flat) TOP CHORD Structural wood sheathing directly applied or 6-0-0 oc purlins, CHORD 2x4 SPF No.2(flat) except end verticals, is 2x4 SPF No.2(flat) BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing. REACTIONS. (Ib/size) 10=614/04-6,7=614/Mechanical FORCES. (lb)-Max CompJMax.Ten.-All forces 250(lb)or less except when shown. TOP CHORD 1-10=-270/0,6-7---270/0,2-3=-140010,3-4=-1400/0.4-5=-1400/0 BOT CHORD 9-10=0/954,8-9=0!1400,7-8=01954 WEBS 5-7=1072/0,2-10=1072/0,5-8=0/546,2-9=0/546 NOTES- 1)Unbalanced floor live loads have been considered for this design 2)Refer to girder(s)for truss to truss connections, 3)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 4)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 oc and fastened to.each truss with 3-10d(0 131"X 3")nails, Strongbacks to be attached to walls at their outer ends or restrained by other means. OF NEW - f`�'�J,t4 GA q&- '0 m'. z R -pc-SsAo"' � July 24,2019 ®WARNING-Verity design parametersand READ NOTES ON THIS AND INCLUDED 6iITEK REFERENCE PAGE MII.7473 rev.10/03/2015 BEFORE USE Ouafgnvalid foe u::ouhlyw01thlrri)&=11W OS.Tfu&tl0tfgn1G6rdonly,ultoaPamrRulmOizflt:and1pfprnn.4ndMilualbulhtmgGo';P'I iah'tgnd. urnia6.ayWim,fdarcrat tt,Ili WrlfdinjdalUrtermzssivu{dylhb'apµlleohildyUt$rA�Qnpr;rartiAlWatmdpropnrly`InCctpcfaWfoiniloylgnIntnINn&rsra0' , huAdh q'dea!Qn Rtadag Indicated fatap/avenl hOrklin9 of lnd�ldnal truss web am orchwd mnmhnm0ly.Addi0orvittempamty urld i�ammnool bmclnp isnlw0r,,requitodfor otafri14,and'taptovanlm+lupowthpassibleparxaimlft�uryanu�xt>Fegyydamage;'Fmgnna3ltquldauiearequrdM2lho d0linaatian,dtafagd,delivorryY'aadioifantlUttidng�,oluucsns-and u0855yalalna:Beb INSIMPH .ilry,Crhodo,D56-80,ond8C5f8ulldlnp,Component 16023SwingleyRidge Rd Snfolyh4_or'MA00a,nUnitahlatramitvus,PiateInaUllrl Z{8pttLeeaural,Sulir.'312,klAxdtidriA,VA223t3. Chesterfeld,MO63017 Job Truss Truss Type Qty Ply Vlneyafd Vlew Sulldhig 0 2nd Floor 137921923 35970F3' F34 Floor 3 1 _ Jab Reference[oa6ona!_ Unlversel C6Rp nenVCorpr,- EAST HAVEN CT 06512 8.010 s Aug 112017 M1Tek tndUstrles,Inc, Wed Jul 24 16:40'08 2019 Pape 1 I D.nd IRDAhLEUvQ7PkiBgAvyTyu qda-uwJcKnTO rP M dO n 91 b_QrEI D FSfwFwsi7 u dl4CCyuoL7 2-6-0 Scale=1711 1 5x3 II 4x6 = 1.50 11 44 = 4x4 = 3x6 FP= 1.5x3 II 46 = 1-50 II 1 21 2 22 3 23 4 24 5 6 7 25 8 26 9 s 1 , 17 15 14 13 18 12 19 11 20 f+, 4x4 3x8 = 3x8 MT18H FP = 1x4 II 1x4 II 3x8 = 4x4 = -Plate Offsets(X Y)— (R'0•'i-B Edctel•[5'0.1,8;Edae]' 10 Edae,O 1-61 tl6:Edpe,O 1 81 - LOADING SPACING- 1-8-0 CSI ( }- 400 OEFL. in loc I/defl Ud PLATES GRIP TCLL 40 0 Plate Grip DOL 1.00 TC 0.50 Vert(LL) -0.34 15-16 >580 360 MT20 197/144 TCDL 120 Lumber DOL 1.00 BC 0.54 Vert(CT) -0.43 15-16 >457 240 MT18H 244/190 BCLL 0.0 Rep Stress Incr YES WB 0.32 HOrz(CT) 0"03 10 n/a n/a Weight,71 Ib FT=20%F,11%E BCDL 10.0 Code IBC2015ITP12014 Matriz-S LBRACING• UMBER- TOP CHORD Structural wood sheathing directly applied or 6-0-0 oc purlins, TOP CHORD 2x4 SPF No,2(flat) except end verticals BOT CHORD 2x4 SP 285OF 2.3E(flat) WEBS 2x4 SPF No,2(flat) BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing, REACTIONS. (Ib/size) 10=847/0-2-4,16=847/0-4-6 FORCES. (lb)-Max Comp./Max.Ten -All forces 250(Ib)or less except when shown, TOP CHORD 1-16=-270/0,9-10=-270/0,2-3=-2223/0,3-4=-222310,4-5=-2532/0,5-7=-2223/0,7-8=-2223/0 BOT CHORD 15-16=011345,13-15=012532.12-13=0/2532,11-12=012532,10-11=011345 WEBS 2-16=-1526/0,2-15=0/997,3-15=-30710,4-15=-4951152,8-10=-1526/0,6-11=0/997,7-11=-30710,5-11=4951152 NOTES. 1)Unbalanced floor live loads have been considered for this design, 2)All plates are MT20 plates unless otherwise indicated, 3)Provide mechanical connection(by others)of truss to bearing plate at joint(s)10 4)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads, 5)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 oc and fastened to each truss with 3-1 Od(0 131"X 3")nails, Strongbacks to be attached to walls at their outer ends or restrained by other means. GA ndE r w to Z)A 010800q% July 24,2019 WARNING-Verify design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE 01.7473 rev 10/03/2015 BEFORE USE D"4U11 varid,lcr,uaa aril'y vrWa Ai'fObit+cennectnrs Thlb doMpn in hosud,wrly upon pr rnm�nn shmm,and k(nr iin!ddjildunl au+hllpaeamponen4 prat rt/f T �, n buns ayetpm;9eforo ow,tlaa bw1&q deelpermootwdrythe a11;At:aW1Jly of MOO pataraelem and Pmj)Vly Ir"tavrptYatn Uafi Coaipn'htto thu o6ora11 f MiTek' txiItding dnaign Cradnp lndtcatotl tato prnveN Uucldln0 otindrvidunl Uu:s,wrb nnUlor c6o!d mariaho:e only.QddtLantal temporary and pgrmnneat EacinO [I 'H c9n0Ya tOpuneC Inr s!nhlpiy nrid to rre�cpt c�na.e w5da dna+Nn neraonn)Iraiurynnd NiaraOriy dvpago,Fay penrrN gulilenca rnga+ding ttec _ 16023 faWicntkvl,srtra,+,a.dc.Uvw.y,FJ�scrinn&rdtuttc�.g�.lr,:AS�s�,d:tss�,.-.ays!ums,SSO_ _•P-NSfffFl1A00r1Y5'!!!'d°.46H9BPnd@CS18u11dingCamponent ChesterfieldiMO63017d Safety bltoamailon ovollnhlo from TfaaS Fintr InaliOr[o,218 N.t.ca SUn ek Sune 312,f}Igas;mirin;,V1.2232A, � �� -Tfuss Type " Qty' PPy VtnsyardVlew Building D 2nd,F1t10t — 137921924 35970F3 F35 FLOOR o 1 Joh ReferenceG+�t3dttall Univergal Component Corp.',-'"-"'EAST hIA1%EN C T:Fit'a12 "� - "-' --- - ' -. -'- 8.010'5 ft 11 201 r;M1 d IndUtittrri05,Int;,'Waft 10[2416t4M2}19 Pa�4,T' t© rdiRDAfrLEU,eQ7AkiBg7lvyTtwt(d'ag�liUFrtEVH)wtUNiCF�JhIF?Sltclbttf t7rnKxtri4 OB SODL5,' 2-6-0 0-11-14 , Scale,1/2"' 1x3 II 3x6 = 1x3 II 3x3 = 1x3 II 3x6 = 1x3 II 1 17 2 16 3 19 4 20 5 21 6 22 7 o t 13 11 14 1D 15 94x6 II 16 4x6 11 6x6 ;z 3x6 II" 4x6 II 14-1-6 -- LOADING (psf) SPACING- 1-8-0 CSI. DEFL. in (loc) 1ldefl Ud PLATES ,GRIP TCLL 40.0 Plate Grip DOL 1.00 TC 0.49 Vert(LL) -0.15 8-9 >999 360 MT20- 197/144 TCDL 12.0 Lumber DOL 1 00 BC 043 Vert(CT) -0.19 8-9 >891 240 BCLL 00 Rep Stress Incr YES ' WB 0 27 Horz(CT) 0_,02 8 n/a n/a BCDL 10,0 Code IBC2015frP12014 MaOX-S Weight,70 Ib FT=M%F,11%E LUMBER- BRACING- 'CHORD 2x4 SPF No2(flat) TOP CHORD Structural wood sheathing directly applied or 6-0-0 oc purlins, 'CHORD 2x4 SPF No.2(flat) except end verticals. 3S 2x4 SPF No.2(flat) BOT CHORD Rigid ceding directly applied or 10-0-0 oc bracing. REACTIONS. (lb/size) 12=723/0-4-6,8=723/0-2-4 FORCES. (lb)-Max:CompJMax Ten.-All forces 250(lb)or less except when shown. - TOP CHORD 1-12=-27010,7-8=-27010,2-3=184510,3-4=-1845/0,4-5=1860/0,5-6=1860/0 BOT CHORD 11-12=011165,10-11=011860,9-10=011860,8-9=011179 WEBS 2-12=-130910.2-1 1=0[764.3-11=-30510,4-11=-2621279,6-8=-1326/0,6-9=0/765,5-9=-251144 NOTES- 1)Unbalanced floor live loads have been considered for this design 2)Provide mechanical Connection(by others)of truss to bearing plate atjoint(s)8,- 3)This truss has been designed for a moving concentrated load of 250.0lb live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any'other live loads. 4)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 oc and fastened to each truss with 3-10d(0.131"X 3")nails. Strongbacks to be attached to walls at their outer ends or restrained by other means. oF NE WGA 01 JLu p;910 July 24,2019 ®WARNING-Verify design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE At/1-7473 rev.1010312015 BEFORE USE Dual)fnvidtfTr uss+dllYwlttrnu;alaxlcarumetar 7h�dajpntyh"asaipplyupodpare Nt4rscHawn,an6lataranind{vldna(aut�ggeampanatd.not n ,b,4nass'yatam i�aratautw,,tea,hUlid)ngdcajQnOrrtou�vrurYylHriapp(fcablSlyatdtatgry,pnnlmatgr addtC+opnity'in'saparS4tittdi'yfi� pRiotulha'averalt W47 lto - yt7 0 i tj is ryi hurl d l(t rtt ittd1�d ll t- - tc`nrdtor Gttt)>}IRainboaa onl'hrtdi![npaRa ri ark"add ilnmtliuent Pirretng IfJ,tij. �fegUI'M,r�tt{wity,Ti6 tQpaova'c'i lip'�4alhRttS�IpiylPe�SFxPnI'tnjU!YARdFcropurt7tdompOF:FacgtmtftClflpidanEo+aptlydilu�lffts UWd6UVaH,>w.titfei�a,ddiiv�Y.'atOrtlatOtntdbr0elapaftrttSst:SNndtrd:ISSyaCCtUd,sao - M}1Q'f�tlQuatltyCt(titrio;02iFitiaend�CStBt111dtagComponent 1S023Sw,ngleyRidgeRd-- ' 5nfalylydonnnlian aJnlahiafto,ZTrura(?tit, IiiiiilUt4,218[Vt fStraaac4ttfd,3i2;111 nddq.Vh2211d. chesterfield,NO 63017 - ------ - Jpb Truss Truss Type- - QtY ply Vln0 i td Visiw BUSS hlg D 2nd Floor 137921925 5970F 36 Floor Supported Gable 1 1 Jett Retorence`(ojI at -_ --- Universal Component Corp. ;CASTHAVEN CT 06512- ---- $.010 s Aug 1,1 2097 iu1t��r 7c I(tdtttttrltis,lltc.i+Y9tl Jul 21',{6,aU, 20,39 Fatty!_ ID,t1d1RDA}tLEth�iTl'htBgAV,�YugO lllypVv81(jBt£ut6�l'swnlrlll3F)7aabzfuXyunL4 Scale=1• 1x4 II' 1,5x3 II 1 30 21 31 3 32 4 33 5 34 6 35 7 36 8 37 9 38 10 F y e o v -- - ." - — ,_- y,-" .�--'a r r-,^,:.-^�`s.<+-',m.... 'd,C,�•.;f�s'�_ azo F'," .� J.ti�. *'`x '' k;Y�, '�` "�- _ �,w.3"�z'4�',t}yr�w.;*'s`'w ��.h��v-s�``�� a .�.�_.. _.;,•:.4•.� ',�,:.ri9�.�.w �x.. ._.r" 20 21 19+ 22 Tl 18 23 17 24 16 25 15 26 Y 14 27 13 28 12 29 11 1x4 II LOADING (psf) SPACING- 2-0-0 CSL DEFL. in (too) Vdefl L/d PLATES GRIP TCLL 40>0 Plate Grip DOL 1100 TC 0.18 Vert(LL) n/a n/a 999 MT20 1971144 TCDL 12.0 Lumber DOL 1 00 BC 019 Vert(CT) n/a n/a 999 BCLL 0.0 Rep Stress Incr YES WB 0.03 Horz(CT) 000 11 n/a n/a Weight 42 Ib FT=20%F,11%E BCDL 10.0 Code IBC2015frP12014 Matrix-S _. LUMBER_ — - - BRACING- TOP CHORD 2x4 SPF No.2(flat) TOP CHORD Structural wood sheathing directly applied or 6-0-0 oc purlins, BOT CHORD 2x4 SPF No,2(flat) except end verticals- WEBS 2x4 SPF No•2(flat) BOT CHORD Rigid ceiling directly applied or 6-0-0 oc bracing. OTHERS 2x4 SPF No.2(flat) REACTIONS. All bearings 11-11-6 (lb)- Max Uplift All uplift 100 lb or less atjoint(s)11 Max Grav All reactions 250 Ib or less at joints)except 20=275(LC 31),11=274(LC 40),19=310(LC 32),1 B=308(LC 33),17=309(LC 34),16=309(LC 35),15=309(LC 36),14=309(LC 37),13=309(LC 38),12=309(LC 39) FORCES. (lb)-Max Comp,/Max„Ten,-All forces 250(lb)or less except when shown TOP CHORD 1-20=-263110,10-11=-262/12 WEBS 2-19=-280/0,3-18=-27910,4-17=27910,5-16=-279/0,6-15=-279/0,7-14=-279/0, 8-13=279/0,9-12=-27910 NOTES- 1)All plates are 1x3 MT20 unless otherwise indicated, 2)Gable requires continuous bottom chord bearing. 3)Truss to be fully sheathed from one face or securely braced against lateral movement(t e-diagonal web), 4)Gable studs spaced at 1-4-0 oc 5)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift at toint(s)11. 6)This truss has been designed for a moving concentrated load of 250,Olb live located at all mid panels and at all panel points along the Top Chord and Bottom Chard,nonconcurrent with any other live loads. 7)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 cc and fastened to each truss with 3-10d(0,131"X 3")nails. Strongbacks to be attached to walls at their outer ends or restrained by other meansf CO 0.080 "r �t' ¢ r•� ' 'CG Q 6 S6o'� . pp July 24,2019 AWARNING-Verifydesfgn Parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCEPAGE Mit-7473 rev.101031205BEFOREUSE i { qe,{gnuAtldfrrrus��ifp.vifgtMfi6k�ainnetar�z,'tg��d�!ttnlibascdatra�uptuiFtvuiri�tc!>+chd{wt,®ndtalartmtinUturdudt6t�th13hgcomptrttnnlarzpa .i . a'l,ot+a hyt5ta t 'My dar 80forp anti,uio ttdgdtnp ct sipndr must verity 1hn apppea agrt pari ldMB{end pr vptuty iaso parstn this dae4q n tr m thgotpnr+ll R � � '° nvdinp�tin ;ttfncnAttrti,cnicdsatnxgrttlLfrthtlnl[t3Jna#Ctdfs4alt�itlerttRrdtntsVbaR»anly.iukdAluitaSlFnpotbtyuttdpatrnanantttar3nq R4alwayy::inquired"i$rldohl7l#y,nAtttn�iiavtvtleDttanpsnrntti,poaWtdt?4Lrimc3int9n')uryin4tirronuftydEtmO¢tt:.Faroe>iornt9�rtduorcarg9'rdAagifrP " tabrdcfititin.'atOrs%ru,duGv nre.gri»and bias'M_i}tttnusa�asctttuss sj.rttrar;.se5 AN31lrPtt Gun111y cr€turta;05it•OS end 43081 Bvlldbt8 Component y Chesl field,ey Ridge Rd W1o1y lntwmuUart•u++ntt€t}uilnm Tnse PtaLu rrfsiHutc, ,18N:ttr^atrnat;StGto 312..AIrixRrtdrro,slA 9:.47�i., - - - _ tI Chesterfield,M063017 - - Job--- - Truss -- - --Truss Type Qty P Vingyafd View Building D'?nd,Flodc 137921926 35970F3 F37 Floor Supported Gable 1 1 _ _ �JDS'Ref�encE o•Aanai._ ___ _ _ _ 'UnNei-ssl Component Corp„” ',!AST HAVEN CT 06512—, Ba110's,AUp;t12017 MITeklndusl6es,Irm.,Wed Jul 24'16:40,10 2019--1'690 1' ' IDaitll}�Ofy{,L'Eklu(3?PkiHi{�1vyTyuyda=mi87881h!Xup1:V013ygVrtpR079GtV,EskFJnF�IL:yuou3' 1 1x3 II 4' 2 1x3 11 10 31.5x3 II Scale=110,21 LI l f - �i�ll i� F1 ii hP Y qY h`u K?c�sl m � if�q iS�aF�x{AV-moi y�K.t.+`.X� sem(YqN�/,A(�'s�`,F•y +r^s •�n�`rY�r...�:i'xh.�"=:ac�:��,.,rx':»v'�tm"s-" �mac:��.axc">b i.+,.aa.-...,Jm...� �.`n-.--- 6 7 5 a 4 10 II 1x3 11 1x4 I! 292 _— _ R _ 242 — LOADING (psf) SPACING- 2-0-0 CSI: DEFL. In ((oc) (Idefl Lld PLATES GRIP TCLL 40.0 Plate Grip DOL 1-00 TC 0r20 Vert(LL) nla n/a 999 MT20 197/144 TCDL 12.0 Lumber DOL 1.00 BC 0 21 Vert(CT) n/a nla 999 BCLL 0.0 Rep Stress Incr YES WB 0;03 Horz(CT) 000 4 n/a n/a BCDL 10.0. Code IBC2015/TP12014 Matrix-S Weight.11 Ib FT=20%F,11%E LUMBER- - BRACING- _ TOP CHORD 2x4 SPF No.2(flat) TOP CHORD Structural wood sheathing directly applied or 2-9-2 oc purlins, CHORD 2x4 SPF No Z(flat) except end verticals, 3S 2x4 SPF No-2(flat) BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing. JERS 2x4 SPF No,2(flat) REACTIONS. (Ib/slze) 6=7112-9-2,4=77/2-9-2,5=179/2-9-2 Max Grav 6=275(LC 10),4=277(LC 12),5=314(LC 11) FORCES. (lb)-Max.Comp/Max.Ten.-All forces 250(lb)or less except when shown: TOP CHORD 1-6=-26315,3-4=-26410 WEBS 2-5=282/0 NOTES- 1)Gable requires continuous bottom chord bearing. 2)Truss lobe fully sheathed from one face or securely braced against lateral movement(Le diagonal web)., 3)Gable studs spaced at 1-4-0 oc 4)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads.. 5)Recommend 2x6 strongbacks,on edge,spaced at 10-0-0 oc and fastened to each truss with 3-10d(0.131"X 3")nails. Strongbacks to be attached to walls at their outer ends or restrained by other means �`OF NEQA ; .. LU t I!J July 24,2019 ®WARNING-VMl y design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE Mll-7473 rev.1010312015 BEFORE USE �• 'AdsPOn Vuf,�d tai use only H11h trllTek21 wndecla+a.TIBa daeipn'1sbe0ed'im)y uprlii psumele!><SIIuwAi and 15 f0n00Ingivtdual huilding mmpanOnL`,no, n Buss aysto,n,6o(,mn uxp,INg bn114lnsj i(e5i0nUc rquat v0niy thotgplfFa6sl:ly of daei0n pnrnCals and PrupiuPy 1p`anrpohlo fills dnaipn lriia itin wnmll4 bulWlOg`dgily r,6rpe[nG k+dleai&i Is fbprevanl lvcW(pg q,Ia vlaual'buay web m+illceeha+d m0mbcia Only,Addlilanni lori Pwnry?nd ppcumtinerli umon0 MiTekF (nnlnardginra6torslnhlrlymxl,11epragnn(rn�l0psa,wll+posy+uingaraogat nyry3nd[!n1+a+tYdnmaOu.FwOcnnrnl{iuldanrarngunllnjlnn rngn�lian,ataa0a,ddltG' ,ainGifmir lid brrielnp ol'Ini sesnisd Uu45ays?dms,sen. 9}NSIffPll Queli,y Cri,Arlo,USa SB and flCSt l3W,ding Component 1G0238criag,ay Rod u Rd snfaty Infomintlon'avnlllo lrom ffNs P(ata Inalltuie,7113'M,Lao Sune(,Suiln 312,Neiwndfln,VA'2231h. C ,erlicld:RtO dQ1�' SYM."As --- Numbering system, AiL General Safety ro tes PLATE LOCATION AND ORIENTATION " Center plate on joint unless x,y 6-4-8 dimensions shown in ft-in-sixteenths Failure to Follow Could Cause Property a offsets are indicated. (Drawings not to scale) Damage or Personal Injury Dimensions are in ft-in-sixteenths. Apply plates to both sides of truss ' 2 3 1. Additional stability bracing for truss system,e.g. and fully embed teeth TOP CHORDS diagonal or X-bracing,is always required. See BCSI. Cti-? 027 2. Truss bracing must be designed by an engineer For Q ie, 4 wide truss spacing,individual lateral braces themselves WEBS' may require bracing,or alternative Tor 1 F� � p bracing should be considered. iY m 0. 1 O " y 3 af7� ' 3 O 3. Never exceed the design loading shown and never U ;N U stack materials on inadequately braced trusses. 00 0.0 4. Provide copies of this truss design to the building For 4 x 2 orientation,locate c&7 Cs' 1— designer,erection supervisor,property owner and plates 0- 'lid'from outside BOTTOM CHORDS all other interested parties. edge of truss. 8 7 6 5 5 Cut members to bear tightly against each other. 6. Place plates on each face of truss at each ® This symbol Indicates the JOINTS ARE GENERALLY NUMBERED/LETTERED CLOCKWISE joint and embed fully.Knots and wane at joint required direction of slots in AROUND THE TRUSS STARTING AT THE JOINT FARTHEST TO locations are regulated by ANSIITPI 1. Connector plates. THE LEFT. 7 Design assumes trusses will be suitably protected from CHORDS AND WEBS ARE IDENTIFIED BY END JOINT the environment in accord with ANSI/TPI 1. "Plate location details available in MiTek 20/20 NUMBERS/LETTERS. software or upon request. B hall nototherwiseUnless exceed 19%eat time of fabricatiod,moisture n. lumber PRODUCT CODE APPROVALS 9. Unless expressly noted,this design is not applicable for PLATE SIZE use with fire retardant,preservative treated,or green lumber. IGC-ES Reports: The first dimension is the plate 10,Camber is a non-structural consideration and is the X 4 width measured perpendicular ESR-1311, ESR-1352, ESR1988 responsibility of truss fabricator General practice is to to slots.Second dimension is ER-3907,ESR-2362,ESR-1397,ESR-3282 camber for dead load defiection the length parallel to slots 11.Plate type,size,orientation and location dimensions indicated are minimum plating requirements. LATERAL BRACING LOCATION 12.Lumber used shall be of the species and size,and in all respects,equal to or better than that Indicated by symbol shown and/or Trusses are designed for wind loads In the plane of the specified, by text in the bracing section of the truss unless otherwise shown. 13 Top chords must be sheathed or purlins provided at output Use T or I bracing spacing indicated on design. If indicated Lumber design values are in accordance with ANSI/TPI 1 14.,Bottom chords require lateral bracing at 1Oft.spacing, section 6.3 These truss designs rely_ on lumber values or less,if no ceiling is installed,unless otherwise noted. BEARING established by others. 15.Connections not shown are the responsibil'dy of others. Indicates location where bearings 16,Do not cut or alter truss member or plate without prior 1 (supports)occur. Icons vary but C 2012 MiTek®All Rights Reserved approval of an engineer. reaction section indicates joint number where bearings occur. 17 Install and load vertically unless indicated otherwise. Min size shown is for crushing only. R 1 B.Use of green or treated lumber may pose unacceptable ` environmental,health or performance risks Consult with project engineer before use. Industry Standards: ANSIrrPI1: National Design Specification for Metal 19 Review all portions of this design(front,back,words Plate Connected Wood Truss Construction, and pictures)before use,Reviewing pictures alone is not sufficient. DSB-89: Design Standard for Bracing. a BCSI: Building Component Safety Information, 20.Design assumes manufacture in accordance with 'MiTek Guide to Good Practice for Handling, ANSIfrPI 1 Quality Criteria. Installing'&Bracing of Metal Plate Connected Wood Trusses. MiTek Engineering Reference Sheet:Mll-7473 rev.10/03/2015 [GIRDER TRUSS TO BEAR OVER BUILT UP POST,DIRECTLY - POST 2..110'111ATE LOCATIONS - WALL PANEL DRAWINGS I To- 14'53/4' I.W I 31.IOW4* t 14.53/4' 1111/ 1 1 1 hTi IC4E-- 41 5314- =41 --r9 (42 I LL > Lai- • 2'0" TV 2V T�-TV V To- I-X TV TO TV TV TV <Z Z 10 1. H 6 �T}' - -- -� i I --6 go C Z > i LL < -0 X� 2 1. h I i, W 'TJ 0 a -Ll--rt ISA p �j DQ L L r 0) -C C 01? U) C 5d H I H ❑ rn II r,;2 n fN L 10Z , Z C 0 0 7M11 E 7To-. r1 1rz• Z 91 H 0 10, Z- To- TV TV TV .1. Z TV To- -0- 0 A N I 7T TV 7- V y, 0 ......... E TV 40-11 1� 0— 4'!RE 7TI1. co Architect/Budder sh I review all pitches,spans, overhangs, heel heights, loading, bearing locations, at room sizes etc. prior to fabrication, m EV Z NOTE.DRAWINGS WERE - -5-0 0 CHECKED FOR LOADING . 2 t GIRDER TRUSS TO BEAR CRITERIA AND GENERAL > C GIRDER TRUSS TO BEAR E C DIRECTLY OVER BUILT ST. DIRECTLY OVER BUILT UP POST CONFORMANCE WITH THE L4 m; q COORDINATE LOCATIONS IT. COORDINATE LOCATIONS WITH CONSTRUCTION > WALL PANEL DRAWINGS LIP P,9 WALL PANEL DRAWINGS TYP DRAWINGS ®R COORDINATE GIR R q•mE TRUSS BEARING LOCATIONS WITH WALL Z o v s a F, PANEL BUILT UP POSTS IN u y v — E WALLS !2 . ElF- V Z.2 Buildina D Roof LAYOUT a n A Scale NTS - - MITek USA, Inc. 16023 Swingley Ridge Rd - --Chester field MO 63017 314-434-1200 Re: 3597083 BUILDING D ROOF VINEYARD VIEW The truss drawing(s)referenced below have been prepared by MiTek USA,Inc. under my direct supervision based on the parameters provided by Universal Component Corporation. Pages or sheets covered by this seal: I37938909 thru I37938960 My license renewal date for the state of New York is May 31,2021. JOyo � -m V' laA4 2 Q, 4 ii Fa °•094�3'� A � . Opt- July 26,2019 Johnson,Andrew- IMPORTANT NOTE:The seal on these truss component designs is a certification that the engineer named is licensed in the jurisdiction(s)identified and that the designs comply with ANSVTPI 1. These desigris are based upon(iarameiers sisown(e.g.,loads,supports,dimensions,shapes and design codes),whlch,were given td MITek,6r TRENCO. Any(project specitic information,fncluded is for MiTeWs or TRENCOVctistorfiiers 51.64afarenr��,urpose,onty,-and was'not taken into account in the 0regaral!o-n of these designs. MiTek�r TRENCO hag not Kdependently verified the applicability of the_design•parametars-or,the designs for any partf6laf,bUiiding:, Before use, the building designer�shouldzverify,appiicabilNyof design parameters and-,properly inR orpcirate li�ese cleStgns;into me,overall buiidingidesign per ANSI/TPi 1;GhaPter 2. Job runs-- russTre. aty ply BUILDING D ROQR�VINEYARD VIEW 137938909' 3597OR3 GOI common Girder 2 1! Um4ersel_Compon6ht C&O-1 HAVEN'_CT065'12: 8.010 slAug,11.2017MITak Industries,Inc, Thu Jul 2523:14,57209 Pige+i IDuHBIG9;Ak,9 ".10E ra,.,H'Aly,-,'A'Bg-yd*.,CYDoEFtg FPh,MZlafF&A.4BDqL.,(WIZ)iBT7hfyjjNSy Q 16 tK 3-7-11 10-10.7 Ris :3,7-11 3-7-3 46 iI Scale 150.6 -4 12 13 12,00 FIT 3.6 11 3x6 14 2 n- 7 16 17 18 19 20 2122 23 15 10 a 8 4x6 4x6 = HUS26 2x4 11 5X8 = 2x4 if HUS26 HUS26 HUS26 HUS26 HUS26 HUS26 3-7-11 32-134 10-10-1 4_5-112= 3-7-3, 37-4M PIW,6 Offsets Y, LOADING (psf) TCLL(roof) 30.0 SPACING- 2-0-0 CSI. DEFL In (loc) I/defl Ud PLATES GRIP Plate Grip DOL 1 15 TC 0.20 Vert(LL) -0.05 9-10 >999 240 MT20 1971144 Snow(Pf/Pg) 38.5/50.0 Lumber DOL 1 15 BC 0.54 Vert(CT) -0,07 9-10 >999 180 TCDL 10.0 Rep Stress Incr NO we 0.55 Horz(CT) 0.02 6 n/a n1a BCLL 0,0 Code IBC2015/TP12014 Matrix-S Weight,145 lb FT=20% BCDL 10.0 LUMBER- BRACING- TOP CHORD 2x4 SPF No,2 TOP CHORD Structural wood sheathing directly applied or 6-0-0 oc purlins,, CHORD 2x6 SPF No.2 BOT CHORD Rigid celling directly applied or 10-0-0 oc bracing. 3S 2x3 SPF No.2 REACTIONS. (lb/size) 2=406210-5-8,6=3521/0-5-8 Max Horz 2=182(LC47) Max Uplift 2=-233(LC 10),6=-214(LC 10) FORCES. (lb)-Max,CompJMax.Ten—All forces 259(lb)or less except when shown: TOP CHORD 2-3=3896/215,34=-2627/227,4-5=-26271227,5-6=-3898/219 BOT CHORD 2-10=-107/2521,9-10=-107/2521,8-9=-53/2522,6-8=-53/2522 WEBS 4-9=246/3192,5-9=-1104/145,5-8=-4811538,3-9=-1102/141,3-10=-42/1535 NOTES- 1)2-ply truss to be connected together with 10d(0.131"x3")nails as follows, Top chords connected as follows 2x4-I row at 0-9-0 cc. Bottom chords connected as follows 2x6-2 rows staggered at 0-6-0 oc. Webs connected as follows:2x3-1 row at 0-9-0 oc. 2)All loads are considered equally applied to all plies,except if noted as front(F)or back(B)face In the LOAD CASE(S)section_Plyto ply connections have been provided to distnbute only loads noted as(F)or(B),unless otherwise Indicated,. 3)Unbalanced roof live loads have been considered forthis design.. 4)Wind:ASCE 7-10;Vult=1 30mph(3-second gust)Vagd=103mph;TCDL=6.Opsf,BCDL=6TOpsf,h=25ft,B=45ft;L=24ft,eave=4ft;Cat, Il;Exp B;enclosed;MWFRS(directional);cantilever left and right exposed;end vertical left and right exposed;Lumber DOL=1,60 plate grip DOL=1,60 5)TCLL-ASCE 7-10;Pr--30 0 psf(roof five load:Lumber DOL=1.15 Plate DOL=1.15);Pg=50.0 psf(ground snow);Pf--38.5 psf(flat roofsnow,LumberDOL=1.15 Plate DOL=115);Category Il;Exp B;Partially Exp.,Ct=11.1 6)This truss has been designed for greater of min roof lave load of12.0 psf orl.00 times flat roof load of 38,5 psf on overhangs non-concurrent with other live loads. 7)This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads. 8)*This truss has been designed for a live load of 20.Opsf on the bottom chord In all areas where a rectangle 3-6-0 tall by 2-0-0 wide will fit between the bottom chord and any other members. 9)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT atjt(s)2 and 6.This connection is for uplift only and does not consider lateral forces 10)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads, 11)Use Simpson Strong-Tie HUS26(14-10d Girder,4-10d Truss,Single Ply Girder)or equivalent spaced at2-0-Oocmax,starting at 4A 0-'0994 0-6-8 from the left end to 12-6-8 to connect truss(es)to back face of bottom chord. 12) Fill all nail holes where hanger is in contact with lumber. ES$1 ,D CASE(S) Standard July 26,2019 ®WARNING-Verify design parameters and READ NOTES ON THIS AND INCLUDED MIrFK REFERENCE PAGE Mil-7479 rev.1010312015 BEFORE USE DeW§nvh1fdIaras"oWywigs)1JT &c*onedom.'171*1 de&ljjlt 112 based chi)-,don parameters MovIn,and Is loran inaMdurd biri4ing componont,P.01 "PA11110 the OqLr4 MiTeIc' Fut# yapd,pfopat(ydvmnq%ia 131CIMH at U'ums-ile'd ir6ib syalemo,Liiv _`AK�Wll 4 CIM lip( OSE-69 and HCEI BuIldina Component 16023 Swingley Ridge Rd sotdiytnfomintlan Chasterrield,MO 63017 juss plrilt�neli0j.0 al�Sf4lo$12 fm Alex d0a,VA 22314; Job Truss hiss Type Qty Ply BUILDING D ROOF VINEYARD VIEW 137938909 3597DR3 G 01 Com -Mon0rd6t 2 2 Job Reference(optional2 Universal Component Corp., EAST HAVEN-CT 06512 - "" 8.010 s Aug 11 2017 f,Al7ek 1606stdt;a.Inc. 7MI Jul 25 23 14:57 2019 Pagu 2 1 D:uH81G9iAM9_WQEtKnavHVNyuW Bg-ydXYOIoEFtg_FPtvMZ1 afFM480gLxW IZH6T7hfyuNSy LOAD CASE(S) Standard 1)Dead+Snow(balanced)-Lumber Increase=1 15,Plate Increase=1.15 Uniform Loads(plf) Vert*14=-97,4-7=-97,2-6=-20 Concentrated Loads(lb) Vert:8=-817(B)15=-824(8)17=-817(B)18=-817(B)20=-817(B)21=-817(B)23=-817(B) ®WARNING-Verify design parameters and READ NOTES ON THfS AND INCLUDED MITEK REFERENCE PAGE Mil-7473 rev.10/03/2015 BEFORE USE t3,tyn Velid fpr<<aa onty wtih t11TakF1 WilnnttalF.ThIB dg7tt�n la h0aad anlyuryan parantotOra shown,aria fu for;in Indlyjddaj bdlldtn?camponenl,not, K Inisa s'y01ow0nlom tion,thn building dafilinor most VIVO wo.*pi vn6r.iy atibtstgri lowdinblurs mid prupurty biratpatata 1.19a.des l; foto Ow'oyaiull Dulidingacsign Brashiilgd,wtadtatopmurnlbuckting,orindlAduidCiowobundtoraced mambersonly. MiTek' ja ahyoyn raquirod fw aloin ily and ta,pravant onuepso w1d1 posi:it iti t+txdattgl btluly nrd,prtgrai;ydamugn=far t{uile{al�utdnn ragnrtl'u•n!60 iabttraatrn,st6r9ge,dollvo,y,arection and blaclomol ti6s6cs and duos sysrcrnII,sea AKSUrpt1 Quality Cdtarfa,DSB:da nrid Beal Building Component 16023 Swrigley Ridge Rd ,Sadly foformallaR m tlloata frnm,Tiucs P attr 1ariltuw,21B�.tc a$bv t iIIC 11d,.ilaz Ind h;VA 2314, Chastadleld,MO 63017 fiftyly--, ROOF VINEYARD VIEW--- 137938910,1 G02Job Mss 02 6ornmoni-Girde, 11- - - 3d4bReference 160644 Universal Component Corp., 9_010-sAug 11 2017 Mffek.lnd�Lstqe�,)pa.,Wt Industries, 15:02 2019 Page I 413-110- 18-442• 112-5-14 164-0 7 29.ljb� 7 7 20-8-2 25-2-1 t 41-2' r41A-ZC 45-15 5 Scale 1.:72.6 5 3.75 F1 2 X8,11, 30 7 31 466X6 Z: AX8 29 32 4x6 zz 4x8 33 4x4 27 4 10X10 10 4x4 4x8 % 26 44 zz� 4x8 2- 12 21 35 3 -JI[,1 114, 41g_! 47 48 49 3 62 6 39 40 41 42 43 44 45 .46 21 5D 5152 6 17 54 5556 57 68 59 60 61 3637 38 24 - 23 22 20 19 HUS26 18 HUS26 16 15 14 6x14 Iwo 11 2x4 11 4x4 4A = 8x14MTI8HWB 8X8 5x6 4x6 44 2A 11 HUS26 HUS26 HUS26 HUS26 HUS26 HUS26 HUS26 HUS26 HUS26 HUS26 HUS26 7x10 MT1 8H = HUS26 HUS26 HUS26 HUS26 HUS26 HUS26 HUS26 HUS26 :25-24' '.4.1-14 38-7-13---_-,._-___4 4-4 -4;3-J0_1-=�_-_,—84-12, j2&'14 A! -15" _- ,Plate [2`64-3,015M,r21:0-2-12.0-4-6j LOADING (psf) SPACING-' 2-0-0- CSI. DEFIL in (loc) I/defl Ud PLATES GRIP TCLL(roof) 30.0 Plate Grip DOL 1.15 TC 0,61 Vert(LL) -0fi8 16-18 >900 240 MT20 197/144 Snow(Pf/Pg) 38.5/50 0 Lumber DOL, 1.15 BC 0.62 Vert(CT) -0,86 16-18 >603 180 MT18H 197/144 TCDL 10,0 Rep Stress Incr NO WB 0.79 Horz(CT) 026 13 n/a n/a BCL2 OD Code IBC2015t-rPI2014 Matrix-S Weight 773 lb FT=20% BCDL _10-0 41 IBER- BRACING- CHORD 2x6 SPF No.2"Except' TOP CHORD -Structural wood sheathing directly applied or4-10-14 cc purlins, 1-4,10-13-2x6 SPF 2100F 1.BE BOT CHORD Rigid ceiling directly applied or 10-0-0 cc bracing. BOT CHORD 2x6 SPF 210OF 1 BE WEBS 2x4 SPF No.2 OTHERS 2x4 SPF No.2 SLIDER Left 2x6 SPF No 2 4-5-6 REACTIONS. (lb/size) 1=10421/Mechanical,13=10895/0-5-8 Max Horz 1=76(LC 74) Max Uplift 1=794(LC 12),13=-B16(LC 12) FORCES. (lb)-Max CompJMax.,Ten,-All forces 250(lb)or less except when shown, TOP CHORD 1-2=-21388/1668,2-3=22419/1835,3-5=-21726/1860,5-6=-19738/1785, 6-7=-17353/1640,7-8=-17365/1640,B-9=-20880/1900,9-11=r24376/2088, 11-1 2=-2743112214,12-13=-2827212169 BOT CHORD 1724=-1464/19064,23-24=1454119064,22-23=-1667/21392,20-22=-1652/20696, 19-20=-1544116763.18-19=-1659/19873,16-18=1878!23220,15-16=-2042/26182, 14-15=-200i/26436,13-14=-2003/26436 WEBS 2-24---2611375,2-23=-240/2626,3-23=-95/332,3-22=-923/24,5-22=-7512352, 6-20=r3035/165,6-20=-24013817,6-19=-42511305,7-19=-885/96B9,8-19=-572,11472, 13-18=-386/5098.9-18=-4775/308,9-16=-194/3887,11-16---3577/199,11-15=-62/2302. 12-16=-374123,12-14=3711668 NOTES- 1)3-ply truss to be connected together with 1 Od(0^131'x3")VxT')nails as follows- NE Top chords connected as follows:2x6-2 rows staggered at 04-0 or. Bottom chords connected as follows:2x6-2'rows staggered at 0-7-0 cc., V Webs conner.tpd as follows:2x4-1 row at 0-9-0 oc; V 2)All loads are considered equally applied to all plies,except if noted as front(F)or back(B)face In the LOAD CASE(S)section,ply to ply connections have been provided to distribute only loads noted as(F)or(B),unless otherwise indicated. z 31 Unbalanced roof live loads have been considered for this design. 4)Wind:ASCE 7-10,Vult--130mph(3-second gust)Vasd=103mph;TCDL=6,Opsf,BCD L=6.Opsf,,,h=25ft,B=45ft;L=24ft;eave=5ft;Cat., 11;Exp B:enclosed;MWFRS(directional);cantilever left and right exposed:end vertical left and right exposed;Lumber DOL=160 plate grip DOL=I,.60 5)TCLL,ASCE 7-10;Pi--30.0 psf(roof live load:Lumber DOL=1 0 5 Plate DO L--,I,l 5);Pg=50,0 psf(ground snow);Pf=38 5 psf(flat roof snow.,Lumber DOL=1.15 Plate DOL=1.1 6):Category 11'.Exp B,Partially Exp.;Ct=1.1 0994 nbalanced snow loads have been considered for this desigm Ill plates are MT20 plates unless otherwise indicated. his truss has been designed for a 10,0 psf bottom chord live load nonconcurrent with any other' liveloads - 9) This truss has been designed for a live load of 20.Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide July 26,2019 A WARNING-VerW design iianinefers and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE AIII-7473 reii;1010312015 BEFORE USE Fiat! 2*n%milh Y.L - am rating' trbildin6 dislow. is jopnivdid bliAllitoW I MiTeW, 6'4Wjo rinilfed(Watiibllllyland to IXUVbQt'6dI0Pe 1AIIIII and prorm"Y'dintago- organaulgii(o 16023 Swingley Ridge Rd 001,61tonformallait d4nila cKeiterrield,MO 63017 '1 Job fuss Trus5Ty11e Qty Ply SUIL171NG13 ROOF VINCYARDVIEW - - ,I 137938910 35976143. ,G02 t.'Dnllnvfl Glydi t 1 lJl Uryivwsal CoTrjpanenl:Cprp., EAST HAVEN CT 06512 8.010 s Aug 11.2017M)Teklodustrles.Inc.Thu Jul 25 23:15:02 20 19,Gage 2 ID•uH81G91AM9 WQEtKnavHVNyuWBg-JbKR3QsN4PIHLA1t96dlMJ3rZOT6chIROBuMtyuNSt NOTES. 10)Refer to girder(s)for truss to truss connections, 11)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 794 Ib uplift at joint 1 '12)Two RT5 USP connectors recommended to connect truss to bearing walls due to UPLIFT at 1t(s)13.This connection is for uplift only and does not consider lateral forces '13)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord, nonconcurrent with any other live loads. 14) Use Simpson Strong-TIO HUS26(14-1 Od Girder,4-1 o Tfusb,Shiglu Ply Oil dBl)ui eyuivdlenl spaced at 2-0-0 or.max.starting at 1-5-0 from the left end to 41 6 0 to connect truss(es)to back face of bottom chord, 15) PIII all hall Ifules wlieiH Iteugei ib Iii 1.unlact with lumber. - LOAD CASE(S) Standard 1)Dead+Snow(balanced),Lumber Increase=1.15,Plate Increase=1,15 Uniform Loads(plf) Vert 1-7=97,7-13=-97,1-13=-20 Concentrated Loads(lb) Vert:18=-803(8)16=-817(B)17=-803(8)36=-662(8)38=-662(6)39=-662(B)41=-662(6)42=-662(6)44=-811(8)45=-803(B)47=-803(B)48=-803(B)50=-803(8) 51=-803(B)53=-803(8)54=-817(B)56=-817(B)57=-817(6)59=-817(B)60=-817(8)62=-817(8) ®WARNING-venfy design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE 11111-7473 rev.10/03/2015 BEFORE USE ,D)W1gnytdld tnr u"Only wlNr Mist u^I po inucirr3 Tl a d%Ign is bapod Tlyupon pommaltilt a bavirr,and iu frr nn,IndIIhllrnl bulhAnlJ edmpnria0l,not a 1Nas6ylIm.Below use,111nbuildtnu dtWgprq mustvalgy Ultl epp)feitlb 4ryot deot(in jl�minattua�nnp propdrfy incuip aald Ihiw'datdgn 1140 Uro decal, i bald}t6d Itjn;Brat�ng,(Rdb^�rndlatAp[avapt,buckCng,n{,[td7vLlutdVuss,webanrydretgrq,mamb�nRntY lutd111opa1fOrrtpornryarKipmrman+irtlbracing �`� is tr4+rys roA arod tA1 ntoENrdy vtu!to{ event sN4rpsa Wlir rsrssldg per<onAl mlury and property damage'Fa general guidance rega dmg rhe lObi(adwn,'storege,delivery,-z-FT rection and^bracing of trusses and truss systems,see ANSIRPII Quality CfSloflnl DSB•SB and BCS,Huliding Component 16023 Svam0ley R1dge Rd 5a1alylnfonneNon avellab,e from Tntss Plate Insgtute,218 N.Lee Street,Swta 312,Aiexendda,VA 22314: Cheslertfeld,MO 63017 106 cuss -; russ:Type Qty Ply lob UILDING D ROOF VINEYARD VIEW 137938911 35970Ci3 G03 Common Girder. 1 3 Reference(optional)-.- Universal o trona/__Universal Component Cotp., -EAST HAVEN"CT-06512_ —" O.O,IO s Aug 112017 MiTek Industries,Inc.;Thtl Jul 26 23.15 04 2019 Page 1 ID uH81G9)AM9_WQEt iaaHVNyuNBg-FzSCU6tdc0Y?aUvFGXfDRk8EQgAN4eLbmg?MyuNSr 9-1"- _2:2-8--28 -6�_f 3.811 7-2-1410.9-1 8 ._—. — _A4 5.12_ : .1 •4{ 0•f0. = i 3-6.3 :38-11 f}•1Uki' 44 16 Scale=1:49,9 4 12 12,00 12 11, f , 1x4 jfJ 5 5x6 3 10�i 6 ' 14 9 15 8 16 f 4x8 // 4xB'- 414 II 4x8 = Special 2-2-8 4.1012 .7-2.14°_ _, 9-7-0 145-02-_ -Plate Offsets(X,Y�-- [210-19,0=1-9j,t3!G-0=i2.0;2.81.f6:0 5-14.0.2-01 - - -- - LOADING (psf) SPACING- 2.0-0 CSI, DEFL. in (loc) I/deft Ltd PLATES GRIP TCLL(roof) 30,0 Plate Grip DOL 1.15 TC 0.39 Vert(LL) -0.05 8-9 >999 240 MT20 197/144 Snow(PI/Pg) 38,5/50.0 Lumber DOL 1.15 BC 0.71 Vert(CT) -0.08 8-9 >999 180 TCDL 10.0 Rep Stress incr NO WB 0.72 Horz(CT) 0,01 6 n/a n1a SBCLL COL j0.0 f Code IBC2015/TPl2014 Matrix-S Weight 268 lb FT 20% BER- BRACING- - CHORD 2x4 SPF No,2 TOP CHORD Structural wood sheathing directly applied or 6-0-0 oc purlins. BOT CHORD 2x8 DF No.2 BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing, WEBS 2X4 SPF No.2 PLY-TO-PLY CONNECTION REQUIRES THAT AN APPROVED WEDGE FACE MOUNT HANGER(SPECIFIED BY OTHERS)IS REQUIRED AT Left.2x4 SP No.3 JOINT 9 FOR LOAD REPORTED IN NOTES,FACE MOUNT HANGER SHALL BE ATTACHED WITH A MINIMUM OF 025"x 4.5"SCREWS OR OTHER FASTENERS THAT PENETRATES ALL PLIES,PER HANGER REACTIONS. (Ib/size) 2=9860/0-5-8,6=239610-5-8 MANUFACTURER SPECIFICATIONS. Max Horz 2=182(LC 9) Max Uplift 2=-761(LC 10),6=182(1_C 10) FORCES. (lb)-Max.Comp JMax.Ten,-All forces 250(lb)or less except when shown- TOP CHORD 2-3=-11203/828,3-4=-2782/249,4-5=-2721/266,5-6=-2963/230 BOT CHORD 2-9=539/7227,8-9=-539/7227,6-8=-57/1891 WEBS 3-9=68418810,4-8=-270/3256,3-8=-5949/558 NOTES- 1)n/a 2)3-ply truss to be connected together with 10d(0_131'x3")nails as follows, Top chords connected as follows 2x4-1 row at 0-7-0 oc. Bottom chords connected as follows.2x8-4 rows staggered at 0-4-0 oc. Webs Connected as follows:2x4-1 row at 0-9-0 oc_ 3)All loads are considered equally applied to all plies,except if noted as front(F)or back(B)face in the LOAD CASE(S)section.Ply to ply connections have been provided to distribute only loads noted as(F)or(B),unless otherwise indicated 4)Unbalanced roof live loads have been considered forthis desigm- 5)Wind:ASCE 7-10,Vult=130mph(3-second gust)Vasd=103mph;TCDL=6Apsf,BCDL=6.Opsf,,h=25ft,B=45ft,L=24ft;eave=oft;Cat. N Il;Exp B;enclosed;MWFRS(directional);Cantilever left and right exposed;end vertical left and right exposed;Lumber DOL=1. 60 �,QF - }� plate grip DOL=1.60 6)TCLL ASCE 7-10,Pr-30.0 psf(roof live load:Lumber DOL=1,15 Plate DOL=1.15);Pg=50,0 psf(ground snow);Pf=38,5 psf(flat roof snow:Lumber DOL=1:15 Plate DOL=1.15);Category Il;Exp B;Partially Exp;Ct=1 1 * y 7)This truss has been designed for greater of min roof live load of 12,0 psf or 1.00 times flat roof load of 38,5 psf on overhangs non-concurrent with other live loads. _ 8)This truss has been designed for a 10,0 psf bottom chord live load nonconcurrent with any other live loads, 9).This,truss has been designed for a live load of 20 opsf on the bottom chord In all areas where a rectangle 3-6-0 tall by 2-0-0 wide s W will fit between the bottom chord and any other members. y 1ctat f-�+ 10)Two RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT atjt(s)2.This connection is for uplift only t� N and does not consider lateral forces. �p .0904 )ne RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT at jt(s)6 This connection is for uplift only ; '' _" Q. ind does not consider lateral forces. ��`E JS��N 'his truss has been designed for a moving concentrated load of250.0]b live located at all mid panels and at all panel points along the'Top Chord and Bottom Chord,nonconcurrent with any other live loads. July 26,2019 ®WARNING-verify design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE M11-7473 rev,1010312015 BEFORE USE s ' ,lanjpttvh><d;tgcUxo anly wdti hltTrk6 Wni4entora-?his deslgri la haw ,ohtY,pts n pimntutnhs stromic,nrka(h for nn mrfnidun{puTulnll cmm�onunll gait, n livaasyelom.Bbtorause;Ihp 6uRdiOp do:�Dner.muet,vonv 0 npp6caMlity of dr�ifln pnmrnntiws rtt U ptapt{dy(dcapet0lo Ilvs`ilr1t10ri frilo3tio Ov&Oil, hulldl�{�despti_91 4 flip�unl'eatndlsfstpmctdbOrJpnpO(fnd4)dunitrues�4ebaddlor41i rdmemttersonty,Addrliortallornpan�yand'p2rmattonttrnctnp; ��'te��' ta>Ivhtya requlm dstk'lnbdifywrd ib.Qrow gt FapapGav4lh ppss b a pernnnAf tnlurynnrf pcopattydmnODa„Fnr,Qrmerst p iidntice rnpMding lhtt latld�ilfcat,9tonpn',dbr'.'Lncc11 andb br4f3rip af,Uussesand bv>H sy�stpins,coa._ -AN8111pt1 Qunitty CdtcHo,QaB^8g and BC$1 Bnlld(ng Component 16D23 Swingley Ridge Rd -Sefapi tnfwmtrtian rivrillchlchmn This:plOte tnatltrhn.21D N;Uro'Strcu,Suim312:�114xnndrin; Chesterfield,M063D17 rJob _ Truss rusaTypa' Qty ly BUILDING D ROOF VINEYARD VIEW 137938911 35970R3 G03 Common rdor 1 3 Job Reference(optional Universal Component Corpr. EAST_HAV[N,CT 06512- 8.010 s Aug 11 2017 MITek Industries,Inc-1 hu Jul 25 2315:04 2019 Page 2 ID:uH81G2iAM9 WQEtKnavHVNyuWBg-FzSCU6ldc0Y7aUvFGXfDRkBEQgAN4eLbuig7RlyuNSr NOTES- 13)Hanger(s)or other connection device(s)shall be provided sufficient to support concentrated load(s)10401 Ib down and 814 Ib up at 2-2-8 on bottom chord.The design/selection of such connection device(s)is the responsibility of others. LOAD CASE(S) Standard 1)Dead+Snow(balanced):Lumber Increase=1.15,Plate Increase=l 15 Uniform Loads(pif) Vert.1-4=-97.4-7=-97,2-8=-20 _. Concentrated Loads(ib) Vert 9=-10401(F) WARNING-Venty design parameters and READ NOTES DN THIS AND INCLUDED MITEK REFERENCE PAGE 8111-7473 rev 1010312015 BEFORE USE. ; ace 'DesiOn%41jd for du6ohly lv,0,t`MITpRO tahnoctara.Thin designle wscd only upon por4mtllutr.ibnwn,end In for arI 1pdrviduol budding P0114 ��fff n4 not Sall ' atruss syetomi Belem use,the b0dMp doiliocr most verify tlltr aF Crat:lfly or dint"ptriarnutUra 0ntt Utoit ly letxupt>:aln UA daslgu Nit-Ole uVokll buildlrg doslgn.Bracmn lt>d3eotcd fs to pravdU budding or rnd(vlduat truss vMb ands chord rnombm pnh•.Adddlc ni lamrmrnry rind permnnant p acOg M)Tek, i,slhvnYEtuquaudfrr(Alowlynnflo(tavern a4lipiniNilhptr31dhnrirrfimiDlh,•ulyStilt]nrpnnyr tmlap0,Foe tjrNimlpuidanrofogINChI Ain rntxtrdtiknt= A(e d^_74t�y,ar4sti�+„ >1 et n3"gitrli nu ndp Unna atislemi sc0" iWSIffl?h r3unflly Ct term;DSB-a9 bild BC51 Aui1dinp Component 1 16023 Swinglay Ridge Rd Saroty inrormntion-nvulinbto fromTruss f?inlo InA111Utd,216 N.tee Sheet Sugg 311,A1.2,rddn;VAY1314. _ - _ - "- _ - _ Chesterfield,NO 63017 Job Truss "" Truss Type QtyPly BUILDING D ROOF VINEYARD VIEW 137938912 3597OR3 G04 COMMON GIRDER 1 3. A9b ReferenceJanbonal_ . Universal Component Corp,. EAST HAVEN,CT06512 8.010 s Aug 112017 MfTek Industries,Inc.Thu:lfN 25 23:15:09 2019 Pagel l0:uW6fGf 2I 1 6V4t�1K31-8-0 yuWOfl of GSXpxmQ7 H(1FoD?.3FOfins,Ffmf5.4 Pfm6f yu{fSm 87 9=2-6. 13-8�-- 182.3 22-8-2_ 27-2d 31-8-0 38-1L`la 40.7-13' 45.4 1 4-8-7 4-5-15 a-5;td, 4.5.75 4-5-15 4-5-15 4-5-115 4-5.15^ 4.5-15 4=8 7 Scale=1.79,8 3.75 F12- 6x8 II 2B 7 29 5x6 5x6 5x6 4x6 27 :'�-�'' � `z 30 4x6 zz 5 �+" 9 bx6 4x4 G 4 ',_..�"'��- _ 10 4x4 3 � 11 4x4 5 Z6 ,�,,. �-�' _ /f14'^•,- 31 4x4 HUS26 25 - 2 - - ;! I _ ~" 12 32 13 - - , 33 34 35 36 37 38 39 21 40 41 42 43 44 45 46 47 17 46 49 -_ 50 51 52 53 54 55 24 23 22 20 19 18 16 15 14 5x12 MT18H = 2x4 II HUS26 4x4 =HUS26 700 MT18H = HUS26 8x8 = HUS26 5x6 =HUS26 4x6 = 4x4 = 2x4 II 7x10 MIT18H = HUS26 HUS26 HUS26 4x6 = 5x6 = HUS26 HUS26 7x10 MT18H = HUS26 HUS26 HUS26 HUS26 HUS26 HUS26 HUS26 HUS26 HUS26 HUS26 HUS26 a-ea , 9-2-6 1 3'&4 1e=2-3 22-8-2_ -2772-1 1 eo _3s-1-t4 __ _4o=r13 . 4644 1 4 8 7 45.15 (d-5-1b �_ _4-rr1-5�+ -t'-5-=5 .4-5-15 -- - --- 4-w f5 .1.5-15 11.8.7 1 ,Plato Offsets j; , ,(i:0.5-64;2-81 — - --- --- - -- - —_ LOADING (psf) SPACING- 2-0-0 CSI. DEFL. in (loc) Ifdefi Ud PLATES GRIP TCLL(roof) 30 0 Plate Grip DOL 1 15 TC 0.93 Vert(LL) -0.69 20-22 >783 240 MT20 197/144 Snow(PAPg) 38.5/50 0 0.0 Lumber DOL 1 15 BC 0.88 Vert(CT) -103 20-22 >525 180 MT18H 197/144 BCDLL 10,0 Rep Stress Incr NO WB 0,87 Horz(CT) 0,31 13 n/a n/a 'BCGL 10A Code IBC2015ITP12014 Matrix-5 Weight 777 Ib FT=20% BER- BRACING- - -- - - CHORD 2x6 SPF 2100F 1 BE*Except* TOP CHORD Structural wood sheathing directly applied or 3-2-15 oc puffin 1-4:2x6 DF No.2 BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing. BOT CHORD 2x6 SPF 2100F 1.8E WEBS 2x4 SPF Not REACTIONS. (Ib/size) 1=11579/0-5-8,13=1144310-5-8 Max Horz 1=-76(LC 73) Max Uplift 1=885(1_C 12),13=-882(LC 12) FORCES. (lb)-Max.Comp./Max.Ten.-All forces 250(tb)or less except when shown, TOP CHORD 1-2=-29717/2338,2-3=-28955/2401,3-5=-26045/2293,5-6=22630/2111, 6-7=-1 91 5 511 8 56,7-8=-1915511856,8-9=-2 262 7121 1 1,9-1 1=-261 0912 2 97, 11-12=-29113/2416,12-13=-29793/2353 BOT CHORD 1-24=-2162127797,23-24=2162/27797,22-23=-2220/27637,20-22=-2073/24809, 19-20=1859/21540,18-19=-1859/21537,16-18=-2077/24871.15-16=-2236/27788, 14-15=-2175/27861,13-14=-2175/27861 WEBS 7-19=-1004/10683,B-19=-56591461,8-18=-38115079,9-18=-47821307,9-16=-191/3865, 11-16=-35211192,11-15=-56/2241.12-15=-310/108,12-14=-36/1544,6-19=5665/461, 6-20=-382/5083,5-20=-4690/301,5-22=-1 8713 786,3-22=-3414/178,3-23=-4512164, 2-23=-342/48,2-24=-36/1562 NOTES- 1)3-ply truss,to be connected together with 10d(0.131"x3")nails as follows: Top chords connected as follows,2x6-2 rows staggered at 0-4-0 oc. Bottom chords connected as follows 2x6-2 rows staggered at 0-5-0 oc �f bF-NEI � - Webs connected as follows.2x4-1 row at 0-9-0 oc. Cr �V 2)All loads are considered equally applied to all plies,except If noted as front(F)or back(B)face in the LOAD CASE(S)section.Ply to � ��{!) ©y Q ply connections have been provided to distribute only loads noted as(F)or(B),unless otherwise indicated CDe' tis 3)Unbalanced roof live loads have been considered for this design. 4)Wind ASCE 7-10;Vult=130mph(3-second,gust)Vasd=103mph,TCDL=6.0psf;BCDL=6.Opsf;h=25ft;B=4511,L=24ft;eave=6ft;Cat. 11;Exp B;enclosed;MWFRS(directional);cantilever left and right exposed,end vertical left and right exposed,Lumber DOL=1.60 - plate grip DOL=1 60FM ry 1 5)TCLL•ASCE 7-10;Pr=30 0 psf(roof live load-Lumber DOL=1,15 Plate DOL=1.15);P9=50.0 psf(ground snow);Pf=38 5 psf(=tat y4 W roof snow.Lumber DOL=1.15 Plate DOL=1 15),Category II;Exp 8;Partially Exp.;Ct=1 1 _ 6)Unbalanced snow loads have been considered for this design 7)All plates are MT20 plates unless otherwise indicated. $94,its truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads, rhes truss has been designed for a live load of 20 Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide II fit between the bottom chord and any other members, 10)Two RT5 USP connectors recommended to connect truss to bearing walls due to UPLIFT at jt(s)1 and 13,This connection is for July 26,2019 ntrMAn nni in - I ®WARNING-Venry design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE Mll-747a rev 10/03/2015 BEFORE USE o auslqn atdfaruseunly,wtthMiTeAtlallno,'o-rslitbdeglgnis'baacdrlyuponp?mrnstnmShown;andlyforinMr6vduattfi111dn8com(nHienl'not a buss syt1cm Befornusn,the bufdinit U�ygturti+ual`96d1y the nppllcdyidy of desrfln p alt stc`ro and prupo by In zr pdrotn this dcatpn into th a overall iii fa btiddfrigilmign Bradnglndiratedistopfw ijht0lfngoffndividunfburswebandlord'Wdntd!Tits¢fttOn(y.AddlllonpltomporarymdPormmtantbraang Is always required for stability and to prevent collapse with possible personal injury and property damage For general guidance regarding the fbb6tation;ulnrnlis,durNory,`ereciian and bracing of trusses and truss systems,see ANSI/TPII Quality Criteria,OSB-89 and SCSI Building Component 16023 Svangley Ridge Rd 1 ;Safely Info;rmnllon-°Fvallppie from Truss Plate Institute,216 N Lee Street,Suite 312,Alexandria,VA 22314 ) Chesterfield,NO 63017 Job" Truss Truss Type Qty Ply El DING D ROOF VINEYARD'VIEW 137938912 35970R3 G04 COMMON GIRDER •I21niVgitSsl ComporlenlCorp., EAST HAVEN CT 06512 8.010 s'Aug 1112017 tu11TekIndustries,Inc Thu Jul 25'23,15:09 2019`Page 2- ID:uH8lG9iAM9 WQEtKnavHVNyuWSg-cxG5XpxmQZBHhFoD34FO8nszkrrnlsBK2_Nm6zyuNSm NOTES. 11)This truss has been designed for a moving concentrated load of 250 01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord, nonconcurrent with any other live loads. 12)Use Simpson Strong-Tie HUS26(14-10d Girder,4-10d Truss,Single Ply Girder)or equivalent spaced at 2-0-0 oc max.starting at 1-5-0 from the left end to 43-5-0 to connect truss(es)to front face of bottom chord 13)Fill all nail holes where hanger is In contact with lumber- LOAD CASE(S) Standard 1)Dead+Sutity(balaii%e�)."Lumber Increase=1.16,Plate Incfeasa�T 15 - Uniform Loads(plf) Vert:i-7=-97,7-13=-97,1-13=-20 Concentrated Loads(lb) Vert 18=-803(F)16=-817(F)22=-803(F)23=-803(F)17=-803(F)33=-B01(F)35=-803(F)36=-803(F)38=-803(F)39=-803(F)40=-803(F)41=-803(F)42=-803(F) 44=-803(F)45=-803(F)47=-803(F)48=-817(F)50=817(F)51=-817(F)53=-817(F)54=-817(F)56=-817(F) ®WARNING-vedfy design parameters and REAP NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE Mll-7473 rev,10/03/2010 BEFORE USE. Design yglid for use only vilih mue"uinpec iota,Thi6 decipn Is,basad city upon"mmkl.:rs Ettrnnl,and bl�lcr,�n.lfidtrUU'n!bUitd{ng wtrpiuinnl,not s hudtt syalom Before tile,Ute boOfng desl{plur-rnull tallry the applle1it:ildy of d"gnµuttlimldts.utd pta{xirty lacotpe alu dila dvolgri Into 11in overall building datiRn Branng indrmt0d is to pruvgN buckliiyl of Individual toots;web andlor'dord mambnm oniii,:.ddidanal itlnipor.ity and ptrmnaant bracing ��T��( is always required for stability end to prevent collapse with possible personal injury and property damage For genetpi gUidiance regarding the ,fAbricalion,38H,a9o,dellvery,,erection and bracing of trusses and truss Systems,see ANSVTPll,Quallty Crltoria,DSle-69 and BCSI Building Component 76023 Svnngley Ridge Rd '$atnlylntominllon evadable From Truss Plate Institute,2r8 N Lee Street,Suite 312,Nexandds,W22314. Chesterfield,MO 63017 Job Truss russ Type city PlyBUILDING D ROOF VINEYARD VIEW_ 137938913 597OR3 Vol Jack-Closed 1 1 _Job Reference o ttoral _ Universal Component Corp„ EAST-HAVEN CT06512 8.010 s Aug 11 2017 Mtrek Industries,Itim-Thu 30125 23 15.10 2019 Page 1 ID•uHBIG91AM9_WQEIHnavHVNyuWBg-47pTk9yOBsJBIPMPdnmdh70HbFNSU W4TGe7JePyuNSI - - _16-15 --' --- ----- - --- 1.5.10 1-6-_15 '1-s=t0 - - Scale=1 10,5 2x4 11 4 1 3 ._ _.-_.__........ ... ... _. .� _�. _ ..-,.<_....-....,- 6.66 12 ` 2 — 1 _ 7C" 6 3x6 it —fl 1x4 115 --a,5iy__. 1-5-1_ _ I Plate Offsets{h'Y)- 17:0-3-13,04-81 - LOADING (psf) SPACING- 2-0-0 CSI. DEFL. In (loc) Well L/d PLATES GRIP TCLL(roof) 30.0 Snow(Pt1Pg) 36.5150,0 Plate Grip DOL 1.15 TC 0.29 Vert(LL) -0.00 6-7 >999 240 MT20 1971144 TCDL 10.0 Lumber DOL 1.15 BC 0.09 Vert(CT) -0.00 6-7 >999 180 BCLL 0,0 Rep Stress Incr YES WB 0.00 Horz(CT) -0.00 5 n1a n/a % BCDL 1p:0 - Code IBC20151TP12014 Matrix-S WeighL7lb FT=20 BER- - - BRACING- - - �—-- -- --- - -- _- CHORD 20 SPF No2 TOP CHORD Structural wood sheathing directly applied or 1-5-10 cc purtins, tsu i CHORD 2x4 SPF No,2 except end verticals, WEBS 2x4 SPF No,2*Except* BOT CHORD Rigid ceiling directly applied or 6-0-0 cc bracing 3-6'2x3 SPF No,2 REACTIONS. (Ib/size) 7=35410-8-13,5=-321Mechanical Max Horz 7=59(LC 15) Max Uplift 7=-93(LC 16),5=-84(LC 20) Max Grav 7=356(LC 21),5=212(LC 34) FORCES. (lb)-Max,Comp/Max Ten.-All forces 250(lb)or less except when shown. TOP CHORD 2-7=-315/161 NOTES- 1)Wind,ASCE 7-10;Vult=130mph(3-second gust)Vasd=103mph;TCDL=6,Opsf;BCDL=6.Opsf,h=25ft;B=45ft;L=24ft;e8ve=411;Cat. Il;Exp B,enclosed;MWFRS(directional)and C-C Comer(3)zone;cantilever left and right exposed;end vertical left and right exposed;C-C for members and forces&MWFRS for reactions shown,Lumber DOL=1.60 plate grip DOL=1.60 2)TCLL.ASCE 7-10;Pr=30.0 psf(roof live load,Lumber DOL=1.15 Plate DOL=1:15);Pg=50.0 psf(ground snow);Pf=38 5 psf(flat roof snow-Lumber DOL=1,15 Plate DOL=1.15);Category Il;Exp B;Partially Exp.;Ct=1A 3)Unbalanced snow loads have been considered for this design. 4)This truss has been designed for greater of min roof live load of 12,0 psf or 1.00 times flat roof load of 38.5 psf on overhangs non-concurrent with other live loads. 5)This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads 6)*This truss has been designed for a live load of 20 Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide will fit between the bottom chord and any other members.- O� NEW 7)Refer to girder(s)for truss to truss connections. 8)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 93 Ib uplift at joint 7: 9)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT at It(s)5,This connection is for uplift only4Q` and does not consider lateral forces. 10)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along * _ the Top Chord and Bottom Chord,nonconcurrent with any other live loads, r I U eC .Ui July 26,2019 ®WARNING-Verity design parameters^and READ NOTES ON THIS AND INCLUDED MtTEX REFERENCE PAGE 11111.7473 rev.10/03/2015 BEFORE USE. OGi6n valid fw wo onty,vhdi hTTog6latsortcolpr4 Tr`13&51911 Id baaefl Orly upon linrarnatr'ra ohown and Ir.for rm ladt ddwd 1 Pdtnpiornpmlcjft,not a buss syvenl.borito usa,thu Iialydip j ircJgnm tnmi-vonly lbw applivdbifq or dedign I aramotnro old prnpody IdcorpWata flib'du5rhrtlhto Ota riverall bu0dln',4'das%r1.Bradinglndkfiladfr.gopm�wntbtrek(icgaftplt�duatrfusdl�ebandrorctwtdmomhmnpgty.Addllfpnnttomfwrsryrmdparmarrcnlbaung 1 �iTe - is alwt A required trd tlalilbty mid Co;(�+e'eantM14r1tev wi{It"{tiesttrin'parsor�l injury and property damage For general guidance regarding the 1 61incabon,storage,delivery,erectton and bracing or 1russas and truss systems,see ANSUrPI1 quality Ciflgda,DSB-89 and SCSI Building Component 16028 Swingley Ridge Rd Safety Information available from Truss Plate Institute,218 N Lee Street,Suite 312,Alexandria,VA 22314. Chesterfleld,NO 63017 ,I Job Truss - Truss Type "- Qly Ply BUILDINGD ROOF VINEYARD VIEW 137938914 3597OR3 M01 Monopitch Supported Gable fG 1 Job Reference fo tional - Urilyersai Component Corp., - EAST HAVEN`CT OSS12_ -- B010 s Aug 11 2017 MIT, Industries,Inc.lTliu Jul 25 23:15`71 2019 Pagel ID uHBIG91AM9_WQEtKnavHVNyuWB9-YKNryVyCyAR7wYxbAVHsDCxPitfDDxJdVlstBryuNSk 5.-12 5 5-6-12 1 Scale= _ 3x6 11 10 31Ta�t 4 1 3.00 12 0 l.c-. :�-. - - -•;;C,xT4�'z-''r'; "� •-'•, _`z; i,':>.`i; �,��.n.;•^..N.'�„'";°;`'°"kv�a','•'.••"—v�''.:'`a'✓..`fa`.' at .�-,.ol, •y°;�:< � ..rj�;�,�a'=(, x;{;�';�:= �r��. y'�^. 4�'"a;°', c �".'..`'?... �,� ,.r..r \'n+"..."+�.S.+.x." x..�`-.1..'�J�r '. >s.z.vb i a' u.....vu.-;..d'w"...•^'``�•°• .c v.�b �.«'ia4'=.-J: .,A.w ,S-�P-.w.=5.4...'.11-31�-.`..i.�.di+:`. '�3."�'.- 11 6 12 5 40 4 3x6 II 1x4 II 58.12 -- LOADING (psf) SPACING- 2-0-0 CSI. DEFL. in (lac) Vdefi Ud PLATES GRIP TCLL(roof) 30,0 Plate Grip DOL 1 15 TC 0.45 Vert(LL) 0.00 3 n/r 120 MT20 197/144 Snow(Pf/Pg) 38.5/50 0 Lumber DOL 1 15 BC 0.37 Vert(CT) 0.00 3 n/r 120 TCDL 10.0 Rep Stress Incr YES WB 0,13 Horz(CT) 0,00 5 n/a n/a BCLL 0.0 Code IBC20151TPI2014 Matrix-SWeight:15 lb FT 20% B06L 1010 __ - — --- — LUMBER- BRACING- TOP CHORD 2x4 SPF No 2 TOP CHORD Structural wood sheathing directly applied or 5-6-12 cc purlins, BOT CHORD 2x4 SPF No.2 except end verticals. WEBS 2x3 SPF No.2 BOT CHORD Rigid ceiling directly applied or 10-0-0 cc bracing. OTHERS 2x3 SPF Not REACTIONS. (ib/size) 1=221/5-2-4,5=-35115-2-4,6=792/5-2-4 Max Harz 1=56(LC 13) Max Uplift 1=9(LC 12),5=-416(LC 37),6=-66(LC 12) Max Grav 1=325(LC 35),5=124(LC 40),6=851(LC 21) FORCES. (lb)-Max Camp/Max.Ten.-All forces 250(lb)or less except when shown. TOP CHORD 3-5=-2401332 WEBS 2-6=-711/454 NOTES- 1)Wind ASCE 7-10;Vult=130mph(3-second gust)Vasd=103mph;TCDL=6Apsf;BCDL=6,Opsf,h=25ft;B=45ft,L=24ft;eave=2ft;Cat. II;Exp B,enclosed;MWFRS(directional)and C-C Comer(3)0-0-0 to 3-0-0,Exterior(2)3-0-0 to 5-8-4 zone;Cantilever left and right exposed;end vertical left and right exposed;C-C for members and forces&MWFRS for reactions shown;Lumber DOL=1,60 plate grip DOL=1.60 2)Truss designed for wind loads in the plane of the truss only, For studs exposed to wind(normal to the face),see Standard Industry Gable End Details as applicable,or consult qualified building designer as per ANSI/TPI 1. 3)TCLL-ASCE 7-10,Pr=30.0 psf(roof live load'Lumber DOL=1.15 Plate DOL=1,15);Pg=50.0 psf(ground snow);Pf=38.5 lost(fiat roof snow:Lumber DOL=1.15 Plate DOL=1.15);Category 11;Exp B;Partially Exp.;Ct=1 1 4)Unbalanced snow loads have been considered for this design; 5)Gable studs spaced at 2-0-0 oc. 6)This truss has been designed for a 10-0 psf bottom chord live load nonconcurrent with any other live loads 7).This truss has been designed for a live load Of 20.Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide will fit between the bottom chord and any other members. 8)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 9 Ib uplift at joint 1,416 lb uplift at joint 5 and 66 Ib uplift at joint 6 9)Non Standard bearing condition, Review required. ' 10)This truss has been designed for a.moving concentrated load of 250-01b live located at all mid panels and at all panel points along AJ the Top Chord and Bottom Chord,nonconcurrent with any other live loads, w r h 0.099A July 26,2019 ®WARNING-V,rtry design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE Mll-7473 rev.10/07/2015 BEFORE USE prSfOry vnpd for utn anly.Nrh 1 UTa}ra aavlm toza-rift design Ih bisen tmiy ophn pommotan;viawn,ands s rot an inoivfdoni pwomog eam0ononl,not a teusq tystnm,Bofore uya.{ha t udM1 t 01no dnaipnormnmv6tityfltn applirablilly of dlu,l5n OrrniulO sah0[nigi�ty Intagxxnte ihl5 d05ipii t eta uin w4nn Bttllt!!np l�slprt. nater['topiavenl bubo o/rndlvidu0l tiir l v eL nndlorchard mdmbars arlp.Addilioncl tatr aumry and pormannni brac pfl I �'��(- Isal`vayarorysiitndtofa U'ltynnd,toprovanlcotlgp&ovifltpa�nWap¢ra?nat6vurynnuproporlyydsmu8e.Fur t}ennaipu[dnn�etignnrnpthe, f1-6tii;nllem,,aUYeaac.ddflgarryy t:te'oriand,bradrty M twmi'end trust SyMemor 1100 'A�QSlrIPi,Quality Gilrorin.'DSB-93.and RC`il Building Component t 160235vnngley Ridge Rd Chesler0eld,M0630,7 SifetyMlarmetion ovalialeje*xr1o 'russtyarinatnte,218f1.Lenb{re4L5ui1nSty,Ntnnndtinr4A=4r Job Truss russ Type Qty Ply BUILDING D ROOF VINEYARD'VIEW ` 137938915 ' 35970R3 M02 MonopItch 25 1 Jot/Refere^_nce.(Gptional. Universal Component Corp„ EAST HAVEN CT 06St2 8,010 s Aug 11 2017 Mrrek Industries;fpc. T1fu J0125,2305.12 2019 Page 1 ID uH81G91AM9_WQEtKnavHVNyuWBg-OWxD9rzrjUZsYIWokCo5mQUV12w1yQZmkycQjlyuNSj Scale=1 12,6 2 3 Ix.- t MO 12 t - ll 46 I I 8 4 4x4 1x4 II r 64 - �Qw1=8--(-� 5-2-4 - ) Plate Offsets KY).- 01:4.0-7 j11�-12,1�4_-- - - -- --- -- -- - - - --- — -- LOADING (psf) SPACING- 2-0-0 C51, DEFL. in (too) I/deft L/d PLATES GRIP TCLL(roof) 30.0 Plate Grip DOL 1 15 TC 0.80 Vert(LL) -018 1-4 >360 240 MT20 197/144 Snow(Pf1Pg) 38.5/50.0 Lumber DOL 1 15 BC 0.66 Vert(CT) -0.22 1-4 >285 180 TCDL 10.0 Rep Stress Incr YES WB 0.00 Horz(CT) 0,00 4 n/a n/a BCLL 0,0 Code IBC2015/TPi2014 Matrix-S Weight:15 lb FT 20% BCDL-- BER. BRACING-- - CHORD 2x4 SPF No,2 TOP CHORD Structural wood sheathing directly applied or 5-6-12 oc puffins, tsu I CHORD 2x4 SPF Not except end verticals. WEBS 2x3 SPF No.2 BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing, WEDGE Left-2x4 SPF No 2 REACTIONS. (Ib/size) 4=331/Mechanical,1=308/0-4-8 Max Horz 1=56(LC 13) Max Uplift 4=27(LC 12),1=-17(LC 12) Max Grav 4=361(LC 21),1=355(LC 34) FORCES. (lb)-Max,Comp./Max,Ten.-All forces 250(lb)or less except when shown. TOP CHORD 24=308/132 NOTES- 1)Wind:ASCE 7-10;Vult=130mph(3-second gust)Vasd=103mph;TCDL=6 Opsf;BCDL=6.Opsf;h=25ft,B=45ft,L=24ft,eave=4ft;Cat 11;Exp B;enclosed;MWFRS(directional)and C-C Exterior(2)0-24 to 3-2-4,Interior(1)3-2-4 to 5-8-4 zone;cantilever left and right exposed;end vertical left and right exposed,C-C for members and forces&MWFRS for reactions shown,Lumber DOL=1;60 plate grip DOL=1.60 2)TCLL-ASCE 7-10;Pr=30 0 psf(roof live load-Lumber DOL=1 15 Plate DOL=1 15);Pg=50 0 psf(ground snow),Pf=38 5 psf(flat roof snow:Lumber DOL=1 15 Plate DOL=1,15),Category II;Exp B;Partially Exp;Ct=1.1 3)Unbalanced snow loads have been considered for this design.., 4)This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads. 5)'This truss has been designed for a live load of 20,0psf on the bottom chord In all areas where a rectangle 3-6-0 tall by 2-0-0 wide mrill fit between the bottom chord and any other members, NS 6)Referto girder(s)for truss to truss connections. � • i 7)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 27 Ib uplift at joint 4, +� 8)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT at jt(s)1.This connection is for uplift only and does not consider lateral forces, 9)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads, , ,'1 a W t Z fi �0 July 26,2019 ®WARNING-Verify design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE MII-7473 tev.-10/03/2015 BEFORE USE I Design valid for use only with MITek®connectorsrThis design Is based only upon parameters shown;and is for an individual budding component,not ? a truss system,Before use,the budding designer,must verify the applicability of design parameters and properly Incorporate this design Into the overall budding design Bracing Indica led is to prevent buckling of individual truss web andlor chord members only.Additon at temporary and permanent burring ,'lTO�C is always required for stability and to prevent collapse with possible personal injury and property damage.For general guidance regarding the M+ fabrication,storage,delivery,erection and bracing of trusses and truss systems,see ANSIrrPI7 Quality Criteria,DSB-89 and SCSI Building Component 16023 Swingley Ridge Rd Safety Information available from Truss Plate Institute,218 N.Lee Street,Suite 312,Alexandria,VA 22314- Chesterfield,MO 63017 Job _ PIS1)• russType �" • QtyD'-(3C3pF VINEYARD VIEW137938916 35970R3 ;Common 14 . ---- ,AJr lvWml Component Corp., EAST HAVEN_CT06512 = - 9,010"st5utj 112017 Mi)eKdndustnes,Inc_Thu Jul 25 23'1514 2019 Ptlt;e t ID:uHBI G91AM9_WQEtKnavHVNyu W Bg-yu3_aX7vF5panOgAsdgZrrZorsbtQ5Q3BF5XnAyuNSh 0(11}¢3 7.13TMg 1 - t3 iO 4 1 20-e-j- R-52'0 I- 7-5-94 7-8-6 35-7-14 oisi� t0 42-10• 7-p•$ 6-0=14 $+8-1 r _ - Scale=.-. 3,75 12 fixfi 26 6 6x12 s i+CR4' '^^ 2728 4x4 25 3x10 29 24 4x4 z.3.-,-'"e" ;f' -"'-�.._30 4x4 6x8 MT18H 4 3 "sr r t r - 9 = 3x8 r,¢ - -_}.-� _ 10 3x0 21 12 20 32 i9 33 18 17 34 16 35 1514 36 19 37 602 = 5x8 MT18H 11 8x8 = 5x8 MT18H = 48 = 4x4 = 2x4 11 4x4 = 5x12 MT18H = 7.0.6 28-2-0 357-1 F f3 4�f { t-- 7-0-6 6-9-1 i 6-9-1q Plate-,0fM_!ijX,..vy= a(�:n+3-110:2.11 �s:�a.;fj-s-fl3J��:� -n res •tis:o s s.�f�e� - _ ---- LOADING (psf) SPACING- 2-0-0 CSI. DEFL. In (loc) I/def/ L/d PLATES GRIP TCLL(roof) 30.0 Plate Grip DOL 1.15 TC 0.97 Vert(LL) -050 13-14 >999 240 MT20 197/144 Snow(Pf/Pg) 38.5/50.0 Lumber DOL 1 15 BC 0.70 Vert(CT) -078 13-14 >666 180 MT1 BH 197/144 TCDL 10.0 Rep Stress Iner YES WB 1.00 Horz(CT) 0,25 11 n/a n/a BCLL 0,0 - Code IBC2015t7PI2014 Matrix-S Weight 195 lb FT=20% _BGDL 10.0 LUMBER- -= -- _ -- - BRACING- TOP CHORD 2x4 SP 270OF 2.2E"Except' TOP CHORD Structural wood sheathing directly applied, except end verticals. 5-6:2x4 SPF 2100F 1 BE BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing BOT CHORD 2x4 SPF 210OF 1 BE WEBS 1 Row at midpt 4-16.7-16 WEBS 2x4 SPF No.2'Excepe 2-19 2x4 SPF 2100F 1.8E SLIDER Right 2X6 SPF No.2 3-11-14 REACTIONS. (Ib/size) 20=2627/0-5-8,11=2612/0-5-8 Max Horz 20=-100(LC 14) Max Uplift 20=-137(LC 16),11=-132(LC 16) FORCES. (lb)-Max,Comp./Max:Ten.-All forces 250(lb)or less except when shown. TOP CHORD 2-3=50521343,3-4=-4864/377,4-6=-3988/363,6-7=-40031363,7-9=-5348/402, 9-11=-6327/416,2-20=-25471273 BOT CHORD 19-20=-41/447,18-19=25514724,16-18=-22714553,14-16=-252/5018,13-14=-329/5868, 11-13=-32915868 WEBS 3-19-5061124.3-18=-324/108,4-18=0/379,4-16-1425/115,6-16=-59/1696, 7-16=-18841147,7-14=0!495,9-14=-905/87,9-13=0/394,2-19=-227/4323 NOTES- 1)Unbalanced roof live loads have been considered for this design. 2)Wind:ASCE 7-10;Vult=130mph(3-second gust)Vasd=103mph;TCDL=6,Opsf;BCDL=6,opsf;h=25ft;B=45ft;L=24ft;eave=5ft;Cat- 11;Exp B;enclosed,MWFRS(directional)and C-C Exterior(2)-0-10-8 to 2-1-8,Intenor(1)2-1-8 to 20-8-2,Exterior(2)20-8-2 to 23-8-2 zone;cantilever left and right exposed,end vertical left and right exposed;C-C for members and forces&MWFRS for reactions shown;Lumber DOL=1.60 plate gnp DOL=1 60 GG 01 �E 3)TCLL.ASCF 7-10;Pr=30,0 psf(roof live load:Lumber DOL=1.15 Plate DOL=1,15);Pg=50.0 psf(ground snow);Pf=38.5 psi(flat roof snow'Lumber DOL=1.15 Plate DOL=1.15);Category Il;Exp B,Partially Exp.;Ct=1.1 4)Unbalanced snow loads have been considered for this design, 5)This truss has been designed for greater of min roof live load of 12,0 psf or 1,00 times flat roof load of 38,5 psf on overhangs non-concurrent with other live loads. 6)All plates are MT20 plates unless otherwise indicated. 7)This truss has been designed for a 10,0 psf bottom chord live load nonconcurrent with any other live loads. 8)"This truss has been designed for a live load of 20.Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide will fit between the bottom chord and any other members- 9)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT atjt(s)20 and 11.This connection is for ¢-Dg �63�+ Uplift only and does not consider lateral forces 10)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along ��'aFessiIi the Top Chord and Bottom Chord,nonconcurrent with any other live loads. July 26,2019 XW ®WARNING-Verhy design parameters and READ NOTES ON THIS AND iNCLUDED MITEK REFERENCE PAGE M11.7473 rev 1010312015 BEFORE USE, t)*J n vrim for use gpiyylith WOO Tih�drinlyn is hoed only uponparanm3orapt>sWaLap ta¢_1pr a(IJIUMAduoi blAffirip cmilpenHOl;flat ? ,a filt8a systtmr.Befom,wo the buIItl4jtl'dusxJ'egr nlUhl Vadty the oppfcobilily of,drrtiflh po[trieler3+tlyd luonillty frrmpt~re1s1 thln duvon Into bib oveiall- Wittin0''t-.-fin Brae`rhol4dicaled4914Pn;vd6tbuC�n9of!iadrviddaltruss web 4ndtordrpiTek, is always required for stability and to pievenl collapse with possible'personal injury podptgporty damrgo,h'o+`pr7rifd€.i tatli�re?;1t7t41Cr1F 1110 fabncall n,nlnte/jv.delivery,erecbon and tracing of trusses and truss systems,sqa Ansrrfpll Qu juty Criiatin,osS.ssatid eCSI Hitliding Component 16023 Swingley Ridge Rd safety Information available from Truss Plate Institute,218 N Lee Street,Suite 312,Alexandria,VA 22314, Chesterfield,MO 63017 Job Truss rui"m Ype Qty 1ply BUILUINIG Dr�ROOR VINEYARD VIEW--------' '` — 137938917, 35970R3 T011GE — CoriHgola Supported Gable _ —6 — 1 Jab Reference D Uarza>)'- - _ Ilnfy-P#salCGi11091je ilCorp,, EAST HAVEN CT 06512 8.0'!R•s Aug`1120'171t9CTefklndustrles,Inc:Thu Jul 25 23.15.16-20,19 Page-1 ID uH81G9iAM9 WQEtKni vHVNyuWBg=vHBk?CO9n1310KgZz2t2wGeLGgQGuB4MfZaes3yuNSf --7-2-14, — .( 14'-5-12- 541 , 1 — 721 ---7=214- =__ _ =-t11C1.8. 4x4 = Scale 114°=1' 6 5 p ' 7 12.00 12 '. 21 4 20 25 .,f` s;. 9 19 3 l f }° - 26 Q 2 - 4S k, ti? 10 io 27 18� 26 17 29 16 30 -"15 31 14 32 13 33 12 34 3x8II' 3x8 I, Plate Offsets(X,-,]--- ,1_2:Edrie.04: ),Lj :fidge.0.0-74 LOADING (psf) SPACING- 2-0-0 ; CSI. DEFL. in (loc) I/deft Ltd PLATES GRIP TCLL(roof) 30,0 Plate Grip DOL 1115 TC 0,15 Vert(LL) 0.00 10 n/r 120 MT20 1971144 Snow(Pf/Pg) 38 5/50 0 Lumber DOL 1.15 BC 0.13 Vert(CT) -000 10 n/r 120 TCDL 10.0 Rep Stress Incr YES WB 022 Horz(CT) 0.00 10 n1a n1a �BBCLL OA ' Code IBC20151TPI2014 Matrix-S Weight:66 lb FT=20% BDL w10.0 - _ - - -- • - �- __ - -_ - - - - BER- BRACING- CHORD 2x4 SPF No.2 TOP CHORD Structural wood sheathing directly applied or 6-0-0 oc purlins. 130T CHORD 2x4 SPF No 2 BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing. OTHERS 2x3 SPF No.2 WEDGE Left 2x4 SPF No.2,Right.2X4 SPF Not REACTIONS. All bearings 14-5-12. (lb)- Max Horz 2=-182(LC 12) Max Uplift All uplift 100 Ib or less at joints)2,10,16,17,18,14,13,12 Max Grav All reactions 250 Ib or less at loint(s)except 2=301(LC 40),10=301(LC 48),15=311(LC 60),16=331(LC 59),17=333(LC 58),18=312(LC 57),14=331(LC 61),13=333(LC 62),12=312(LC 63) FORCES. (lb)-Max.Comp„/Max Ten.-All forces 250(lb)or less except when shown WEBS 5-16=-2781120,4-17---2811135,3-18=-2701134,7-14=2781120,B-13=-2611135, 9-12=-2701134 NOTES. 1)Unbalanced roof live loads have been considered for this design, 2)Wind:ASCE 7-10;Vult=130mph(3-second gust)Vasd=103mph;TCDL=6.0pA;I§dDL=fibpsf;h=26ft;9k45ft:L=:Aft;fave=2ft;Cat. 11,Exp B;enclosed,MWFRS(directional)and C-C Comer(3)-0-10-8 to 2-1�8,Exterior(.))2-1-8 to 1-244,Cemerl3);7•M4 to 10-2-14 zone;cantilever left and right exposed,end vertical left and right ekpoSed;C'•C(tlr member5_and'eOrces 3_M*RS for reactions shown;Lumber DOL=1,60 plate grip DOL=1.60 L 3)Truss designed for wind loads in the plane of the truss only.For studs exposed to wind(normal to the face),see Standard Industry Gable End Details as applicable,or consult qualified building designer as per ANSI/TPI 1. OF NES 4)TCLL ASCE 7-10,Pr--30.0 psf(roof live load:Lumber DOL=1,15 Plate DOL--1..15);Pg=50,0 psf(ground snow);Pf=38.5 psf(flat ." roof snow:Lumber DOL=1.15 Plate DOL=1.15);Category II;Exp B,Partially Exp.;Ct=1.1 5)This truss has been designed for greater of min roof live load of 12,0 psf,or 1.00 times flat roof load of 36.5 psf on overhangs non-concurrent with other live loads. 6)All plates are 1x4 MT20 unless otherwise indicated. ' 7)'Gable requires continuous bottom chord bearing. 8)Gable studs spaced at 2-0-0 oc 9)This truss has been designed for a 10.0 psf bottom chord live load non concurrent with any other live loads, m' ju 10)'Thi's truss has been designed for a live load of 20.Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall'by 2-0-0 wide will It between the bottom chord.and any other members. 11) Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift at joint(s)2,10,16,17,18, �_ •"Qg9Q33 . 14,13,12, A Phis truss has been designed for a moving concentrated load of 250,0Ib live located at all mid panels and at all panel points along .he Top'Chord and Bottom Chord,nonconcurrent with any other live loads. July 26;2019 ®WARNING-Verify design parameters end READ NOTES ON THIS AND INCLUDED MITEK REFERENCEPAGE P4I1-7473 rev,1010312015 BEFORE USE 0ovDvalid fin,seany,+ylltfb{rc4w'aonpQrgt Thi crfnP;g+rf�btiaorffrNy.IN>tlhl el+;ra`sllmv,�,aiidiir',(r"ttai¢polvfdualbulltl(tirr gig 46_ q'Tia�lsinC:neE� 4Uusz6katarr,9arar0at�rCltgbi7HdlIarl tmysiibntyt`n¢nppll�a6illty'¢[N4St*pttflklhi¢tb1§altaptdpeaty€rrc?iGoratpdtva'ifvsa9n(nsgirpeilt"V ;buiid(nOCa�lpn,6rac)ppladrtplad,lrtopfo{aplbexklin0oftraAi'ofdii�tnrr�wr)iondfo�chardrt<rgiltezuti+ify',AtldilEanslhem( adyttrrdarirrnuna_tGriigfn0 k � � ; iisiffwaycfrttgtareiif�slefiilltYugl�1?pruUcmtcWCa2?anifthi+Asl7ilap++.!'+7¢nt�ttnjGry�ani3prgp9(ipdoir-age,.F,prgunet&!'guldliaCa�'Isget�70gOk'r- - (ehaPcalbPr aCofn�rt+:tialhpry,emdlp+inntl Drar3pit of fruasgsn l,Iruos eyaC�rriO.fi4e` ASSBLrfPif Quailky Ci[tariai[(38 fig and 6f 1 Butld)gq domponent t9 18023 Sy Ridge Rd `Satdtyfiifarata4ah pv;}IlaAti7{ryFryi Tires htitta i4fsCikiita,2f8 hh Ltla S.-'Cf¢gt,'t;00a C��;Nh>rAinfd5,VA 22S'fd! f` Chesterfield,eld.M063017 Jotl Truss cuss Type — Qty Ply BUILDING D ROOF VINEYARD,VIEW 137938918 35970R3 T02 Common 2 1 ____ — ___ Job Reference,(opUtfnatl Universal Component Corp., ST;HAVEN CT 06512 8.010 s Aug 112017 MiTek Ilidualries,Int,lb!!Jul 25 23 15 17 2019 Page 1 F7e " I D:uH81G9iAM9_WQEtKnavHVNyuWBg-NTk6CY1 nY069eTPIXiifOHTTBUV3dsdfMVtDJBOVyuNSe 1— 10-14.1 _} 14,542- ,5�4.- U•IU •7-11 37' 3.7.2, 37-11 - 0.105 Scale= 4x4 4 11 12 X 12 00 12 1x4 \\ 10 13 1x4 A} 4 3 5+ \, 14 2 15 8 16 3xB I1 3x8 If 3x8 = 7-2-14 - _ 7-2-14 _ - — -- Elate Offsets(X Y) LOADING (psf) SPACING- 2-0-0 CSI. DEFL. in (loc) I/defl Lid PLATES GRIP TCLL(roof) 30.0 Plate Grip DOL 115 TC 0.31 Vert(LL) -0,24 2-8 >705 240 MT20 197/144 Snow(Ff/Pg) 38.5/50 0 Lumber DOL 1.15 BC 0,68 Vert(CT) -D 29 2-8 >572 180 TCDL 10.0 Rep Stress Incr YES WB 0.16 Horz(CT) 0.01 6 n/a n/a BCLL 0,0 Code IBC2015(rP12014 Matnx-S Weight 59 lb FT 20% LUMBER- BRACING- TOP CHORD 2x4 SPF No 2 TOP CHORD Structural wood sheathing directly applied or 5-11-9 oc purlins BOT CHORD 2x4 SPF No.2 BOT CHORD Rigid ceding directly applied or 10-0-0 oc bracing. WEBS 2x3 SPF No 2 WEDGE Left 2x6 SPF No.2,Right 2x6 SPF No.2 REACTIONS. (Ib/size) 2=927/0-5-8,6=927/0-5-8 Max Horz 2=-182(LC 12) Max Uplift 2=-69(LC 14),6=-69(LC 14) FORCES, (Ib)-Max.CompJMax Ten,-All forces 250(lb)or less except when shown; TOP CHORD 2-3=-9281114,3-4=-6961153.4-5=-6961153,5-6=-828/114 BOT CHORD 2-8=-14/557,6-8=0/537 WEBS 4-8=-111/465 NOTES- 1)Unbalanced roof live loads have been considered for this design, 2)Wind.ASCE 7-10,Vult=130mph(3-second gust)Vasd=103mph,TCDL=6-Opsf,BCDL=6,Opsf;h=25ft;B=45ft,L=24ft;eave=4ft;Cat. 11;Exp B;enclosed,MWFRS(directional)and C-C Exterior(2)-0-10-8 to 2-1-8,interior(1)2-1-8 to 7-2-14,Exterior(2)7-2-14 to 10-2-14 zone,cantilever left and right exposed;end vertical left and Tight exposed,C-C for members and forces&MWFRS for reactions shown,Lumber DOL=1 60 plate grip DOL=1,60 3)TCLL•ASCE 7-10;Pr=30,0 psf(roof live load:Lumber DOL=1.15 Plate DOL=1.15),Pg=50 0 psf(ground snow);Pf=38.5 psf(flat roof snow,Lumber DOL=1 15 Plate DOL=1.15):Category 11,Exp B;Partially Exp:Ct=1,1 4)This truss has been designed for greater of min roof live load of 12,0 psf or 1 00 times flat roof load of 38.5 psf on overhangs non-concurrent with other live loads. f Q 'N / 5)This truss has been designed for a 10 0 psf bottom chord live load nonconcurrent with any other live toads. Ti JO 0 6)"This truss has been designed for a live load of 20 Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide l�j� wili fit between the bottom chord and any other members. 7)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT at jt(s)2 and 6.1 his connection is for 4 uplift only and does not consider lateral forces„ 8)This truss has been designed for a moving concentrated load of 250.0lb live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads, �- fL �t �.09941- July 09941-July 26,2019 is WARNING-Vetrfy design parameters and READ NOTES ON THIS AND INCLUDED Ml rEK REFERENCE PAGE MII-7473 rev.1010312015 BEFORE USE ®{ Vosigav4�dtot srtoQnlY•tuttaAfTnkt?eennucur Thsdrtigttuktn sd,v A upnnPnrnmgLtntSanvnt.mnifi5lrinrrlhdtA;rYzhi(nfilifinp='mpailoollnet ) /` MiTek ""04- IfUaS Ly%lrifn: foto usp_ill.hilldlnpaf�pnrt riit6tvorily ltm np�ficojkltyuf du91 n jspramptt tt Und jnoS Orly In'sMpOratp Bf>s,dbvl}yt train Uttl ovmntl, I� ®UiGdlf}p'd9slgfu Rrscinpinedleto}ilovrntbUckl(npotinHlvldUn4•tusyssnb00474r stadinambarvnnty,_7ubl,lonaltampwaryalpfrenatnstti-Isrchiq le tsinafya a u;rdsl to styb lily dnd 10 fxdptud' lhlli �?Cef f k b o f! M i»Jprypeu!l rap�rtp dansogo.Fui'gbneml qu de�a rt��l!t rdU p the t[itr3glfpp.*Jlerglge.d4??Y4ry dP'utl9an nndhmdnq of itne'.:afl5 0nd Uds3'ryrinmu,=sea AN81(YP,lI Ctyplliy Grttprin,C789�8'J'and SGSt,$iilidlnq Component 16023 Swingley Ridge Rd Spfpty,Infcarm�oUrsn u+'ryitAbla tirmfinrss r�lnle fnht(tht^,71811,1..zt filrrsS,Suitc 312,F7awtidtin,VA2231.1, Chesterfield,M063017 Job TrtiGe . -'.Tlu&SType -- -- Oly - Ply --BUILDINGD ROOF MNEY.�RDVJEW` - 137936919 ' E 3397083 T02ts!< Common Supported Gable 1 1- --- _ - ,ufllvdisut Crt_mlldr_ient CorPA EAST HAVEN CT 06572 - i' - -8;Oi0 s Rug_i12017 MITek Indtxsttio5 (nR Thu Jul 25 23:15'25 2019 Page 1 - co 0'!Q - -- - 27.8.2' l .ft`r4'_ ='=_ a�242 0=10-0; _ 22-8-2- ^_ - - - _- - _ -- - - - 22-8-2 0.10 8 Scale=1.76.4 a 3j5 12 5x6 _. _. 14.63 =15-_64_-16„" 60 3x6 11 12 r�1 1261 >F17 I 18 qt19 3x6 59 2 0€21 58 - X , _69 l t a 68• 2-2 57 70 7 23 56 71 24 ` 72 5 25 263x6 54 73 3x6 zz 29 �E 01 __,"^"'"Y; lf �p i- i �I �i v, sa S£ y� r� 4 �. ,.�1F'.`u' 28 o f 6`�-,��...-_.:.11..-".,_�.iE.�,-�,-{r.-..a..o.t1.y_-y 75 52 76 51 7,7 50 78 49 79 48 80 47 81 46 45 44 82 43 83 42 64 41 85 40 86 39 87 38 37 36 BB 35 89 34 ;10, 33 91 32 92 31 93 30 94 4X611 4x6 II 3x6 = 3x6 = - 454.4 r -- - - - - 45-, t»s Piat++Offsets(X,Y-_a_ [L.G r.0-.1Ja'.L2k.'A:3 7.0- _ - - - - - -- LOADING (psf) SPACING- 2-0-0 CSI_, DEFL. in (loc) lldeft L/d PLATES GRIP TCLL(roof) 30.0 Plate Grip DOL 1.15 TC 0.19 Vert(LL) 000 28 n/r 120 MT20 197/144 Snow(Pf/Pg) 38.5/50.0 Lumber DOL 105 BC 0,18 Vert(CT) 0.00 28 n/r 120 TCDL 10.0 Rep Stress incr YES WB 0.35 Horz(CT) 000 28 n/a n/a BCLL 00 Code IBC2015/TP12014 Matrix-S Weight 177 Ib FT=20% BCOL; __ ----10,0-- - - - LUMBER- - - - BRACING- TOP CHORD 2x4 SPF No.2 TOP CHORD Structural wood sheathing directly applied or 6-0-0 oc purims, CHORD 2x4 SPF No 2 BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing -RS 2x3 SPF No.2 aa-IVER Left 2x3 SPF No 2 1-6-3,Right 2x3 SPF No,2 1-6-3 REACTIONS. All bearings 4544 (lb)- Max Horz 2=77(LC 14) Max Uplift All uplift 100 Ib or less at joints)2,42,43,44,46,47,48,49,50, 51,52,40,39,38,36,35,34,33,32,31,30,28 i Max Grav All reactions 250 Ib or less atjoint(s)except 2=318(LC 58),41=323(LC 113),42=341(LC 21),43=330(LC 111),44=330(LC 110),46=330(LC 109), 47=330(LC 108),48=330(LC 107),49=330(LC 106),50=332(LC 105),51=323(LC 104),52=354(LC 103),40=341(LC 22),39=330(LC 115),38=330(LC 116), 36=330(LC 117),35=330(LC 118),34=330(LC 119),33=330(LC 120),32=332(LC 121),31=323(LC 122),30=354(LC 123),28=318(LC 80) FORCES. (lb)-Max Comp./Max.Ten -All forces 250(lb)or less except when shown WEBS 15.41=-25810,1442=-301/117,13-43=-280178,12-44=-284/69,11-46=-279/70, 9-47=-274/70,8-48=-276170,7-49=278/69,6-50=-281(/3,5-61=-280/62, 4-52=-298/121,16-40=3011117,17-39=-280178,18-38=-284169,19.36=-279170, 21-3 5=-27417 0,22-34=276170,23-33=-278169,24-32=-281173,25-31=-280/62, 26-30=-298/121 NOTES- 1)Unbalanced roof live loads have been considered for this design. _ IF N�fw, . 2)Wind:ASCE 7-10,Vult=130mph(3-second gust)Vasd=103mph,TCf3I=6,0psf,BCDL=6 Opsf,h=25ft;B=45ft.L=24ft,eave=2ft,Cat ll;Exp B;enclosed,MWFRS(directional)and C-C Corner(3)-0-10-8 to 2-1-8,Extenor(2)2-1-8 to 22-8-2,Corner(3)22.8-2 to 25-8-2 J10 J1Q/y, ''� , zone;cantilever left and right P.xposed;end vertical left and right exposed,C-C for members and forces 8 MWFRS for reactions _1 shown,Lumber DOL=1.60 plate grip DOL=1,60 s"' Q 3)Truss designed for wind loads in the plane of the truss only, For studs exposed to wind(normal to the face),see Standard Industry Gable End Details as applicable,or consult qualified building designer as per ANSI/TPI 1. C 4)TCLL ASCE 7.10;Pr=30.0 psf(roof live load-Lumber DOL=1,15 Plate DOL=1.15);Pg=50 0 psf(ground snow);Pf=38.5 psf(flat roof snow,Lumber DOL=1.15 Plate DOL=L 15);Category 11;Exp B;Partially Exp;Ct=1„1 Eu 5)Unbalanced snow loads have been considered for this design. 6)This truss.has been designed for greater of min roof live load of 12.0 psf or 100 times flat roof load of 38,5 psf on overhangs non-concurrent with other live loads. .O•V$9 �3f 7)All plates are 2x4 MT20 unless otherwise indicated 8)Gable requires continuous bottom chord bearing, aEs. �a - - ible studs spaced at 2-0-0 oc, his truss has been designed,for a 10,0 psf bottom chord live load noncon current with any other live loads.' July 26,2019 tttell. '' ®WARNING-Verity design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE Mir-7473 rev.f0103/2015 BEFORE USE Oa�lgri4Nllrftarudkrakf�+V�iM,MtT4kQttl1[fg4el�.Yttltd_sign`1r13ndtldtallyClllWi.Ntinlnnl tp,±i }t#tENlllatdroliLodlVd0altwUdNilcodpdtt0ntirml I �' n U,uea_'ry41Mn:apra'n tin lttt?OmiWng'dccl2Cinrtnust,vunfydteg nutifrira#Iity of dog On isamrngtvrr anp ptgpastp iq?arpamtn tnf�dor tpn into Uid caernll ttuilalgp d6tnn,,8radnir(n itadja to ptc+renttitn^icililo a!W1040111 lfiiiia tsn ldl rjW'j Ir 61aW5 ch!,Add 006 of tnmpemty nod orm0ttnadbradn0 t 'WGIC, isalW*letiulmd tor'ciQW111jand to k66nfcM1ppd0 wlthpadsibl4 And nrapofij onirtnw.Ft7{6gnVglt,gauinnrrt„{c atdtnO tiro, ,faltjcpl=u{t,6inla�d,;d0?ileriyJ ore(dianand tnnc,} OtihisSiitnn6ttit35t-spstt t�.,dnV�' ;ANSifrP,lIQl alltyCsUeria,D513•tgwtd8G61'Oulld{ng Component 16023SwingieyRidge Rd q &alalli tnt0rmat10R 41N1rabCa tram Tnrss Ptatn hratlluro,2S8 f#.S ttn'Siivat;Snde 312,Ignxandifd,VA22:14," § Chesterfield,MO 63017 Job Truss _ Tru§s Type Qty PIy $UILb NG 0ROOF VINEYARD VIEW 137936919 3597083 T02GE Common Supported Gable doh Raf+r�ainess;apitonai�' Universal Component Corp„ EAS HAVEN CT 06512 - - _ -- 8.010 s Aug-11,-201,7,MiTek Industries,Inc-Thu Jul 25 23:15 27:2b19 Pagu 2 IDvH81G91AM9_WQEtKnavHVNyuWBg-4PLuJz93B4SkrOAg6sZdtabCk59wz7r AnkjlwyuNSU NOTES- 11)'This truss has been designed for a live load of 20 Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide will fit between the bottom chord and any othb;;members, 12) KOvide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift at joint(s)2,42,43,44,46,47,48,49,50,51,52,40,39,38,36, 35,34,33,32,31,30,28. 13)This truss has been designed for a moving concentrated load of 250,01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord, nonconcurrent with any other live loads. I ®WARNING-veriry design parameters and READ NOTES ON MIS AND INCLUDED MITEK REFERENCE PA GE MI1•7473 rev.10/03/2015 BEFORE USE. Gn.,f{jh,Y.f411fefturxokilyWlUl,T+`IT`s3kQJCrNinf;fJara,Yt[idd�rignt4bnaedt%sIY.0S�Pnrt+nr�l�.f5§7rnwn,n,lU�arar,anfndtuiouulhffPd+nt2<:tl(nnaennk:riot � iVlASTek"gfrUtF9 eyp'Vsni. tprr;[s5n.11fu trUi>at"nq dosfgnnr ngtlat,voilty the upitiirilbrllky of dcaglq parmnn}9rz,qlf rel+Yrtry;ini:a]h r'urn tt,tY dl+aIgminlDM1irc aitulAil I .9 ek" lnriktlnp defign,ttmran,l tnurret�d Es i2 prevent bk�.4lLiSaxt Inaiv�ftlkifi tnfsa�`fob`nndlae�}wrdi+mm5a+e aniy.tuldittnhnr remlyofxf pfirrnnnnnl bfccc:ng y vs Hiway tngaited tdrstntrflltyer 11tH �vant'coriuDev trr 5(,aaynngtyrlttnmln,ngfnrrtastfkafen,daeuckasryl,fy,tR�isrkmttnit�Tntrn�nssd'FpCa�ilAaP_ snaf jnieiy cur t Pr.- g damsgo:,fargnnnral`p idn az rvktl ininy itfn__ --- j£ 16023SvnngleyRidge Rd bllkad,bdts"%and llit0syStmmIV*, AlgQand ecst Boding component ?ipr4lostikuto2i8A,l'0Chesterfield.M0630171 _- - Job Truss - russ Type my ply BUILDING D ROOF VINEYARD VIEW 137938920, 3597OR3 03 FFCommon 2 1 ' _ - I Job-Reference a tional Universal Component Corp., EAST''=jfyVEN-CT{I651? :$.910 S,itqu 11 2017 Mi Tek Industries,Inc. Thu Jul 25 23.15:28 2019 Page`1 ID:uH81G9iAM9_W QEiKnavh\./NyuWBg-YbVGW JAhyOabTAktgZ4sPo8M1VN7idr7 PRUG H MyuNST 3-7-11,> 741$ _11P104 — 14-5-12 -- 5-f-4 3 7 1— 3-7-3 r` 3-7-3 T=f1 1Q B 4X4 `' Scale=1 49,9 F. 12.00 12 11 12 -f 1x4 \\ 13 10 '� 1x4 2 4 9 ` 14 4 _ -- - *3.,-- IT d — - o ks 15 16 3xB II 7 3x8 = 741.1 - -7-2-14 Piat1�0(fsets X;Y}-- 1.•Ed- 0�0w7 �a,Ed a`0-0-7 f.P.'.�- __ _ _- �` LOADING (psf) SPACING- 2-0-0 CSI. DEFL. in (toe) Itdefl Ltd PLATES GRIP TCLL(roof) 30>0 Plate Grip DOL 1.15 TC 0.31 Vert(LL) -025 1-7 >674 240 MT20 197/144 Snow(Pf/Pg) 38,5!50.0 Lumber DOL 1.15 BC 070 Vert(CT) -0,31 1-7 >544 180 TCDL 10.0 BCLL 0.0 * Rep Stress Incr YES WB 0.17 Horz(CT) 0.01 5 n/a n/a BCDL , - 1(110 _ Code IBC2015/TPI2014 Matrix-S Weight-58 Ib FT=20% LUMBER- BRACING- TOP CHORD 2x4 SPF No,2 TOP CHORD Structural wood sheathing directly applied or 541-3 oc purlins. -T CHORD 2x4 SPF No.2 BOT CHORD Rigid ceding directly applied or 10-0-0 oc bracing. BS 2x3 SPF Not -IDGE Left 2x6 SPF No.2,Right'2x6 SPF Na,2 REACTIONS. (Ib/size) 5=932/0-5-8,1=816/0-5-8 Max Herz 1=-178(LC 12) Max Uplift 5=-71(LC 14),1=-32(LC 14) FORCES. (lb)-Max Comp,/Max,Ten.-All forces 250(ib)or less except when shown. TOP CHORD 1-2=-911/122,2-3=-704/163,3-4=-7021154,4-5=-934/115 BOT CHORD 1-7=-16/568,5-7=0/541 WEBS 3-7=-125/472 NOTES- 1)Unbalanced roof live loads have been considered for this design_ 2)Wind ASCE 7-10,Vult=130mph(3-second gust)Vasd=103mph;TCDL=6.Opsf,BCDL=6.Opsf;h=25ft,S=45ft;L=24ft;eave=4ft;Cat, Il;Exp B;enclosed;MWFRS(directional)and C-C Exterior(2)0-2-12 to 3-2-12,Interior(1)3-2-12 to 7-2-14,Exterior(2)7-2-14 to 10-2-14 zone;cantilever left and right exposed,end vertical left and right exposed;(-C for members and forces&MWFRS for reactions shown;Lumber DOL=1.60 plate grip DOL=1.60 3)TCLL.ASCE 7-10,Pr=30 0 psf(roof live load:Lumber DOL=1;15 Plate DOL=1,,15);Pg=50.0 psf(ground snow),Pf=38 5 psf(flat roof snow Lumber DOL=1.15 Plate DOL=1.15);Category II;Exp B,Partially Exp;Ct=1,1 4)This truss has been designed for greater of min roof live load of 12,0 psf or 1,00 times flat roof load of 38 5 psf on overhangs non-concurrent with other live loads: 5)This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads: a 6)*This truss"has been designed for a live load of 20.Opsf on the bottom chord in all areas where,a rectangle 3-6-0 tall by 2-0-0 wide � 1{4) will fit between the bottom chord and any other members. �1 7 One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT at't s 5 and 1 Thi's connection is for ' 0 ' uplift only and does not consider lateral forces 8)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along s the Top Chord and Bottom Chord,nonconcurrent with any other live loads, tr¢ •,p99 -ESS1� July 26,2019 ®WARNING-Verify design parameters and READ NOTES ON THIS AND`INCLUDED M1TEK REFERENCE PAGE M11-7473 rev.fOID3/2015 BEFORE USE. -Dosfan Volid for use poly win M]TnMohnnrK;a[9.,Tbjs,itgaigt is basedcaily upon paraniCtdmitiova,and is for an individual building component,not a;ttues 8yshim Bsfoi6uji%the Wililltig'd8wgner must iirpjt,the i ppilcalrhty of design ptiraliiclaa and property Incorporate this design into the overall butidliip dalibn Bracing Indicated Into ptsvanf'buelti(ni}`otirsllvlduttPltYiss,web endtor chord members only,Additional temporary and permanent bracing Welk'+ is always required for stability and to prevent collapse with possible personal injury and property damage,Forgen"r,giiitiance regarding the ,. > fabrication,storage,delivery,erection and bracing of trusses and truss systems,see ANSIrrPII Quality CdtatlaiDSB-89 and Best Building Component 16023 Svnngley Ridge Rd Safety Information evadable from Truss Plate Inshtute,218 N Lee Street,Suite 312,Alexandria,VA 22314. - Ch..161.-Id,MO 63017 Job runs Truss Type - _` - 4ty`^ PIY- BUILDING D ROOF VINEYARD VIEW` 137938921 g717R3 03GE Common Supported Gable 1 1 -- ! 'Job Reference o tlaaal - Unlversal Component Corps EAST HAVLN CT 06512 - - _ - -- 5+010 s ntig 912097'Mt`I ek 1nt)Usf�ies;lnc.Ttiu JU125 23:95,3�f?13 Patltt 1 tD;uii81G9ififv9 WVCOEiI<n2vFlVtlytlWB9t11GYrjM 4V I{ItES6 Rtg8f•,f30FSw�tftrlTOrit3xbUllyu4 •0.10 20-8-2 9�„�2 --- "44;3�I2 0,1�' -- ;2iJ•82 =_ 22-8-2 0;18.8" Scale=1 72 Q 3,75 12 5x6 = 61. 13 63 141,.6,4 15 _ ---.� - 3x6 7::- �� ( " 65 16 66 sx6 11 12 62� � �` 10 _ ry 17 67 60 18 59 9- r Ea t + 19 20 68 58 B / 1 0tip^ 2169 57 7._ it•` ) 5 g %, ,e 22 70 71 g� 56 6 '11' II i ( ai 1s 11- 23 f{ tt [ _ _ 725 245455 73 44 24 28 53 26 74 32 27 t - o y5�.a-„-,--..!r�..e-L^'-'xY�"" :....>-,...,..li.-...-_y^+T.=.---x.>.,,�__I..;gm�. ii _�+ �I.^t'.a,,.�I..-., .:.I,f .,.-xl. ^.-`.3' "'" #"�"'^ .�ry•„ i,�t; I^---#---��-1, 3x6 11 52 51 7& 76 49 77 48 78 47 79 46 80 45 81 44 43 42 82 41 83 40 84 39 85 38 86 37 36 35 87 34 88 33 89 32 90 31 91 30 92 29 93 3x6 = 3x6 = 43.4.7 =1 ' - - - - - 43-1-4 Alaic:Otfssits X( J27. 2 LOADING (psf) SPACING- 2-0-0 CSI. DEFL. to (loc) Udefi L/d PLATES GRIP TCLL(roof) 30.0 Plate Grip DOL 1.15 TC O<20 Vert(LL) 000 27 n/r 120 MT20 197/144 Snow(Pf/Pg) 38.5/50 0 Lumber DOL 1 15 BC 0.18 Vert(CT) 0,00 27 n/r 120 TCDL 10,0 Rep Stress Incr YES WB 0.36 Horz(CT) 0,00 27 n/a n/a BCLL 0.0 Code IBC20151TPI2014 Matrix-S Weight.173 Ib FT=20% BCDL _ 10.0 LUMBER- BRACING- TOP CHORD 2x4 SPF No,2 TOP CHORD Structural wood sheathing directly applied or 6-0-0 oc purlins, BOT CHORD 2x4 SPF No-,2except end verticals WEBS 2x4 SPF No,2 BOT CHORD Rigid ceding directly applied or 6-0-0 cc bracing. OTHERS 2x3 SPF Not SLIDER Right 2x4 SPF No 21-6-3 REACTIONS. All bearings 43-4-4 (lb)- Max Horz 52=-100(LC 14) Max Uplift All uplift 100 Ib or less at joint(s)52,41,42,44,45,46,47,48,49, 50,51,39,38,37,35,34,33,32,31,30,29,27 Max Grav All reactions 250 Ib or less at joint(s)except 52=285(LC 81),40=326(LC 114),41=341(LC 21),42=330(LC 112),44=330(LC 111),45=330(LC 110), 46=330(LC 109),47=330(LC 108),48=330(LC 107),49=329(LC 106),50=333(LC 105),51=304(LC 82),39=336(LC 22),38=330(LC 116),37=330(LC 117),35=330(LC 118),34=330(LC 119),33=330(LC 120),32=330(LC 121),31=332(LC 122), 30=323(LC 123),29=355(LC 124),27=316(LC 80) FORCES. (lb)-'Max.CompJMax Ten,-AII forces 250(lb)or less except when shown TOP CHORD 2-52=-273/61,13-14=-971262,14-15=-971269 WEBS 1440=-263/0,1341=-301/117,12-42=-280178,11-44=-284/69,9-45=-279/70, 846=-274/70,7-47=-276(70,6-48=-278170,5-49=-280169,4.50=-283187, 15-39=2961117,16-38=-275/78,17-37=-281169,18-35=-272/70,20-34=-274170, 21-33=276f70,22-32-278169,23-31=-281172,24-30=-280163,25-29=-299/117 NOTES- 1)Unbalanced roof live loads have been considered for this design. ��.Opsf;h=25ft,B=45ft,L=24ft;eave=oft;Cat. jo 2)Wind.ASCE 7-10,Vult=130mph(3-second gust)Vasd=103mph;TCDL=6 Opsf;BCDL=6, , Il;Fxp A;enclosed;MWFRS(directional)and C-C Corner(3)-0,10-8 to 2-1-8,Exterior(2)2-1-8 to 20-8-2,Corner(3)20 B-2 to 23-8-2 � � zone;cantilever left and right exposed,end vertical left and right exposed,C-C for members and forces 8,MWFRS for reactions , shown;Lumber DOL=1 60 plate grip DOL=1 60 3)Truss designed for wind loads in the plane of the truss only. For studs exposed to wind(normal to the face),see Standard Industry N ;-f d, Gable End Details as applicable,or consult qualified building designer as per ANSIITPI 1Y tt 4)TCLL•ASCE 7-10,Pr=30.0 psf(roof live load'Lumber DOL=1.15 Plate DOL=1.15),Pg=50,0 psf(ground snow);Pf=38 5 psf(flat roof snow'Lumber DOL=1,15 Plate DOL=1.15);Category Il,Exp B;Partially Exp.;Ct=1,.9 kik h (? 5)Unbalanced snow loads have been considered for this design: '099 6)This truss has been designed for greater of min roof live load of 12,0 psf or'1 00 times flat roof load of 38.5 psf on overhangs �A3 non-concurrent with other live loads. �aFEScu�l�'aR 7)All plates are 2x4 MT20 unless otherwise indicated. 8)Gable requires continuous bottom chord bearing July 26,2019 9)Gable studs spaced at 2-0-0 oc. D r i ®WARNING.Verify designparameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE Mll-7473 rev.10/03/2015 BEFORE USE Iii rot nn Individulil trulrt•,infl CampgnVll.not vilyss/xtnm:Bota'rowd,lhUbulin0igbt lgnvtritusarote/,thwnnpgnnil6tYotaostTinporomaamandpropnry600ipo0oth1fitl" inti therN67"trttlltlin)I�i {n1�Br�c'fi�hkli4_t4dWlnPro fln#'I:nekling6llpdhhrllNllltt�-S ' 4nQtAir�Q�d'i#[nhlhdiucrtly;JitldEtlOnnlron:�I4mrybndpnrman1tnaF�.) MR, 'In atw¢ya mridtrrCl tor'etaoi6tj!orad In,'pr�avcnt rnthtpu�+�q?pnra:filo perecttul iPjliry Ind Orop4riy(Innrp90 For g0anml tjtr#danc0 rugnr111np the fowthi;rm.dlinraOo:dCi`,4eryry nmaifon nrnilirtsr5ng tit ltta�0;end"1.0»Sl isy9lnms.6o0 -ANSVI'P11,006lify Ctltnrtal DSO•BO and BC83 B011ding Component 16023 Swingley Ridge Rd &nidFy lnFormation mailable fidinTrusn PlotOrwm6i6.216 N:U60 Strom;Svdo,11't,Nex mililp,VA22314, Chestedield,MO 63017 - Job -� � russ�"`�_-- �^-" "Truss Type'- Qty -�"Ply BUIIDI�tG.D ROOF VINEYARD V_IFVIf- 137938921 5970R3 03GE Common Supported Gable 1 1 __ _Jo6Roferi3ncco Universal Component Corp..--`l-EAST,HAVEfJ*GT06519, --'—"" 8.010sAug112017MiTeklndtiultit7s,Int%.ThuJul'2523:15:362019Page2 ID uH81G9iAM9_WQEtKnavHVNyuWBg-J701B2G14raSQOMPBFEkkUTILkE4aCzlFhQhzvyuNSL NOTES- 11)"This truss has been designed for a live load of 20.Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide will fit between the bottom chord and ly other members •ovide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift at joint(s)52,41,42,44,45,46,47,48,49,50,51,39,38,37,35, _f,33,32,31,30,29,27: 13)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord, nonconcurrent with any other live loads. p WARNING-Verify design parameters ared'READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE MII.7479 rev 70!0312015 BEFORE USE. i, Qcsf(jn`vatldlyx U".N onty wW)1A1'Pek�1 cwitreclots,This dasigq Iia trasesf�tNapon pOramomrc shOWn;and is fdtart In1Gutlital(7nlTdtng nbttstiWtorIldiv:lmrynQylluoidsncr.otoa�lmtjtuwnl,r.a aB6[a}rrto7o.6Cdrd,eO11wtt(tatv+bUu0tlry,ldlltl.yheaganilntbegCud!i{tftoa}9n mP16r7raa1d>cnarsJqp,vpnatlrnmp oaoittv.tini'hntpy0toVtaa bainpiplcicmslOtipnliiny9,AmSfjudryecd l�mnd'P,1Pmmprninaty,"¢snianiudyuru.ntFfuiuily�dOInm(amlytwpgubtdnVntrbi�e dreayutiydna:r lrtngntrpti mothnur a'oraintvrtta(w.rxoJl l liM iTek'oussrid, brirlLrp of INs�cs and uoaK ayaama.,eea AKSIFiP11 Quat tyCrtfana,t]9a 89 and UG616u{Idinp Component Chest 5 eld, y 6301idge Rd Satafy Intarmatton"ovnifubta from Tnlsp Aato tnotiptto;a0 N:Lca StiaoL 3aite 312r 7Jn nir dda,yA423 hi: ChasieKeld,MO 63017 Jab- cuss - TiussTypa Qty Ply I,BUILDING D ROOF VINEYARD VIEW 137938922 35970R3 04 Rout Special' 2 1 _ 9Gb_Reference[ootfonall -Universal Compofient Corp„ EAST,HAVEN CT,06512 8.010 s Aug 11 2017 MITek I1ldusules,Inc.'Thu Jul25 23:'15372019-Page 1 ID uH81G91AM9_WOEtKnavHVNyuWBg-nKygPOHKg9lJ2YxblylzHhOvK7RIJhkSUKAF6LyuNSK :7.11 ?-2•t%t E 10-101 i341•114152 i 3-7-11 1 3.7.3 3.7-3 3 1-1 O fr1 44 Scale= 3 12,0012 13 ti94 1x4 \ 12 ,1 ; 5 4x4 \\ 2 yk.` 4 11 .f 1x4 11 10 `;\\ 6x6 = 6 VIE 17 g 18 8 7 3x8 II 3x8 4x4 = = 3x6 II 7-2-t413-1 i=i 14-542 7-2-14 1 - 'e=_4 a.�--- Plate Offsets(%Yl I1 Edge'0>f1.71' LOADING (psf) SPACING- 2-0-0 CSI. DEFL. in (loc) [[dell Ud PLATES GRIP TCLL(roof) 30.0 Plate Grip DOL 1 15 TC 0.31 Vert(LL) -027 1-9 >637 240 MT20 1971144 Snow(Pf/Pg) 385/50.0 Lumber-DOL 1 15 BC 0 73 Vert(CT) -0.34 1-9 >502 180 TCDL 10,0 Rep Stress Incr YES WB 0.19 Horz(CT) 0.01 7 n/a n/a BCLL 0,0 Code IBC2015/TPI2014 Matrix-S Weight 56 lb FT=20% BCDL 10.0 LUMBER- BRACING- TOP CHORD 2x4 SPF No,2 TOP CHORD Structural wood sheathing directly applied or 5-9-4 oc purlins, BOT CHORD 2x4 SPF No.2 except end verticals,and 2-0-0 oc purlins(6-0-0 max.):5-6 WEBS 2x3 SPF Not BOT CHORD Rigid ceding directly applied or 10-0-0 oc bracing WEDGE Left 2x4 SPF No,2 REACTIONS. (Ib/size) 7=837/Mechanical,1=837/Mechanical Max Horz 1=179(LC 13) Max Uplift 7=-35(LC 14),1=-35(LC 14) FORCES. (lb)-Max,Comp/Max.Ten--All forces 250(lb)or less except when shown. TOP CHORD 1-2=944/127,2-3=-7301166.3-4=-7231153,4-5=9231119,6-7=305/68 BOT CHORD 1-9=66/589,B-9=-47/585,7-8=-571564 WEBS 2-9=256/156,3-9=127/502,4-9=256/147,5-8=01450,5-7=-1095/94 NOTES- 1)Unbalanced roof live loads have been considered for this design 2)Wind.ASCE 7-10,Vult=130mph(3-second gust)Vasd=103mph,TCDL=6,Opsf,BCDL=6,Opsf,h=25ft;B=45ft,L=24ft;eave=4ft;Cat. 11;Exp B;enclosed;MWFRS(directional)and C-C Exterior(2)0-0-12 to 3-0-12,Interior(1)3-0-12 to 7-2-14,Extenor(2)7-2-14 to 10-2-14,Interror(1)13-11-1 to 14-4-8 zone;cantilever left and right exposed;end vertical left and right exposed,C-C for members and forces&MWFRS for reactions shown;Lumber DOL=1 60 plate grip DOL=1 60 3)TCLL:ASCE 7-10,Pr=30.0 psf(roof live load-Lumber DOL=1.15 Plate DOL=1,15),Pg=50.0 psf(ground snow),Pf=38.5 psf(flat roof snow Lumber DOL=1 15 Plate DOL=1.15),Category 11,Exp B;Partially Exp;C1=1 1,Lu=50-0-0 4)Provide adequate drainage to prevent water ponding 5)This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads. -of NES 6)'This truss has been designed for a live load of 20-.Opsf on the bottom chord in all areas where a rectangle 3.6-0 tall by 2-0-0 wide will fit between the bottom chord and any other members °� Q 7)Refer to girder(s)for truss to truss connections. CO0 o¢ 8)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift at joint(s)7,1, 'Z 9)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads_ L- it 10)Graphical purlin representation does not depict the size or the orientation of the puriin along the top and/or bottom chord; 09 Ss�o July 26,2019 ®WARNING-varlry design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE MII-7473 rev.10/03/2015 BEFORE USE. .udtigr:vaediLwus;Icniy,eal7hR�?'3M1?��•tl:earv7Rlpda;sipiritita::.4c�,1yui>dttp�.:Girt.iDl^DhDYenicodlDl^_r,^.$^d�iysIi�h`f+f+Jlr�r_rygtq,sna,n:,l �, trosx nystnnL f101wn user 11w Wlidln9 ilnUigdnr inu6lvurlly ilio pypd�:nt�ly of floalgn pwnmutuis and prbpwly IriwrpDi:ira ih{s`drrdgri Into Oto overall '+�� bul!dirigdcsipn:aradnPlntlhatedlcfopievsnthuculaigofinnlJrtloeitrusywn4nOdrgrchardmcmbarppi;vy,Addidoimlrnmpmryandpnmmnenrhrndrip �j�'�A�( :in nMaysroRlnrodfix st:fir'.61ynM1m1(Ifo'VwnCt)ilhpY.`Y(fillcps:�fslcpemunnitnJuryntwl,ri-xi+-v'•ydamn9n.frmlioririialguldanarrc0iirdMy'Itir;" - _ tot r(cndon,aiwa0e ddl)very aloWlo'n and UterJnp oI Iru<sac arnd tnrassyDtomil"saa ANSIrMll Qup[ity'Gdlarip,OS"0.1"d BCSI Building Component 16023 Swingley Ridge Rd SaNDty In/ormalloa a"lin to Irian Truss-Ptalc(r-011oln,218 N.Lue SOeel,Sulle 312,AI=nddp,VA 7231.1- _ _ ( Chestertleld,MO 63017 Job russ Truss Type Qtylyl BUILDING D_ROOF-VINEYARD VIEW=_ 1 137938923!� 35970123TG4GE 70113 Common Supported Gable Job ob Reference!optional Universal Component Corp., EAST HAVEN CT 06512 8,019 sAug 1120117 Mi-1ek4nduqneg_,jnc:-,T�y Jul 25 23.15 42 2019 Page I _WdEIKMvHVNyUVV8o:6L I f1?S*T6Lc8JpZUVVL8jj q8H AlktiHSIGSIAM9., m L�*,1Bd6I0nYydN SP 20.8-2 '4344 44-2V 20-8-2 -22-8-2- Scale 1,71 A 3.75 12 5x6 ----- - 12 62 13 63 14 64 10 65 1 3x6 Zz 859 -6 66 17 58 - - 19 7 67 2068 5 56 3, l t 2169 544 55 2270 2371 2 353 52 24724x4 24 25 73 27 26 L f 51 50 74b 75 48 76 47 77 46 78 45 79 44 80 43 42 41 81 40 82 39 83 38 84 37 85 36 35 34 86 33 87 32 88 31 89 30 90 29 91 28 92 3x6 11 3X6 = 3x6 43=14 43-44 'Plate Oilse!a_j6YE J26.10-3-3_03-101 LOADING (psf) SPACING- 2-0-0 CSI.. DEFL. In (too) Well Ltd PLATES GRIP TCLL(roof) 30.0 Plate Grip DOL 1 15 TC 0.20 Vert(LL) 0,00 26 n1r 120 MT20 1971144 Snow(Pf/Pg) 38.5/50 0 Lumber DOL 1 15 BC 018 Vert(CT) OLD 26 n1r 120 TCDL 10.0 Rep Stress[nor YES WB 0.35 Horz(CT) 0.00 26 n/a n1a SCLL 00 Code IBC20151TP12014 Matrix-S Weight:171 lb FT 20% CDL 110,0- LUMBER- BRACING- TOP CHORD RACING.TOPCHORD 2x4 SPF No.2 TOP CHORD Structural wood sheathing directly applied or 6-0-0 co purlins, IT CHORD 2x4 SPF No;2 except end verticals., :BS 2x4 SPF No,2 BOT CHORD Rigid ceiling directly applied or 6-0-0 or.bracing- 2x3 SPF No.2 SLIDER Right 2x4 SPF No.2 1-6-3 REACTIONS. All hearings 4344 (lb)- Max Horz 51=-I 01(LC 14) Max Uplift All uplift 100 lb or less atjoint(s)40,41,43,44,45,46,47,48,49, 50,38,37,36,34,33,32,31,30,29,28,26except 5l=-123(LC82) Max Grav All reactions 250 lb or less at joint(s)51 except 39=325(LC 114), 40=341(LC21),41=330(LC112),43=330(LC111),44=330(LC110),45=33O(LC 109),46=330(LC 108),47=330(LC 107),48=329(LC 106),49=333(LC 105), 50=320(LC 82),38=333(LC 22),37=330(LC 116),36=330(LC 117),34=330(LC 118), 33=330(LC 119),32=330(LC 120),31=330(LC 121),30=332(LC 122),29=323(LC 123),28=355(LC 124),26=317(LC 80) FORCES. (lb)-Max CompJMax.Ten,-All forces 250(lb)or less except when shown. TOP CHORD 12-13=-98/261,13-14=9812138 WEBS 13-39=-26210,12-40=-3011117,11-41=-280178,9-43=-284/69,8-44=-27900, 7-45=-274170,6-46=-276/70,5-47=-279/70,4-48=-280169,3-49=-2841113, 2-50=-261/133,14-38=-293/117,15-37=-27308,16-36=-280169,17-34=-272170, 19-33=-274f74.20-32=276170,21-31=-278169,22-30=-281172,23-29=-280/63, 24-28=-2981117 NOTES- 1)Unbalanced roof live loads have been considered for this design., JOL_ 2)Wind:ASCE 7-10;Vult--130mph(3-secondgtist)VRRd=103mph;TCDL=6.Opsf:13CDL=6.Opsf-,h=25ft;B=45ft;L=24ft,eave=2ft;Cat, Ik Exp B;enclosed;MWFRS(directional)and C-C Comer(3)0-1-12 to 3-1-12,Exterior(2)3-1-12 to 20-8-2,Comer(3)20-8-2 to 23-8-2 zone;cantilever left and right exposed;end vertical left and right exposed;C-C for members and forces&MWFRS for reactions shown;Lumber DOL=1.60 plate grip DOL=1,60 3)Truss designed for wind loads In the plane of the truss only, For studs exposed to wind(normal to the face),see Standard Industry Gable End Details as applicable,or consult qualified building designer as per ANSUTPI 1. 4)TCLL-ASCE 7-10;Pr=30.0 p sf(roof live load-Lumber D 0 L=1-,15 Plate D 0 L=1.15);Pg=50,0 psi(ground snow);P f=3 8.5 psf(flat (P roof snow.LumberDOL=1 15 Plate DOL=1 15);Category ll;,Exp 13;Partially Exp;Ct=1.1 . 5)Unbalanced snow loads have been considered for this design. 099433 6)This truss has been designed for greater of min roof live load of 12.0 psi or 1.00 times flat roof load of 38.5 psi on overhangs non-concurrent with other live loads. "I plates are 2x4 MT20 unless otherwise Indicated able requires continuous bottom chord bearing July 26,2019 ®WARNING-Verify design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE M11-7473 rev.1010312015 BEFORE USE DeBign vnl,d f6r d6ion'fs hatudo*ujunj pLmMwjp4i&fli,aid LifaW unhi0itlquI ding ewipone-li,mt, ' 16rn.'Befewd 1110Qidwo d&af-164 most Vad d 0onnimaill irudhj' NMI' 1: F., mral qm�d. rolan llitr Mri� i.y Crlt. and 0CM.10011t[Ift Cibirriparient 16023 SwInglay Ridge Rd t� - 1 Chesterfield,MO 63017 I Will 11Z L zw,.' r",� p, trips .1 Fva Job Truss - `Truss Type Qty PtyBUILDIhiG D RGOF'•VINEYARD VIEW 137938923, 3597OR3 04GE Common Supported Gable 1 1 J013,1740 fide jo ria i,I `Untversal'Umponent Corp., EAST HAVEN CT 06512 8,010 s Au014 2017,•MITek Industries,Inc, Thu Jul 25 23:15:44 2019 Fage'2 ID,uHBIG91AM9_WQEtKnavHVNyuWBg-4gtJtnMiBJbJNdzxcwNc3Ao6KyyySpzU5wM7rRyuNSD N 6TES- 10)This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads. 11)'This truss has been designed for a live load of 20 Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide will fit between the bottom chord and any other members. 12)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift atjolnt(s)40,41,43,44,45,46,47,48,49,50,38,37,36,34,33, 32,31,30,29,28,26 except at--lb)51=123. 13)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord, _ ___nonconcurrent with any other live loads I ' ' i •.rm - ®WARNING.Verify design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE Mll-7473 rev.10/03/2015 BEFORE USE 4 19asI0n vn6d ra,vae unlyivtlh GIITckF7camtcUOts 97iro d0etgn!,Da ud ahlyupan pnrametcrn ahaWn;antl fs far anlndNideal Iarflr uig carnppnant,pot avv.9�}rtalR:Elatnr4v�:Illobull��pda f{nCtr�tratvndtyfhapppfcablllyoTdaelJnpor3notnrnendptopeflyUicartsar�lillhladts7gnini0lhaovarng i txdldTngdestga.BJadngtatlirri{alfa`o'ptavturlblw'�nN'�li�dlvldunlirunotVabdndlordfotdmotithnrsaity;Addllfencil{ompar0ly ndlwrmMunibrarJng' t ��1�( � Tii,afxayprryurardtdrniObiTitj•and'}g�pvantcallgpuo}vl4hpaa5�daUaresonnlrinjmyand(,ropotlYdnmOya.Forg+enaralaDidnhcprr�tylgaietEip; inAricadcrt,atamgu,dditvtlry,eruailtin and fune4+p a{ItuSaatithretl uuoa sygiama•saa ANSViPli;pudnly'C'dtdrin,bsa•Os end f3C5i Bulfdtng Component � 16023 Swingley Ridge Rd Salvty InlarmaBon nvnUnDfa framTtur.J'Flntu InsMitutn,210�I.Ltc Struat,Salta 31?,Nirrnndd0,VA 2313, � Chesterttald,MO 63017 Job russ - nidsT,ypp l` --City- Ply BUILDING D ROOF VINEYARD VIEW 1379 24 35970R3 05 Roof Special 2 1 Job Reference fo tional - _ ___-- IUniVetsaFComponentCor(t, EAST HAVEN-`CT'08512` -- $,QiOsAtig1120t7MlTt:)c'Ind4Wi�;•iltc.ThuJul 2523M5:462U,t9'Pauli I ID;ti}i81G31 t.S9'��JG>ni�nrroiiVl4yv'diS�=Y&r47tilLyr)A?r,YBA�uiGNLtiKM9b2Glit)Ja6gOtyuhJSC 3.711.; 7=9"14 -- 70 4Lkt 13.3-9, -&112 4x4 = Scale=1.49.7 3 14 12.00 12 13- I 1x4 12 `' 15 1x4 r . 2 4 - 16 4x4= \�`S 4x4 10 - t, I 7 6 18 9 19 ,8 20 7 3xB II 3x8 = 1x4 11 4x4 = 7-2-14 13 3 9 9A•5 12 'Plate Offsets(X = _'Ti Etl )41 5:0.2-0 0,3 4 -- _ LOADING (psf) SPACING- 2-0-0 CSI, DEFL. in (loc) Well Ud PLATES GRIP TCLL(roof) 30.0 Plate Grip DOL 1,.15 TC. 031 Vert(LL) -0;26 1-9 >649 240 MT20 197/144 Snow(Pf/Pg) 38.5/50 0 Lumber DOL 1.15 BC 0,72 Vert(CT) -0.34 1-9 >507 180 TCDL 10.0 Rep Stress Incr YES WB 0,33 Horz(CT) 0,01 7 n/a n/a BOOL10.0 Code IBC2015rrP12014 Matrix-S _Weight:58 Ib FT=20% LUMBER- - —^ -- = BRACING- TOP CHORD 2x4 SPF No.2 TOP CHORD Structural wood sheathing directly applied or 5-9-4 oc purlins, )T CHORD 2x4 SPF No.2 except end verticals,and 2-0-0 oc purlins(6-0-0 max.)'5.6. EBS 2x3 SPF No.2 BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing. ..EDGE Left,2x4 SPF No 2 REACTIONS. (Ib/size) 7=837/Mechanical,1=837/Mechanical Max Horz 1=187(LC 13) Max Uplift 7=-35(LC 14),1=-34(LC 14) FORCES. (lb)-Max.Comp./Max;Ten,-All forces 250(lb)or less except when shown. TOP CHORD 1-2=-945/128,2-3=-731/167,3-4=7241149,4-5=-866/115,5-6=-634/55,6-7=-830/77 BOT CHORD 1-9=-97/589,B-9=-70/583 WEBS 2-9=-256/156,3-9=128/504,4-9=-254/143,5-8=678/124,6-8=-98/960 NOTES- 1)Unbalanced roof live loads have been considered for this design. 2)Wind:ASCE 7-10,Vuit=130mph(3-second gust)Vasd=103mph,TCDL=6,Opsf,BCDL=6.0psY h=25ft,B=45ft,L=24ft,eave=4ft,Cat. 11;Exp B;enclosed;MWFRS(directional)and C-C Exterior(2)0-0-12 to 3=0-12.Interior(1)3-0-12 to 7-2-14,Exterior(2)7-2-14 to 10-2-14,Interlor(1)13-3-9 to 14-4-8 zone;cantilever left and right exposed:end vertical left and right exposed;C-C for members and forces&MWFRS for reactions shown;Lumber DOL=1,60 plate grip DOL=1,60 3)TCLL'ASCE 7-10;Pr--30,0 psf(roof live load:Lumber DOL=115 Plate DOL=105);Pg=50.0 psf(ground snow);Pf=38.5 psf(flat roof snow Lumber DOL=1.15 Plate DOL=1:15);Category II;Exp B;Partially Exp.,Ct=1.1,Lu=50-0-0 4)Provide adequate drainage to prevent water ponding. 5)This truss'has been designed for a 10,0 psf bottom chord,bve load nonconcurrent with any other live loads; C)F {vS�/jj; 6)`This truss has been designed for a live load of 20 Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide will fit between the bottom chord and any other members.- 7)Refer to girder(s)for truss to truss connections. 8)Provide mechanical connection(by others)of truss to bearing plate capable of wlthstanding 100 Ib uplift at joints)7,1. 9)This truss has been designed for a moving concentrated load of 250,01b live located at all mid panels and at all panel points along the Top Chord and'Bottom Chord,,nonconcurrent with any other live loads. _ 10) Graphical pudm representation does not depict the size or the orientation of the purlin along the top and/or bottom chord. _ ;094' R�FESS1�� July 26,2019 ®WARNING-Verify design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE M11-74T3 rev,1010312015 BEFORE USE. a tIm-l6n'61fd fit Use slily,syph,MtTgkO=mctt_=_'t1,d-".d6lbasad ;Is olfl',ufmn pafamofera shown;aan dd 1310r hldN1601 ItUlldfRg CMI2011so1,1101 �• a vusS fivi in,Bofefo hfto,Cho building'd651rmrmoal vet•A/,lho appliotrjil�I of doolgn pommotom and rrtoiforfy ln®tpwale Ih)u dudgif fiifo lf,4 VWnll villiNiffi1e,31 .BraOldOtn iCntndlRenptuvenlloNatrip, erdfm tktntllufttuRluuixwwolfiltoirlstitdmombofuottllii'Addlfignattcfripud oraty-(ild,yenitai Mbmdrsti riger O�� i 1s aiwayJ ruyulrod for oiobifltydii 6i io±+ani cal*ops0 Qll pa8sibie pnl fnjwy,ond piopopty dnin .Fncrltyal pitttftfnregenflgp IhOt .fnh�lcultan,ular3gu.deltvaty,era01t0n snd(iisiAflll Of lruslasartid hues tt1l8teu�sl wo% .=_ A $npll,fd g lly Cfltotlo;DSB•89 and[C81 Buildiep Component 16023 Wrigley Ridge Rd •Barely intfum0llon'ovailantti b0m Truss Pinta inouGllo•21S N;Lori Strc-at;53ide 372;11foxartdda;Viv2;3t4; - Chesterfield,NO 63017 Job _ — russ ;,[4Rcoll _so Type Qty Ply 'BUIL DINGD ROOF-VINEYARD VIEW 137938925 5970R3 O6 Special 2 1 '_ _ _ _ _ Job Reference-oglionall Unlveisal Conipaalont,Corp., EAST HAVEN'0706592 - 8010,s Ad0,11.r2Q17 NI Tekdnriusldras„Inc TtW'Jul 25 23:98'462618 Page 9 ID.uHBIGolAM9 WOBtKnav�IVNyuWBg-12?'Jl Tdx)wr187c7ftjLP48tiuF2'tinV7+vtr itYErDw1<yut4SB 3-7-11 f 7.2-14 10-10-1 X12-a-2 } 14-5-12 t' - 37-1T 3-7-3 3.7,3 1-10-1 1-9.10 Scale 114"=” 4x4 = 3 f�/ +,\ 14 12,00 12 13 1x4 \\ \ 15 12 1x4 2 4 0 11 1x4 11 16 5x6 = 6 1 j t3 17 1 r= 18 9 19 8 20 7 3x8 11 3x8 = 1z4 i. 4x4 = 7_-1d I 12.8-2' 1- 5-12 i _ 7-2-14 -. - 5 - Plate Offsets(X.Y) LOADING (psf) SPACING- 2-0-0 CSI. DEFL, in (loc) I/deft L/d PLATES GRIP TCLL(roof) 30,0 Plate Grip DOL 1 15 TC 0.31 Vert(LL) -026 1-9 >665 240 MT20 197/144 Snow(PfIPg) 38.5/50 0 Lumber DOL 1.15 BC 0.72 Vert(CT) -033 1-9 >515 180 TCDL 10.0 Rep Stress Incr YES WB 0.21 Horz(CT) 0 01 7 n/a n/a BCLL 0-0 Code IBC2015(rP12014 Matrix-S Weight'59 Ib FT=2-0% _BCDL _10.0 _ _ _ - - - LUMBER- BRACING- TOP CHORD 2x4 SPF No.2 TOP CHORD Structural wood sheathing directly applied or 5-9-4 oc purlins, BOT CHORD 2x4 SPF No.2 except end verticals,and 2-0-0 oc purlins(6-0-0 max.) 5-6 WEBS 2x3 SPF No.2 BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing WEDGE Left-2x4 SPF No 2 REACTIONS. (Ib/size) 7=837/Mechanical,1=837/Mechanical Max Horz 1=195(LC 13) Max Uplift 7=-36(LC 14),1=-34(LC 14) FORCES. (lb)-Max.Comp,/Max.Ten.-All forces 250(lb)or less except when shown. TOP CHORD 1-2=-946/129,2-3=-731/168,3-4=-727/150,4-5=-837/115.6-7=-2B5/26 BOT CHORD 1-9=-126/589,8.9=-91/586,7-8--93/584 WEBS 2-9=-256/155,3-9=-130/508,4-9=-259/142,5-7=-9071112 NOTES- 1)Unbalanced roof live loads have been considered for this design. 2)Wind.ASCE 7-10;Vult=130mph(3-second gust)Vasd=103mph;TCDL=6.Opsf,BCDL=6.Opsf,h=25ft;B=45ft;L=24ft;eave=oft,Cat. ll;Exp B,enclosed,MINFRS(directional)and C-C Extenor(2)0-0-12 to 3-0-12,Interlor(1)3-0-12 to 7-2-14,Extenor(2)7-2-14 to 10-2-14,Interi6r(1)12-8-2 to 14-4-8 zone;cantilever left and right exposed;end vertical left and right exposed;C-C for members and forces&MWFRS for reactions shown;Lumber DOL=1 60 plate grip DOL=1:60 3)TCLL•ASCE 7-10;Pr=30,0 psf(roof live load Lumber DOL=1.15 Plate DOL=1.15);Pg=50.0 psf(ground snow);Pf=38.5 psf(fiat roof snow:Lumber DOL=1.15 Plate DOL=1 15);Category 11;Exp B,Partially Exp:Ct=1 1,Lu=50-0-0 4)Provide adequate drainage to prevent water ponding., 5)This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads. �! 01� NC 6).This truss has been designed for a live load of 20.Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide V will fit between the bottom chord and any other members. Q` 7)Refer to girder(s)for truss to truss Connections, col 8)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift at joint(s)7,1 9)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along Ai the Top Chord and Bottom Chord,nonconcurrent with any other live loads. f 10) Graphical purlln representation does not depict the size or the orientation of the purlin along the top and/or bottom chord f1J tf1�,O �o• 0g9t433 ?C? FES 81- July 26,2019 I ®WARNING-Verify design parameters and READ NOTES D N THIS AND INCLUDED MITER REFERENCE PAGE MII-7473 rev 1010312015 BEFORE USE � f r3rtidn vnl111 fin nNR enly Kit}!PdfTG+'ai7-crNlne3-, '3:itfn iS'tai�7:3&:>in',Gll1p kp:!D«lMw:'�S"!"„^.i.5ltd L^fC•0ii Ind!ldoW Luymmy e�r�nrnt"n t n truss bystom.Bala a'us`o.1Bti hnildinll'do9lgnur Im+it vardy eha oppl1-blllty of,do3l0n vA�+nRtan npd,(ropody inaarpamtn Ihla do3kjn inlu Ilia,cvnrail tfftdpOCra{¢n,8�aclrgindicnlndl6toprrrlcSiUtfClllnpa119dlvlddnitruesWrclw'dmonlbcleonly.Addltldnyt'lGmpororJGrn pnrmananlbrnciap y �� i ty piNayri Nqutradtar'±,10611Vty antl l0 proucin9 eatn{39a��1in Det=lbfn Aw3ana"pit ryand nropOMy dnmpgd:'�Or,00n4m1,plodancarRga�nO the i fa cgNarl,p10mpp flopvgry;gmcrian and hradnp of Irua,zs nJ 1ru65syxfurns s:e ANSlJrP11,LSuWlly CAterta D59.84 rinil SCSI BuIWInQ Component { 16023 Sw ngley Ridge Rd SalW (n om+nbdn avail I I I Truss nlnlo Ia of ulo IB N,Loo S11001 Su7fo 31 x.A1axng4(In,VA 2Y31•i, f Ghesierfietd`MO 63017 Job Truss I Trues Type ' Qty— Tty i UILDI D,ROOF VINEYARD VIEW — 137938926 3�970R3 T07 Roa(Speciab 2 1 �._- dab Rnfefeeca Notional), - — -------- Universal Component Corp.., EAST HAVEN CT'46512 — - 8.0rok Industries,Inc,Thu Jul 25 2.3.15:48,2019 Page 1 ID:uH81G9{AN9_WOEtKno4HVNyvWBg zR6g19PEFX5IsEGIrmRYDOzn7ZBXde_gWYM CyuNS9 l 3-7-11 A4 _.-_3-7=1f" --3-7-3 63.7.3 1-2-9 2c5tii 44.=. Scale:1/4"-l' 3 13 / 12.00 12 - 1 x4 \\ 12, 15 1x4 21x4 II p 4 16 6x6 = CP 19 -9— - - 20-- 8 21 7 axe II 3x8 = 1x4 II 4x4 = -- ----4-9-12 7-2-14 - - 4-9 12 2-5.3 - Plalit Offsele(XX —4'•(1:Edpe_t1 - LOADING (psf) SPACING- 2-0-0 i CSI_ DEFL. I-n (loc) Udefl Ud PLATES GRIP TCLL(roof) 30.0 Plate Grip DOL 1,15 TC 0.31 Vert(LL) -0.25 1-9 >686 240 MT20 1971144 Snow(Pf/Pg) 38,5/50,0 i Lumber DOL 1.15 BC 0.72 Vert(CT) -0.33 1-9 >521 180 TCDL 100 Rep Stress Incr YES WB 0.30 HOrz(CT) 0.01 7 n/a n/a BCLL 0.0 Code IBC2015rTPl2014 Matrix-S Weight:60 Ib FT=20% BCDL ,10.11-- — _- -- LUMBER- - --_ - = BRACING- ^0 CHORD 2x4 SPF No.2 TOP CHORD Structural wood sheathing directly applied or 5-94 oc purlins, r CHORD 2x4 SPF No,2 except end verticals,and 2-0-0 oc purlins(6-0-0 max,),5-6. BS 2x3 SPF Not BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing, WEDGE Left:2x4 SPF Not REACTIONS. (Ib/size) 7=837/Mechanical,1=837/Mechanical Max Horz 1=203(LC 13) Max Uplift 7=36(LC 14),1=-33(LC 14) FORCES. (lb)-Max.CompJMax Ten,-All forces 250(ib)or less except when shown. TOP CHORD 1-2=-945/130,2-3=-731/169,3-4=-727/151,4-5=-798/116,6-7=285132 BOT CHORD 1-9=-1551586,8-9=-108/590,7-6=-109/588 WEBS 2-9=-2561155,3-9=131/509,4-9=-267/142,5-B=20/259,5-7=-8691125 NOTES- 1)Unbalanced roof live loads have been considered for this design, 2)Wind:ASCE 7-10;Vult=130mph(3-second gust)Vasd=103mph;TCDL=6 Opsf;BCDL=6,Opsf;h=25ft;B=45ft;L=24ft,eave=4ft;Catt Il;Exp B;enclosed;MWFRS(directional)and C-C Exterior(2)0-0-12 to 3-0-12,Inter:or(1)3-0-12 to 7-2-14,Extehor(2)7-2-14 to 10-2-14,Interior(1)12-0-9 to 14-4-8 zone;cantilever left and right exposed;end vertical left and right exposed;C-C for members and forces&MWFRS for•reactions shown;Lumber DOL=1 60 plate grip DOL=1.60 3)TCLL ASCE 7-10;Pr=30:0 psf(roof live load-Lumber DOL=1.15 Plate DOL=1x15);Pg=50.0 psf(ground snow):Pf=38 5 psf(flat roof snow.Lumber DOL=1,15 Plate DOL=1 15),Category Il;Exp B;Partially Exp,Ct=1-1,Lu=50-0-0 4)Provide adequate drainage to prevent water ponding. 5)This truss has been designed for a 10:0 psf bottom chord live load nonconcurrent with any other live loads OF,Ne 6)`This truss has been designed for a live load of 20.Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2- 0-0 wide JON ' 01 will fit between the bottom chord and any other members. 4� !� 7)Refer to girder(s)for truss to truss connections. 1 8)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift atjoint(s)7,1. 9)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 10)Graphical purlln representation does not depict the size or the orientation of the purlin along the top and/or bottom chord. Uj �0 4994 RpFES.S1fl�P- July 26,2019 ®WARNING-venty design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCEPAGE M11-7473 rev 1010312015 BEFORE USE. r gegtpbaid,for orta'cniyQlt SS,Ta 'oonnt clfii�Thud 7{pt In hasod 0IdjU#,h paiddiol0*sh6vuj.add is rot urmiriry Cori!buGdhtp Can findni,not, o kurs aytio�ri.0urmn ono.Uta hujidin¢tlnaylri:i moat vartry Ilio dn{�Uaflbintyat'deslOr pemm0tdra andtimpody inccrprrraldlh{a�ttis�ii'huo in ov0talllk,- tt q tstiildfliO daS(Dd:-(lrnelnD,ndimitidl0b plola.,l k0lfnp WricdOdtihi ifuas Web andrgr�*btd Inember>6ily.Add,W6traf lampor5ry and per+Uantinl bractnD. 1y,i�(VSI(- islilw7y'�rdgui[n{�r1Y�t71�6i}5d�f ru pr4NMrt C�fd{YJ'a wilb'paSSib(a pMGoeo{Hijuty and pr4n4�tydcmfrg2FQt,Qaneml ijaitlnnca,rdQnWh�f/ItiC - -- f06rip{lgp,5fosaga,dufly�rr�y:prociion ind bmc(ng of tru�lva and IfuSs syntvms.moo' ANStITPlt quality Grltario.DSB-89 and HOSI stiminD component g t6023 5H riDlvY d eo Rd_ Safetyinfonnation dvallitle tram Trims Plata lnal;talE-216 N.L eSr[aar,&ui�3t2,/UOxandia'.VA 22914: "' I Ct�Cstnrf l�ln 1,:063017 dub Truss Truis.Typt - Qty Ply BUILDING D ROOF VINEYARD VIEW 137938927 �3587DR3 T08 Root Speclal' 2 1 Job Reference(optional - tJnivorsal'Oolnpanenl CorD:, EAST HAVEN CT 06512— 8,U10 s Aug 1112017 MITek Industries,Inc, Thu Jul 25 23-15:49 2019 Page 1 ID uH81GgiAM9_WQEtKnavHVNyuWBg-RdgCwVQsOrDcUOrvPUznmDWwl7Xr75_DEC4tXeyuNSB 37-11, 4-2-14tl- f 14.5•'{2 I 3-7-11 - 3.7-3 4-2-4 3 D•10 44 = Scale 1/ 3 1 13 f 12.00 12 1x4 �� 11 14 6x6 = 4x4 = $ 2 5 10 17 8 18 7 19 3x8 II 6 3x8 = 4x4 = 1x4 II i 7-2-t4 11-5-1 T 2-14 A•2—i 3-0-10 Plate Offsets 9fX - _(t'Edoe 0-0.71 LOADING (psf) SPACING- 2-0-0 CSI. DEFL. in (]cc) Well Ltd PLATES GRIP TCLL(roof) 30.0 Plate Grip DOL 1.15 TC 0,40 Vert(LL) -0.24 1-8 >707 240 MT20 1971144 Snow(Pf/Pg) 38,5/50.0 Lumber DOL 1.15 BC 0,71 Vert(CT) -0.33 1-8 >526 160 TCDL 10.0 Rep Stress Incr YES WB 030 Horz(CT) 0,01 6 nla n/a BCLL 0•0 Code IBC2015ITP12014 Matrlx-S Weight,62 lb FT 20% BCDL 10:0 — - — LUMBER- _ BRACING- TOP CHORD 2x4 SPF No.2 TOP CHORD Structural wood sheathing directly applied or 5-94 cc purlins, BOT CHORD 2x4 SPF No.2 except end verticals,and 2-0-0 cc purlins(6.0-0 max.).4-5. WEBS 2x3 SPF No.2 BOT CHORD Rigid ceiling directly applied or 10-0-0 cc bracing. WEDGE Left 2x4 SPF No.2 REACTIONS. (Iblsize) 6=837/Mechanical,1=837/Mechanical Max Horz 1=210(LC 13) Max Uplift 6=37(1-C 14),1=-32(LC 14) FORCES. (lb)-Max.Comp./Max Ten.-All forces 250(ib)or less except when shown, TOP CHORD 1-2=-9431131,2-3=7291170,3-4=-7381138,4-5=-589/111,5-6=-8021127 BOT CHORD 1-8=-1 631586,7-8=1 23/607 WEBS 2-8=-253/153,3-8=-1091470,4-8=-257/130,4-7=-6301139,5-7=-1281888 NOTES- 1)Unbalanced roof live loads have been considered for this design_ 2)Wind;ASCE 7-10;Vult=130mph(3-second gust)Vasd=103mph;TCDL=6.Opsf,BCDL=6.Opsf;h=25ft,B=45ft,L=24ft;eave=4ft,Cat, ll;Exp B;enclosed;MWFRS(directional)and C-C Exterior(2)0-0-12 to 3-0-12,Interior(1)3-0-12 to 7-2-14,Extenor(2)7-2-14 to 10-2-14,Interior(1)11-5-1 to 14-4-8 zone,cantilever left and right exposed;end vertical left and right exposed,C-C for members and forces$MWFRS for reactions shown,Lumber DOL=1.60 plate grip DOL=1.60 3)TCLL.ASCE 7-10,Pr=30.0 psf(roof live load:Lumber DOL=1.15 Plate DOL=1.15);Pg=50.0 psf(ground snow);Pf=38.5 psf(flat roof snow Lumber DOL=1 15 Plate DOL=1 15);Category 11;Exp B;Partially Exp.;Ct=1.1,Lu=50-0-0 4)Provide adequate drainage to prevent water ponding, 5)This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads. !! of NESV 6)'This truss has been designed for a live load of 20.Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide .�V � p will fit between the bottom chord and any other members, 7)Refer to girder(s)for truss to truss connections. cc' 8)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 lb uplift atjoint(s)6,1. 9)This truss has been designed for a moving concentrated load of 250,01b live located at all mid panels and at all panel points along ,rem the Top Chord and Bottom Chord,nonconcurrent with any other live loads, f L kS/` Cc 10)Graphical purlin representation does not depict the size or the orientation of the purlin along the top and/or bottom chord, 4y�•099433 - v July 26,2019 ®WARNING-Verify design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE M11-7473 rev 1010312015 BEFORE USE pealgn vnfd ferw Doty velli,4fi7ul wfinectisra th�d�'pn is bss^d only n t n phmme[nx sh01m,anU la far an inc Mduai blip0ll cop�ilmpnl4 net i �+ afruasoyrtenntibrplousc„thehuUangdnsiggttymuPfvu /itmappU bllltyafiinslpnpnrimntUro-arliSpr+±pnriyfncpgrrpdagliadaFanIntotlwou�n;l t�,g Ilii hulltrinpdiaige-Srpahtpin$lP,aWtllslA;,mVOhlhuaYlltSgW1ut47uldUulauGawobmrUlnrAtordginrnnhrs3nnl�!AtldlUnnnitempor3ryarldAarmanilrdbrnctgp R ➢97@�TO�� fa o t+,y3 roqulmd fOYalnpdisy and t r riratrenfcol nrrm villi p-0a5Rdr!pemanN•injurynnd pre¢orty dart ago,Far gnncml g ltferutr ra ff v l n©rlur I fAWlPllan,alGrag,.doliru y.nrnr,6un and tx Cr j pt trurae3 Fnd uuus�ayala ria,seo. AttSVrP1/Quality Crilorin,DSB 89and BCS1 aulldtnp Component 16029 Svnngley Ridge Rd -.,,,Inin, iimtiun eVOit ahla Gam T.” F7nto,MPUtutn.2tp N.Loa SUcct,5uito3lZ,TirY,tandrin,VA?23t5, Chesterfield,MO 63017 Job f; russ Truss Type - 4ty Ply — BUILDING D ROOF VINEYARD VIEW 137938928 35970R3 09 Roof Special 2 1 Job Reference(optional) UnlWtsat Component Corp„ EAST;HAV_,EWCT-06512' -' 8.010 s Aug 11 2017 MiTek Industnes,Inc. Thtt;JI125 23.15:50 2019 Page 1 ID•uH81G9AM9 �NQEtKnaeHV4lyu%NBg-vgEbegRUm9LT6YQ5yBUOiR26YNt9sYUMTspR35yuNS7 3.7-11' �7-2-14- 10$10 14.5-12- 3447- 4x4 4.5-12- 14+12 4x4 Scale 1/4'=1' 3 12 � , 13 1 12,00 12 1x4 \\ 14 6x6 = 44 = 2 - 10 17 8 18 7 19 axe II 6 3x8 = 4x4 = 2x4 II I _-7 2�4. r 10.9c10 _ -_= - — 7-2=14 - — 3.612 358-3 —= 'Plato Oifuets(X;Y�'l:Eil a 0-0�7j_ _ _ -- LOADING (psf) SPACING- 2-0-0' CSI. DEFL. in (loc) I/dell L/d PLATES GRIP TCLL(roof) 30,0 Plate Grip DOL 1.15 TC 0,35 Vert(LL) -024 1-8 >723 240 MT20 1971144 Snow(PflPg) 38.5/500 Lumber DOL 1.15 BC 0,71 Vert(CT) -032 1-8 >532 180 BCLL TCDL 10,0 Rep Stress Incr YES WB 0,29 Horz(CT) 0.01 6 We We BCDL__ 10.0_• Code IBC2015rrP12014 Matrpx-S Weight_ 20% 63lb FT= LUMBER- BRACING- :HORD 2x4 SPF No.2 TOP CHORD Structural wood sheathing directly applied or 5-94 oc purlins, :HORD 2x4 SPF No.2 except end verticals,and 2-0-0 oc purlins(6-0-0 max.).4-5, 2x3 SPF No-2 BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing WEDGE Left,2x4 SPF No.2 REACTIONS. (Ib/size) 6=837/Mechanical,1=837/Mechanical Max Horz 1=218(LC 13) Max Uplift 6=-38(LC 14),1=-31(LG 14) FORCES. (lb)-Max Comp./Max.Ten-,-All forces 250(lb)or less except when shown. TOP CHORD 1-2=-943/133,2-3=-729/172,3-4=715/150,4-5=-567/117,5-6=7971141 BOT CHORD 1-8=-209/587,7-8=-131/582 WEBS 2-8=-256/156,3-8=-129/503,4-8=-260/131,4-7=-589/138,5-7=-1291841 NOTES- 1)Unbalanced roof live loads have been considered for this design. 2)Wind ASCE 7-10;Vult=130mph(3-second gust)Vesd=103mph;TCDL=6.Opsf;BCDL=6.Opsf;h=25ft;B=45ft,L=24ft;eave=4ft,Cat. 11;Exp B,enclosed,MWFRS(directional)and C-C Exterior(2)0-0-12 to 3-0-12,Interior(1)3-0-12 to 7-2-14,Exterior(2)7-2-14 to 10-2-14,Interior(1)10-9-10 to 144-8 zone;cantilever left and right exposed;end vertical left and right exposed;C-C for members and forces&MWFRS for reactions shown;Lumber DOL=1.60 plate grip DOL=1.60 3)TCLL.ASCE 7-10;Pr=30.0 psf(roof live load Lumber DOL=1.15 Plate DOL=1.15);Pg=50 0 psf(ground snow);Pf=38 5 psf(flat roof snow:Lumber DOL=1.15 Plate DOL=1 15);Category 11;Exp B;Partially Exp.Ct=1.1,Lu=50-0-0 4)Provide adequate drainage to prevent water ponding, 5)This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads. 6)`This truss has been designed for a live load of 20.Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide }% will fit between the bottom chord and any other members 7)Refer to girder(s)for truss to truss connections. SO 8)Provide mechanical connection(by others)of truss to bearing plate Capable of vnthstanding 100 Ib uplift at joints)6,1. 9)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. t-' - •' I , lr 10) Graphical purlln representation does not depict the size or the orientation of the purlin along the top and/or bottom chord. ei i 'W July 26,2019 ®WARNING-Verify design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE MII.7473 rev.IWOVIDf5 BEFORE USE. j 6 h muJ far risu oily Wiui rgi raf cpna[ for itdsdeslyh is bawd mIjdkh afamr rola dm«�,and ip_(Drttti'Indtviduni ttmidur camppnant,not 1'[race dyd•Jm;6pfnni,upu;ato,buildltlg apsl3narmauliry the npplfnnplNly pf dpsl0u pgnntetgra nRd pmpprlY inwrpnmtp otic dui�gn Itifp 1haa+pinll I �+ � buNdlnpdestgnrBnclnpl+tdG lndliet4pm�'mitUu' e4hhtdW(du[tltnt SYebntl A(AfsardmembersonJytldlUa+wttaitipatitryd08pdtnoannrdbrDEtr 1 MiTek,, Isuhvay�t'repo�rad'(cretohltlly!un�W'pipvenlcollWaewithpansa'1>to'pprepndlii�,,try,'andDropnrtYUnmafla.FargnnpmtpuldpnctimflaMctAlifu -- febdcnt[an,,atomge;dorrvnry;erngllon and bmdrip o1'hus a nna llu�ayatdai3,scr ANSI(TP,N.QupAly Gtllet{a+QSB•80 bnd BC$1_l9ulldM Component 16023 Swingley Ridge Rd 'Snrety,tnlomrntlan nanllGhh[eGamTrusa,PmletttGlllido:xldN;l:aoSltdnt,Suitc312,°f4rxpntlrip,yA22S1b; - Chester6eld,MO63017 Qty Ply BUILDING D ROOF VINEYARD VIEW ilob - russ ruSs;Type, I 137938929` f ' 35970R3 TIO RaofStieci©I, Z 1 _ _ __ _ _ _____ _____ I Job Reference_o ifcnal -universal Comporifml corp,, EAST HAVEN CT 06512 8.010 s Aug 112017 MIToklifdustlJes.We Thtl Jul 25 23 15:51 2019 Page 1' ID:uH81G9iAM9 WQEIKnavHVNyuWBg-NOozLAR6XSTKjI?HWv?FrebG9nDUb?kWIWZ_bXyuNS6 7-2-14 10.2.2 14=5.12 I I 3-7-11� 347 3 ( 2.11-4 4-3-11" — 4x4 = Scal f�3 P 13 12% 4x4 = 12.00 12 ,r�' 6x6 = 1x4 15 10 2 i , � a B �• v 16 0 17 7 10 3x6 I I 6 30 = 4x4 = 2x4 11 7-x-14- -- 10.2-2 W'-S-"1-7-2-14- Plate -2-14_Plate Offsets(X'Y)-= (11Edge Q U=7 - ------ _ - - - LOADING (psf) SPACING- 2-0-0 CSI. _ DEFL. in (loc) I/dell L/d PLATES GRIP TCLL(roof) 30.0 Plate Grip DOL 1,15 TC 0,42 Vert(LL) -0,23 1-8 >741 240 MT20 197/144 Snow(PUPg) 38.5150-0 Lumber DOL 1.15 BC 0,70 Vert(CT) -0 32 1-8 >541 180 TCDL 10.0 Rep Stress Incr YES WB 0.29 Horz(CT) 0.01 6 n/a n/a BCLL 0,0 I Code IBC2015/TP12014 Matrix-S Weight:65 lb FT 20% .BCDL 10.0_- LUMBER- BRACING- TOP CHORD 2x4 SPF No.2 TOP CHORD Structural wood sheathing directly applied or 5-9-5 oc purlins, BOT CHORD 2x4 SPF No.2 except end verticals,and 2-0-0 oc purlins(6-0-0 max.):4-5 WEBS 2x3 SPF No 2 BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing WEDGE Left-2x4 SPF No 2 REACTIONS. (Ib/size) 6=837/Mechanical,1=837/Mechanical Max Horz 1=225(LC 13) Max Uplift 6=-53(LC 11),1=-30(LC 14) FORCES. (lb)-Max.CompJMax.Ten.-All forces 250(lb)or less except when shown TOP CHORD 1-2=-9431134,2-3=-729/173,3-4=695/163,4-5=546/124.5-6=7931154 BOT CHORD 1-8=-234/588,7-8=-142/557 WEBS 2-8=-258/159,3-8=-150/540,4-8=2751137,4-7=-5541142,5-7=-135/798 NOTES- 1)Unbalanced roof live loads have been considered for this design, 2)Wind.ASCE 7-10;Vult=130mph(3-second gust)Vasd=103mph;TCDL=6,Opsf,BCDL=6,Opsf;h=25ft,B=45ft,L=24ft;eave=oft,Cat. 11,Exp B,enclosed,MWFRS(directional)and C-C Extencr(2)0-0-12 to 3-0-12.Interior(1)3-0-12 to 7-2-14,Extenor(2)7-2-14 to 10-2-2 zone;cantilever left and right exposed,end vertical left and right exposed,C-C for members and forces&MWFRS for reactions shown;Lumber DOL=1.60 plate grip DOL=1.60 3)TCLL ASCE 7-10,Pr=30.0 psf(roof live load Lumber DOL=1.15 Plate DOL=1.15);Pg=50.0 psf(ground snow),Pf=38.5 psf(fiat roof snow:Lumber DOL=1.15 Plate DOL=1.15);Category Il;Exp B;Partially Exp.,C1=1 1,Lu=50-0-0 4)Provide adequate drainage to prevent water ponding. 5)This truss has been designed for a 10,0 psf bottom chord live load nonconcurrent with any other live loads. OFAE�/�r 6)'This truss has been designed for a live load of 20.0psf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide P�4 will fit between the bottom chord and any other members 7)Refer to girder(s)for truss to truss connections. 8)Provide mechanical connection(by others)of truss to bearing plate capable of vothstanding 100 Ib uplift at jclnt(s)6,1. 9)This truss has been designed for a moving concentrated load of 250.0lb live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. . r5 10) Graphical purlin representation does not depict the size or the orientation of the purlin along the top and/or bottom chord, + r, LU O 09943 4, SSI�N� July 26,2019 ` WARNING-Verify design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE M11-7473 rev 1010312015 BEFORE USE Vimiaen vaBd for use cinlYmith M,T90=11icz6iOn is LnEed only upon para mothno nhtrym,and is for an individual building component,not A liuvs dyr lem Berorp u9P.the I&IdVig deal¢nos must von/y the'opo0cobllity of design parmiiiiidte and properly incorporate this design into the overall b11Jdln4doxtgn Bra clp8 Indicated r3 to gfovtiril huplitin g,lrxlividupi doss web and/or chord members only,Additional temporary and permanent bracing MiTek' ,s always required for stability and to prevent collapse with possible personal injury and property damage, For general guidance regarding the fabncation,storage,dolivorryy erection and bracing of trusses and truss systems,see ANSIrrPl1 Quality Criteria,OSB-69 end SCSI Building Component 16023 Swingley Ridge Rd safety Information nVaille from Truss Plate Institute,218 N Lee Street,Suite 312,Alexandria,VA 22314 Chesterfield,MO 63017 Job Truss Truss Type Ply 9191LD,G,D ROOF VINEYARD VIEW 137938930 3597083 T11 Roof Special 1 1 - _ -- UnlvMg_a1'Component Corp., EASTHAVEN'CT 06512-_ _ — - - 8.010 s Aug,11:2017 MiTek Industries,Inc. Thu Jul 25 23.15:52 2019 Page 1 ID uH81G91AM9 '11lQEtKnavHVNyuVVBg-rCMLYWSkimbBLsaU4cWUOsBPJAZQKRGfwAIY7zyuNS5 10�$ 3-7.11 7-2-14- 9-0.9, 14-5-12_- 10 4-11-3 - 44 = Scale 114"=1' 4 16 - j 12 6x6 x 4x4 = 6 12.00 12 \ =-_ 1x4 \ 11 14'15 t , i 3 �{ ; 1 {I j 10 2 f`�t 16 9 17 8 18 3x8 II 7 3x0 = 4x4 = 2x4 II 7-2-14 9:6.0 14-5-12 --•7-2 14"-- -2-3-11 Plate Offdels(X - LOADING (psf) SPACING- 2-0-0 CSI; DEFL. in (]cc) I/deft L/d PLATES GRIP TCLL(roof) 30.0 Plate Grip DOL 1,15 TC- 0,56 Vert(LL) -0.20 2-9 >839 240 MT20 197/144 Snow(Pf/Pg) 38.5/50.0 j' LumberDOL 1.15• BC 0.65 Vert(CT) -0,28 2-9 >614 180 TCDL 10.0 Rep Stress Incr YES WB 0,33 Horz(CT) 0.01 7 n/a n/a BCLL _BCDL___. 10.0 Code IBC2015fTPI2014 Matrix-S Weight'68 Ib FT=20%, LUMBER- - — - BRACING- - TOP CHORD 2x4 SPF No,2 TOP CHORD Structural wood sheathing directly applied or 5-11-2 cc purlins, )T CHORD 2x4 SPF Not except end verticals,and 2-0-0 cc purlins(6-0-0 max.):5-6 EBS 2x3 SPF No.2 BOT CHORD Rigid ceiling directly applied or 10-0-0 cc bracing EDGE Left'2x6 SPF No.2 REACTIONS. (Ib/size) 7=823/Mechanical,2=939/0-5-8 Max Horz 2=242(LC 13) Max Uplift 7=-72(LC 11),2=-65(LC 14) FORCES. (lb)-Max.CompJMax,Ten,-All forces 250(lb)or less except when shown, TOP CHORD 2-3=-938/122,3-4=-706/162.4-5=-661/166,5-6=-512/125,6-7=-775/167 BOT CHORD 2-9=-252/554,8-9=-154/621 WEBS 4-9=-1521550.5-9=-3081143,5-8=-501/151,6-8=-142/741 NOTES- 1)Unbalanced roof live loads have been considered for this design. 2)Wind ASCE 7-10;Vult=130mph(3-second gust)Vasd=ld3mph;TCDL=6-Opsf,BCDL=6.Opsf,h=25ft;B=45ft;L=24ft;eave=4ft;Cat Il;Exp B,enclosed;MWFRS(directorial)and C-C Extedor(2)-0-10-8 to 2-1-8,Interior(1)2-1-8 to 7-2-14,Exterior(2)7-2-14 to 9-6-9 zone;cantilever left and right exposed;end vertical left and right exposed,C-C for members and forces&MWFRS for reactions shown;Lumber DOL=1 60 plate grip DOL=1 60 3)TCLL:ASCE 7-10;Pr--30,0 psf(roof live load Lumber DOL=1-15 Plate DOL=1,15),Pg=50 0 psf(ground snow);Pf=38,5 psf(flat roof snow:Lumber DOL=1 15 Plate DOL=1.15),Category II;Exp B;Partially Exp.:Ct=1.1,Lu=50-0-0 4)This truss has been designed for greater of min roof live load of 12.0 psf or 100 times flat roof load of 38 5 psf on overhangs non-concurrent with other live loads, 11 OF E(� 5)Provide adequate drainage to prevent water ponding, 6)This truss has been designed for a 10,0 psf bottom chord live load nonconcurrent with any other live loads. �Q ,GVd J0 7).This truss has been designed for a live load of 20 Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide OQS will fit between the bottom chord and any other members B)Refer to girder(s)for truss to truss•connections- 9)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift atjoint(s)7. 10)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT atjt(s)2.This connection is for uplift only and does not consider lateral forces, 11)This truss has been designed for a moving concentrated load 6f 250.01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. '+ - 12)Graphical purlin representation does not depict the size or the orientation of the purlin along the top and/or bottom chord. �d' .0-99A July26,2019 ®WARNING-Verdy design parameters and READ NOTES ON THIS ANO INCLUDED MITEK REFERENCE PAGE 11,1II-7473 rev,1010312015 BEFORE USE E Gre:iu�iaUrl,rifru504 a ah lhTp ctpi0tic[a+a.1{7R tlesfpri is ha?gJc[t[y up pararianar4 Wrnwn,and la lor,ml 1nCiv;ddatttnlldtng CanywnPn4vu nab g a(ruKd'nya[dni:p®[mousa.lfol,huiMlag',dui+rJnermdt[varityShnnPp11ca1I4Cyefdcai�.ipsmmnftr�m8,proledyulcar`p0ra[u[U{edarl; nynLdortiaor,ril I 1m7dYnQdaofpn.'8rsitJltp�tndleat�dirtoprr.�rnh[isucNllnp'a!Irvf/Iduhl[nld4wdbnn'd<areliwdmaylfihr:on[y.AddiGanal[amperntynn�ptrrmlu[cnlEriitlny, u u[uay t rzy0iroil[sir slaUllf[y aril[to pYaV n[[allDmxsvalU pasaliln pa.atnnt Nryv ry NNl properly dumapa.Fpr grit mal pvidmer ropt�vlg 16023 faEN[Ga[[hnr G lonpa,del[{arrYy o aGplin�Hd b'rdnpu[Uitss�s Id [riivs ayL(�rg6,a9n., n[tS[/rp11 QUdlhylCol[er[n,OSB 80 atu16C3i 8ui[dllla Component I Slvingley Ridge Rd Snlaty Idfommilon RvallahlaL.TruasPtO.[naWulo:216 N:L'CO Stto41:5n1ta312,A�eXand{to;VA 229id,, �, Chesterfeld,M0 63017 - -- - - dpu Truss russTyt -- - i 4ty P{Y i 9UILDItIG D ROOF VINEYARD VJEW 137936931 35970R3 r12 Roo-Special 1 1 Jn6Refer`ence'fnp{{opal - Universal Component"Carp, EAST HAVEN CT 015 2 -- ` -8,Oii7 s Aug 11 2017 MTek Industries;Inc TI1u'Jul 25 23 15 53 2019'Psrge'1 -- _ ID:uHeIG9iAM9_WOEtKnavHVNyuWBgJPvjmsTM34k2z09geJ1jv✓dgWXavp2tdp9g25gQyuNS4 7-2-14 Scale.//4"=1' 4x4 4 OxG. .14 5a 0_ 12,00 12 i 1x4 3, t 10, w 1 15 9 16 B 17 7 "3x6 II 4x4 II 3X6 = 4x4 = 7-2-14 691.9` tA•5 32- - -- "'714`` ;"-1=8-3 ate QlFseL (X;YI= .'f2Edpa,O�U 45'.0 3=0'0-3 :Eda� Pl0=28 -- --- - - _ LOADING (psf) DEFL. In loc I/deft Ud PLATES GRIP TCLL(roof) 30.0 SPACING- 2-0-0 CSI. ( ) Snow(Pr/Pg) 38;5!50 0 ; Plate Grip DOL 1.15 TC 0.131 Vert(LL) -0.20 2-9 >866 240 MT20 197!144 Lumber DOL 1.15 ` BC 0.64 1 Vert(CT) -0.27 2-9 >632 180 TCDL 10.0 Rep Stress Incr .YES WB 0.39 Horz(CT) 0,01 7 n/a n/a BCLL 0.0 Code IBC20151TP12014 Matrk-S Weight*70 Ib FT=20% - - — --- LUMBER- BRACING- TOPCHORD 2x4 SPF No,2 TOP CHORD Structural wood sheathing directly applied or 5-11-2 cc purlins, BOT CHORD 2x4 SPF No:2' except end verticals,and 2-0-0 oc purlins(5-10-6 max.):5-6. WEBS 2x3 SPF NoZ BOT CHORD Rigid ceiling directly applted'or 10-0-0 cc bracing, WEDGE Left:2x6 SPF No.2 REACTIONS. (1b/size) 7=823/Mechanical,2=939/0-5-8 Max Horz 2=250(LC 13) Max Uplift 7=-89(LC 11),2=-64(LC 14) FORCES. (lb)-Max.Comp./Max Ten.-All forces 250(lb)or less except when shown. TOP CHORD 2-3=-938/120,3-4=-706/159,4-5=-6601178,5-6=-4g0/132,6-7=-771/182 BOT CHORD 2-9=-274/555.8-9=-1701497 WEBS 4-9=-169/610,5-9=-357/155,5-8=-469/165,6-8=-154/703 NOTES- 1)",llnbalncgd roof;Ilv ')4ads'IiaYe-besircori�'{derad'fa?,lh}s�leslgn. 2)'�Vjnd;I4SCE 7=t0;VuJtC1'�9mli,(3jSecone!gysty;Vasd=ili3mphTCi?L-6 Opsf{®CDL=6,Opst,li1=25ft;;B=45it,L=21ff=e8ve=oft Cat li;=Exp 6;`endosed;MWFRS{diiacltonel)and GCKteHoi(7.j-ti-1d 8 to'2=1-a,)ntedor(1)2=118,'ft;7-2 I4;Exterior(2)7 2-i4 to 8=11-1 zone;cantilever left and right exposed;end vertical left and right e>SpOSdd;C-C(or ntemb�rs:adtl foices&',MW_FRS fob reactl�3nG shown;Lumber DOL=1.60 plate grip DOL--1.60 3)TCLL:ASCE 7-10;Pr--30.0 psf(roof live load:Lumber DOL--1 15 Plate DOL=1,15);Pg=50.0 psf(ground snow);Pf=38.5 psf(flat roof snow.Lumber DOL=1.15 Plate DOL=1.15);Category II;'Exp B;Partially Exp.;Ct=1,1,Lu=50-0-0 4)This truss has been designed for greater of min roof live load of 12.0 psf or 1 rop bmes'flat roof load of 38.5 psf on overhangs non-concurrent with other live loads. 5)Provido.idaquatit d'ralnapo to prevent wit@T potjding 6)This truss has been,deslgned for a 10.0 psi bgttgir chord Ilve,loiid ngtjconcurrentwith any other live loads 7)`This trbss Iias been designed for a live load df 20:Opsf on the bottomchord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide will fit between the boftom chord and any other members. �� 4. , 8)R ale tt5 gETder{s)'itar!rugs to 1rIIs5 connewons. v , 9)Proylde iriec}t�glcal;contieciinri`(by;o{h�+is)of truss to bearing plate capable of withstanding 100"Ib uplift at joint(s)7 IFt, R 10);�Jnt FtT4 USP,connecto{s to iatnit?t?ndoS!to connect truss to bearing walls due to UPLIFT at 11(s)2.This connection is for uplift only nr< I . Lu ' and does not consider lateral forces. 11)This truss has been designed fora moving concentrated load of 250.O1b IIve located at all mid panels and at'all panel points along ��. �O• '� _�. the Top Chord and Bottom Chord,nonconcurrent with any other live't�ad5;. * ,' 12)Graphical purlin representation does not depict the size or the bnentaifon fthe purlm along the top and/or bottom chord. July 26,2019 ®WARNING-Verify design parameters and READ NDTE&ON THISAND INCLUDED MITEK REFERENCE PAGE MIJ-7473 rev.10MM015 BEFORE USE ty' odrrishllam,hntllafOrtl,i"lntll+ifdaat'tmT;dfnycotr+pmtanl,nnT t p0atgn'vnfidtarUaa,an t+!thl�Tri►Abonulrcltus7fitadesipriiarutsn90idyupanparom: - a}fu65 eyaFOm„a0/ain ulSa.tirq tlulldUty dn&Iy+101 muaiVOtriy tlla Appit��flSl�,of�aGl�RRro��,�ropOr0yf1%SRI}�otll l�IiG ItCSttlllilptli lito,9vCF�,+�f; WOW� I h Ingda,;fOn. raclnpindn1od181nTtn'!�ttthaLftttnpGtf4nsRvlOaaltruarrv+ukand+a^c?atdm0tnbafdanta,AtltlluotlGlttlrji&rrsndptgrnantlnttiUietnp ip!�� faa 0yat4quGadloretu1t11dlymhd'tuFfiCvaMan110{�3BwIlN(VDSsi�'ap-:�NogOl,inJurynndfimpgttydnn�nila�',t;arigonomtguiclammr�,jnrqutgltio-.,.- fnLrtroCign,.a!om0e;,dallvprya+act,0aa(rdbmclriaorfruz�eesanuliuss5�sioms,�,ad '- ANSI{TPHGualllyCdteriti;DSB•SOntid8Cs18uRdingComponent CheseAieldg1M06301Rd su/oty,lnTatmadan hvallnYllofrnnr.7'kisdsrMuYu”iaautulu.2lsN:t.oa';irr+pCSpifosl2.itCas{im,Artg�VA2c�.Sd.".' _ -- - - _ - _ _ - — Job --,Truss- TFus"s;Type' Ory Ply BUILDING'S] ROOF VINEYARD VIEW 137938932 3597OR3 13 RoDtSpec(al 1 ; 1 Job Refbrariea ioptldriltl)_ -- Universal Component Cd1>r• ----'EAST IgAVEN_"CT 06512 8.010 s Aug'11 2017 MITek Industries,Inc, Thu Jul 25 23:15.55 2019 Pege,1 ID uH81G91AM9,WQEtKnayKVNyuWBg-Gn1 UBYVdbh_ICJJ3lk3B7UmrIOcRWma5d8XCklyuNS2 '104 3:7-11 _ --___7-2-13' __� .f0, 14-5-12 0404 3-7-11• I 3-7-31 012 6-2=3 -- 4x4 = Scale-1/4"=1' 4 13 5x8 \\ 4x4 URI 12 12.00 F12_ / s 3, �./• i I m 10 i �{ 15 16 17 18 3x8 II 8 7 3x8 = 4x4 = 4x4 II -7-2-14 — - 3=10 14.5-1?. _ .7-2.14 011 6-2-3 ,; Plate Oftsels_-(X,Y)-- f 2:Edge 0-Q-7),(5:0.4.0,0=2-61 LOADING (psf) TCLL(roof) 30.0 SPACING- 2-0-0 CSI. DEFL. In (loc) Well L/d PLATES GRIP Snow(Pf/Pg) 38,5160 0 Plate Grip DOL 1,15 TC 0.86 Vert(LL) -0.19 2-9 >891 240 MT20 197/144 TCDL 10,0 Lumber DOL 1 15 BC 0-63 Vert(CT) -0 26 2-9 >652 180 BCLL 0.0 Rep Stress Incr YES WB 049 Horz(CT) 0.01 7 n/a n/a BOOL 10:0 Code IBC20151TPI2014 Matrlx-S Weight 72 lb FT 20% LUMBER- BRACING- TOP CHORD 2x4 SPF No.2 TOP CHORD Structural wood sheathing directly applied or 5-11-1 oc purlins, �T CHORD 2x4 SPF Not except end verticals,and 2-0-0 oc purlins(4-1-0 max,) 5-6 BS 2x3 SPF No-2 BOT CHORD Rigid ceding directly applied or 10-0-0 oc bracing. DGE WEBS 1 Row at midpt 6-7 Left,2x6 SPF No 2 REACTIONS. (Ib/size) 7=823/Mechanical,2=939/0-5-8 Max Harz 2=257(LC 13) Max Uplift 7=-106(LC 11),2=-62(LC 14) FORCES. (lb)-Max.Comp/Max Ten.-All forces 250(lb)or less except when shown. TOP CHORD 2-3=-938/118,3-4=706/157,4-5=676/188,5-6=-467/139,6-7=768/198 BOT CHORD 2-9=-295/560,8-9=-187/471 WEBS 4-9=1811690,5-9=-463/166,5-8=-436/185,6-8=-1691663 NOTES- 1)Unbalanced roof live loads have been considered for this design 2)Wind.ASCE 7-10;Vult=130mph(3-second gust)Vasd=103mph;TCDL=6,Opsf;BCDL=6.Opsf,h=25ft;B=45ft,L=24ft;eave=oft,Cat, ll;Exp B,enclosed,MWFRS(directional)and C-C Exterior(2)-0-10-8 to 2-1-8,Interior(1)2-1-8 to 7-2-14,Extedor(2)7-2-14 to 8-3-10 zone,cantilever left and right exposed;end vertical left and right exposed;C-C for members and forces&MWFRS for reactions shown;Lumber DOL=1.60 plate grip DOL=1 60 3)TCLL ASCE 7-10,Pr=30.0 psf(roof live load:Lumber DOL=1,15 Plate DOL=1.15),Pg=50,0 psf(ground snow),Pf=38.5 psf(flat roof snow,Lumber DOL=1.15 Plate DOL=1.15);Category'll,Exp B;Partially Exp;Ct=1 1,Lu=50-0-0 4)This truss has been designed for greater of min roof live load of 12,0 psf or 1.00 times flat roof load of 38 5 psf on overhangs non-concurrent with other live loads. 5)Provide adequate drainaqe to prevent water ponding. �V 6)This truss has been designed for a 10,.0 psf bottom chord live load nonconcurrent with any other live loads. �P� fG1f t) :1Qfy 7)'This truss has been designed for a live load of 20.Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide, y�1 will fit between the bottom chord and any other members,with BCDL=10.0psf. 8)Refer to girder(s)for truss to truss connections, " 9)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift atjoint(s)except tit=1b) 7=106, 10)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT at jt(s)2.This connection is for uplift only and does not consider lateral forces Z Naesta' 11)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 12)Graphical purlin representation does not depict the size or the orientation of the puffin along the top and/or bottom chord. RO��ssio�� July 26,2019 &WARNING-Verify design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE 6111-7473 rev.10/03/2015 BEFORE USE. Design valid for use only with MiTek®connectors:This design Is based only upon parameters shown,and Is for an individual building component,not t a truss system,Before use,the bulldmg de-4911 f must verify the applicability of design paramelers and property Incorporate this design Into the overall �r• t�tt- ' bulldmg design Bracing indicated is to provgnflwckimg of individual truss web and/or chord members only.Additional temporary and permanent bracing 1�lQf is always required for stability and to prevent collapse with possible personal injury and property damage,For general guidance regarding the �p Svcltwl fabrication,storage,delivery,erection and bracing of trusses and truss systems,see ANSIrfPlt Quality Criteria,DSB-89 and BCSI Building Component 16023 Swingiey Ridge Rd Safety Information available from Truss Plate Institute,218 N Lee Sireel,Suite 312,Alexandria,VA 22314 Chesterfield,MO 63017 Job - - russ - — Truss Type - Qty Ply BUILQING D ROOF VINEYARD VIEW ` 137936933 35970R3 14 Roof Special 1 ! 1 ljn6 Reference o tior{01 -UniveraaLCompon ant Corp., EAST HAVEN CT 06512' 8.010 s Aug 11 2017 MiTek Industries,Inr, Thu Jul 25 23 15.56 2019 Page 1 ID uH81G91AM9_WQEtKnavHVNyuWBg-k_bsOuVFM?6cgTtFJSbQY112nowBFC7FroGIGlyuNS1 0.10• 3-7.11 7.2-14 7g? _.1h•3•t2 10 3 7•Ui —r-- 3-7-3 Q 5 Scale=14- 6x6 4^6x6 4 6x8 4x4 II 11 'r� r•�� lJ 121111 f [121.4 + 14 8 - 15 7' '3x8 11 4x4 4x4 = = 7-8.214-5.12 7-B 2 Plate,,Oltsets( Y L, 2:E4g 0 4.7} AF-dAd,.0-2.8j.[6'Edge,0-2-13 LOADING (psf) SPACING- 2-0-0 CSL DEFL. In (loc) I/deft L/d PLATES GRIP TCLL(roof) 300 Plate Grip DOL 1,15 TC 0.75 Vert(ILL) -0.28 2-8 >603 240 MT20 197/144 Snow(Pf/Pg) 38.5150 0 Lumber DOL 1.15 BC 03 Vett(CT) -0 37 2-8 >462 180 TCDL 10.0 Rep Stress Incr YES WB 0,53 Horz(CT) 0,01 7 n/a n/a BCLL O.0Code IBC2015/TPI2014 Matrirc-S Weight,63 lb FT 20% BCDL 10.0_ LUMBER- BRACING- TOP CHORD 2x4 SPF No.2'Except* TOP CHORD Structural wood sheathing directly applied or 5-8-15 oc purlins, 5-6 2x4 SPF 210OF 1 BE except end verticals,and 2-0-0 oc purlins(6-0-0 max.)'5-6. BOT CHORD 2x4 SPF No.2 BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing. WEBS 2x3 SPF No,2 WEBS 1 Row at midpl 5-7 WEDGE Left:2x6 SPF No.2 REACTIONS. (Ib/size) 7=823/Mechanical,2=939/0-5-8 Max Horz 2=265(LC 13) Max Uplift 7=-124(LC 11),2=-60(LC 14) FORCES (lb)-Max,CompJMax Ten,-Alt forces 250(lb)or less except when shown. TOP CHORD 2-3=-922/115,3-4=-681/148,6-7=332/90 BOT CHORD 2-8=-311/567,7-8=-203/457 WEBS 5-8=0/406,5-7=-618/187 NOTES- 1)Unbalanced roof live loads have been considered for this design. 2)Wind.ASCE 7-10;Vult=130mph(3-second gust)Vasd=103mph,TCDL=6.Opsf;BCDL=6 Opsf;h=25ft,B=46ft,L=24ft;eave=oft;Cat, II,Exp B,enclosed;MWFRS(directional)and C-C Exterior(2)-0-10-6 to 2-1-8,fnterior(1)2-1-8 to 7-2-14,Exterror(2)7-2-14 to 7-8-2 zone,cantilever left and right exposed,end vertical left and right exposed;C-C for members and forces&MWFRS for reactions shown,Lumber DOL=1.60 plate grip DOL=1.60 3)TCLL ASCE 7-10,Pr-30 0 psf(roof live load'Lumber DOL=1.15 Plate DOL=1.15),Pg=50.0 psf(ground snow);Pf=38 5 psf(flat roof snow Lumber DOL=1.15 Plate DOL=1 15);Category ll,Exp B,Partially Exp.:Ct=1.1,Lu=50-0-0 4)This truss has been designed for greater of min roof live load of 12,0 psf or 100 times flat roof load of 38 5 psf on overhangs ��pF NJ �Pjt non-concurrent with other live loads, j0,Iy 0� 5)Provide adequate drainage to prevent water ponding, fi)' 6)This truss has been designed for a 10 0 psf bottom chord live load nonconcurrent with any other live loads 7)'This truss has been designed for a live load of 20 Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide # 4 `4t"- O•� voll fit between the bottom chord and any other members,with BCDL=1O.Opsf. 177 8)Refer to girder(s)for truss to truss connections, ' 9)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift atjoint(s)except Qt=1b) 7=124a�Yrao Z 10)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT atjt(s)2.This connection is for uplift only and does not consider lateral forces: 11)Thfs truss has been designed fora moving concentrated toad of250,0(b five located at alf mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads,, `90pSrv�pN�' 12)Graphical purlin representation does not depict the size or the orientation of the purlin along the top and/or bottom chord. July 26,2019 ®WARNING-Verity design parameters and READ NOTES ON THIS AND INCLUDED 411TEK REFERENCE PAGE MII.7473 rev.10/03/2045 BEFORE USE m4!ti fOr an!!idlyw_r M iilx nn tnh m,tnni,nyt ! i1�4 anwltfcfv:r�a„t�;ti„,.,MTakrr ;,i, ? nirL1SG$yGtnn+.aQtbFo uca„uio baliding il0$IgnOrnHlst`1or11yy alit appflral,'Itltypfdagirin punmeinre npd prgporryYtn.urpornln thin dnr.lflninlo,tlle avntdll tralWigp design,ara »0 alud to prCvnht 6irekfipQ oh+ntAvklunl vu1S watxrindrnr rix+cJ irsmtu ra ally,Additional tanQora,y rind p trmo lent hr%sing, �Vi elk! lg always rory0ired lar o1i1171111y and to iiruJanl collnprai wOh e�xsii:te pnraonal i.spyy and propaily dnrnpgn”FOr ilt i lit guidOn4+tregs rid S th0 t ifgiWiCnttgn,st}}rnge:ifaiivorl,eronlrYan nnf3 txpdrip of(rU— ntld UuIri syal0Vnc1 Scar, AHatrfPit plfarfty,C1{tada}D90-6_138nd BCb1 9uNdlnp Gornponont 16023 Swingley Ridge Rd tislely lNolnfltdon nvnitahla fmrnXiusa Plotef ln.,Ofu1o: 18N,S.nn Strant;Ew.31R,`Nrrxpndila,VA 22a1d: chesterfield, ----- 7 Job cuss - rtigs'7yp$ 1 ty Ply ;BUILDING D'ROOF VINEYARD VIEW 137938934 3597OR3 15 Roof Special 1 1 -- - _ ob Raftltence+, libiriall ---- -—- Unlversai Component Corp., EAST HAVEN CT 05512 — _- ` '— 8,010s'Aug,11-201,7 tdi dk Industries,Inc,Thu Jul 2523:15:57 2019'Page 1' - ID uHBIG91AM9 WQEtKnavH1!NyuWBg-CA9EcEWt71ETRdSRt96f5vrHFBIC_gUO4S0JpByuNSO 10-2-13 11114h- 344L---_-_ -... --07=11 _ 6-•7 '8•F-lU 145,17I -10$` ;f-0•g` 3-1.2 2.4-12 1-0-3 T+ ----4-2-15 -- 4x4 = Scale:1/4"=V 5x10 — 0- 6x8 — 4x4 11 - 6x6 = 717 _ 10 15 _ 12,00 12 1x4 \\ 4 CI N a 13 14 2 j �` , 20 12 21 t1 22 10 23 3x6 I I 9 3x8 1x4 II 3x8 = 4x6 = 8.74 -10%213 r' 14-5-12 -- — - 6=2-11. - --24-12 1-7-6--`- 4•-2.15, Plate Olfsels'(X_Y) �2Edjie 0 4• , 4j•Q•4.3,Edge1 [7'0.3 t,Edge3t(S:Edgo 0 2-SJ _ - -- LOADING {psf) SPACING- 2-0-0 CSI. DEFL. in (loc) I/deft L/d PLATES GRIP TCLL(roof) 30.0 Plate Grip DOL 1,15 i TC 0,51 Vert(LL) -0,13 2-12 >999 240 MT20 1971144 Snow(PfIPg) 38,5/50.0 Lumber DOL 1.15 BC 0,55 Vert(CT) -0,18 2-12 >965 180 TCDL 10.0 Rep Stress Incr YES WB 046 Horz(CT) 0,01 9 n/a n/a BCLL 0.0 ' BCDL Code IBC2015/TP12014 Matrix-S Weight 87 Ib FT=20% _ _ 10 0 - LUMBER- - _- _ ' BRACING- " CHORD 2x4 SPF No.2 TOP CHORD Structural wood sheathing directly applied or 5-11-12 cc purlins, CHORD 2x4 SPF No.2 except end verticals,and 2-0-0 cc pudins(6-0-0 max) 4-5,7-8 -.is 2x3 SPF No.2 BOT CHORD Rigid ceiling directly applied or 10-0-0 cc bracing, WEDGE WEBS 1 Row at midpt 7-9 Left-2x6 SPF No.2 REACTIONS. (Ib/size) 9=823/Mechanical,2=93910-5-8 Max Horz 2=263(LC 13) Max Uplift 9=-113(LC 11),2=-51(LC 14) FORCES. (lb)-Max Comp./Max.Ten.-All forces 250(Ib)or less except when shown-, TOP CHORD 2-3=-949/126,3-4=-7461158,4-5=-451/148,5-6=-433/179,6-7=508/174,8-9=-290/69 BOT CHORD 2-12=-326/564,11-12=-197/424,10-11=-196/425,9-10=-1661360 WEBS 5-10=428/151,6-10=-171/494,7-9=-692/182 NOTES- 1)Unbalanced roof live loads have been considered forthis design, 2)Wind.ASCE 7-10;Vult=130mph(3-second gust)Vasd=103mph,TCDL=6.Opsf,BCDL=6,Opsf,h=25ft,B=45ft;L=24ft;eave=4ft;Cat- II;Exp B,enclosed;MWFRS(directional)and C-C Exterior(2)-0-10-B to 2-1-8,Interlor(1)2-1-8 to 6-2-11,Exterior(2)6-2-11 to 10-2-13,Intedor(1)10-2-13 to 14-4-8 zone,cantilever left and right exposed;end vertical left and right exposed;C-C for members and forces&MWFRS for reactions shown,Lumber DOL=1.60 plate gnp DOL=1.60 3)TCLL:ASCE 7-10;Pr=30.0 psf(roof live load:Lumber DOL=1.15 Plate DOL=1.15);Pg=50 0 psf(ground snow);Pf=38 5 psf(flat roof snow:Lumber DOL=1.15 Plate DOL=1.15);Category II;Exp B,Partially Exp.;Ct=1.1,Lu=50-0-0 4)This truss has been designed for greater of min roof live load of 12,0 psf or 1 00 times flat roof load of 38 5 psf on overhangs, non-concurrent with other live loads, 5)Provide adequate drainage to prevent water ponding f 6)This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads, 7)'This truss has been designed for a live load of 20,Opsf on the bottom chord In all areas where a rectangle 3-6-0 tall by 2-0-0 wide will fit between the bottom chord and any other members, 8)Refer to girder(s)for truss to truss connections-, 9)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift at Joint(s)except Qt=1b) { • CC 9=113. 10)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT at Jt(s)2.This connection is for uplift only and does not consider lateral forces, `a rirtlk 11)This truss has been designed for a moving concentrated load of 250,01b live located at all mid panels and at all panel points along O- s,� � the Top Chord and Bottom Chord,nonconcurrent with any other live loads, 12)Graphical purlln representation does not depict the size or the orientation of the purlin along the top and/or bottom chord, rQ0 �L Fj SS July 26,2019 ®WARNING-Verify design parameters and READ NOTES ON THIS AND INCLUDED Mi7EK REFERENCE PAGE 6111.7473 rev 1010312015 BEFORE USE P Qdl(In,retlrtl4tase:cnly,wtlhtM-fah�iowlRed^r T[dsdc56gntshtiscdocily0ponperantatuenuhwvlf,nndtafprnntntlt�idllblbuldingcpmpono>tl,npt =tr 1+Ud&ayaloln:0>jfblv'uae;lito gUti Ynn doe gear inuat vntify,ihn apnitpa5itity,cC dattgn pnrnrnnta'rn and'prgpnr y inr�,tpceeEm lirin rtni It l lnla Ih0'tivern6 11"a deer r-BrhaingllM'rratellINto0MV4101butkflrrd11 ndlvldOnlwsMbtut cr2haldmombar3only;Adtlillpirnitampaloryl8(dpalnteno0l'bracing ��@it la atW0y3 togelmd farnlablllly and 10 Pruh/enl GOIIOpfi[r V%ilti Pc3fiihlit pOGui?01 inlluygrl0 propGtty damgge Feraonemt gvldnncc re�atN:pg IIVa (Otx1r,14tan,ptora0e:dglltiary,arorJlpn and tx dilp ut1r11sa0s 1pddrpitsaysl4tna,s•0 ARS1fiPlt'RUaUIy Cri16d0 DS&8A and EC6[Bu11d1e1p Gamponent 16023 Swingley R dge Rd 8alaty btformatton_uviil1ab10 Y.dm Trusr.Ptn Iretiiuro.210 N.:Ltia SiteOt,Sultn 317.Nnxpndrm,VA 22314; - = Chesterfield,MO 63017 Qty Ply VINEYARD VIEW Titiss ruicsType BUILDING D�R0131" " 137938935 TIO Roof Special I I 7 M i re-k '59,'2019 P119- �.01 0 a Aug 11201 Industries,Inc. Th.Jul 25 2�1�5 'U"Iyarsal Component Corp„ EAST HAVEN CT 06512 - H 113,uHSIG9IA1419 LVV.QE'=f0-1D•5 tI1t,9aVHVNyUW@I3 8Z,_qr,VY7%,U8 9-7-10 4-10-11 -Z-4-j2 Z-1-;j _�2-11 3-7-7 Scale*V 4X4 186X6 4X4 11 5x6 = 15 5x6 12.00 12 13 LJ '_ 12 t. 2 21 22 19 11 20 10 9 8 UB li IM 11 4x4 = 3x8 = 4x4 A-10.11 K73,7 14-5-12 _�_= -3-6-14 J.? Plate OlrtetaLX y):.�2 'Q .2-8 _0 - LOADING'(psf) SPACING- 2-0-0 CS11 DEFL. In (loc) 11defi L/d PLATES GRIP TCLL(roof) 30.0 Plate Grip DOL 1.15 TC 0,44 Vert(LL) -0,07 2-11 >999 240 MT20 197/144 Snow(PfjPg) 38.5/50.0 Lumber DOL 1.15 BC 0.42 Vert(CT) -009 2-11 >999 180 TCDL 1010 89 /a n/a Rep Stress Incr YES WB 0.89 Harz(CT) 0,01 8 n tr Weight.78 lb Fr 20% SCILL 0.0 12 X_S Code IBC20151TP 014 CSL LUMBRACING- BER- TOP CHORD Structural wood sheathing directly applied or 5-2-10 oc purlins, TOPCHORD 2x4SPFNo2 except end verticals,and 2-0-0 oc purlins(6-0-0 max,)'3-4,6-7. BOT CHORD 2x4 SPF No.2 WEBS 2x3 SPF No.2 BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing. WEDGE Left:2X6 SPF No 2 REACTIONS. (lb/size) 8=823/Mechanical,2=93910-5-8 Max Horz 2=256(LC 13) Max Uplift 8=89(LC 11),2=-62(LC 14) FORCES. (lb)-Max.CompJMax.Ten,-All forces 250(lb)or less except when shown. TOP CHORD 2-3=953/121,3-4=-562/145,4-5=-4611165,5-6=-548J213,7-8=-284162 BOT CHORD 2-11=-258/525,10-11=-2681523,9-1 O=2161563,8-9=-148/353 WEBS 3-11=0/333,4-9=-499/125,5-9=-2061469,6-8=-717/169 NOTES- 1)Unbalanced roof live loads have been considered for this design, 2)Wind:ASCE 7-10:Vult=1 30mph(3-second gust)Vasd=1 03mph,TCDL=6..Opsf,BCDL=6,opsf,h=25ft;B=45ft;L=24ft,eave=4ft;Cat. 11;Exp B,enclosed;MWFRS;(directional)and C-C Extedor(2)-0-10-8 to 2-1-8,Intenor(l)2-1-8 to 4-10-11,Exterior(2)4-10-11 to 10-10-5,Interior(1)10-10-5 to 14-4-8 zone;cantilever left and right exposed;end vertical left and right exposed;C-C for members and forces&MWFRS for reactions shown;Lumber DOL=1.60 plate grip DOL=1.60 3)TCLL:ASCE 7-10;Pr=30.0 psf(roof live load:Lumber DOL=1.1 5 Plate DOL=1.1 5):Pg=50 0 psf(ground snow),Pf--38.5 psf(flat roof snow.Lumber D0L=1 15 Plate DOL=1.15);Category 11,Exp B:Parbally Exp;Ct=1.1,Lu=50-0-0 4)This truss has been designed for greater of min roof live load of 12.0 psf or 1.00 times flat roof load of 38.5 psf on overhangs non-concurrent with other live loads, of NE j. 5)Provide adequate drainage to prevent water ponding nconcurrent with any other live loads. 0 6)This truss has been designed for a 10.0 psf bottom chard live load no -0 tail by 2-0-0 wide 7)*This truss has been derigned for a live load of 20 opst on the bottom chord in all areas where a rectangle 3-6 will fit between the bottom Chord and any other members. Ar 1r, 8)Refer to girder(s)for truss to truss connections. a g 9)Provide mechanical connection(by others)of truss to bearing plate capable ofwithst withstanding 100 lb uplift at joint(s)8.action is for uplift only 10)One RT4'USP connectors recommended to connect truss to bearing walls due to UPLIFT at jt(s)2.This conn r and does not consider lateral forces. I mid panels and at all panel points along _r 11)This truss has been designed for a moving concentrated load of 250.Olb live located at al �N the Top Chord and Bottom Chord,nonconcurrent with any other live loads. chard. 019914'6 12)Graphical puffin representation does not depict the size or the orientation of the purlin along the top and/or bottom 1��OPP slo July 26,2019 ®WARNING-V.nfy design parameters and READ NOTES ON THIS AND INCLUDED VITEK REFERENCE PAGE MU-7473 rev,f0/03/2015 BEFORE USE, CaslQnvii" , 1 - - ndamn Bloc !#A MiTek' q Venoml ity 1 023 swinglay Ndge Rd Satoly 'j"fle d�j�, a Chesterfield,NO 83017 an nalf b Job -- riiss"--- - ^` Truss Type' "` Qty Pty BUILDING ROOF VINEYARD VIEW' 137938936 95970R3 T17 i Roof Special 1 1, Jab Reference[atiafial}.- Unlversal Component Corp:,---EAS•TMAVEN.CT 06512;- ` 8.010 s Aug 11 2017 MiTek In(lustrles,lnc.,Thu J6125 23 16'00 2019 Pagel ID.uH8IG9iAM9_WQEtKnavHVNyuWBg-clrNEFYmQDc214BOYIfMiYfpFPL1 BzygmPEzPWyuNRz 0 i0•g 9-6-11 - 5.11-7 __ j_17.t0'- 11-5 13 td-5-12-=-- . b'10:8j, '3.6•Uf j ,,gAtt 2 3��7 10 3' i 2•it 15, ) 4x4 Scale.1/4"=V 6 17. 5x 6 = 2x4 II l 16 rx 7 5x6 5x6 — 15 12.00 12 } / N 13 '0 in 'i QQ 12' i-s_ 1g 11 20 10 21 g 22 3x8 I I 6 1x4 II 4x4 = 3x8 = 44 3 8.11 .5.11-7 i1.5 13 dM i2 5-5.6 - Plate offsets X Y)--[2 Edae 0 0 71'f 3 0 3.9 0.2.0.2 a[ - LOADING (psf) SPACING- 2-0-0 CSI. DEFL. In (loc) I/defi Ud PLATES GRIP TCLL(roof) 30.0 Plate Grip DOL 1.15 TC 0.33 Vert(LL) -0.09 9-10 >999 240 MT20 1971144 Snow(Pf/Pg) 38,5/50 0 Lumber DOL 1.15 BC 0.48 Vert(CT) -012 9-10 >999 180 TCDL 10.0 Rep Stress Incr YES WB 0.74 Horz(CT) 0.01 B n/a n/a BCLL 0.0 BCDL 10.0 * Code IBC2015frP12014 Matrix-S Weight 75 lb FT 20% LUMBER- — - BRACING- CHORD 2x4 SPF Not TOP CHORD Structural wood sheathing directly applied or 5-9-4 cc purlins, CHORD 2x4 SPF No,2 except end verticals,and 2-0-0 cc purlins(6-0-0 max)'3-4,6-7, -is 2x3 SPF No.2 BOT CHORD Rigid telling directly applied or 10-0-0 cc bracing WEDGE Left 2x6 SPF No 2 REACTIONS. (Ib/size) 8=823/Mechanical,2=939/0-5-8 Max Horz 2=248(LC 13) Max Uplift B=-64(1-C 11),2=-64(LC 14) FORCES. (lb)-Max Comp./Max.Ten,-All forces 250(lb)or less except when shown. TOP CHORD 2-3=-974/120,3-4=741/142,4-5=-5161147,5-6=-541/209,7-B=279/54 BOT CHORD 2-11=-263/559,10-11=263/558,9-10=-234/747,B-9=-1271342 WEBS 3-11=-30/291,3-10=-28/365,4-9=5K/134,5-9=-169/378,6-8=-7461151 NOTES- 1)Unbalanced roof live loads have been considered for this design, 2)Wind:ASCE 7-10;Vult=130mph(3-second gust)Vasd=103mph;TCDL=6.OpsP BCDL=6.0psf:h=25ft,B=45ft;L=24ft,eave=4ft;Cat. II;Exp B;enclosed;MWFRS(directional)and C-C Exterior(2)-0-10-8 to 2-1-8,Interior(1)2-1-8 to 3-6-11,Exterior(2)3-6-11 to 11-5-13,Interior(1)11-5-13 to 14-4-B zone;cantilever left and right exposed;end vertical left and right exposed;C-C for members and forces&MWFRS for reactions shown;Lumber DOL=1 60 plate grip DOL=1,60 3)TCLL-ASCE 7-1 D,Pr=30.0 psf(roof live load'Lumber DOL=1.15 Plate DOL=1.15);Pg=56 0 psf(ground snow);Pf=38 5 psf(flat 'roof snow.Lumber DOL=1 15 Plate DOL=1.15);Category Il;Exp B;Partially Exp.;Ct=1.1,Lu=50-0-0 4)This truss has been designed for greater of min roof live load of 12,0 psf or 1.00 times flat roof load of 3B.5 psf on overhangs = non-concurrent with other live loads, e, of Ne 5)Provide adequate drainage to prevent water ponding. 6)This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads. J.0 YA_ - 7)*This truss has been designed for a live load of 20 Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide S will fit between the bottom chord and any other members. Q`l B)'Refer to girder(s)for truss to truss connections,. * Q 9)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift at joints)8. 10)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT at jt(s)2,This connection is for upllft only and does not consider lateral forces, !LI 11)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads, 12)Graphical purlin representation does not depict the size or the orientation of the purlin along the top and/or bottom chord. � � •-099Q3` r'�� FCss% - July 26,2019 ®WARNING-Verity design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE 0I.7473 rev.10103/2015 BEFORE USE Aenlgti v0dWone only,wltti ivliTm)ai Caaniac2ar0.114a design In teased ariy,upon pormrietera vhown,nnd(a(Kai)IndividuRl bmlldgtR cymponmld,pet �e ntr�s'ayatotn,Bafprcauq®;Ihpbuilihp¢daajOP,ar'mot4,vnnfytho:ipplllFihUgYefd�413.lnFmrnmtlutaanitpraaurlyln'rmisnnttulhtuctu5igntjtalhQnvmidf MiTek, fxrlldlitgdcafOq•Bsxtaipinui;atWLrop.mvcnlbuertut9or,rndi dual Ws"wah'mnuloreila rrnombarsanty:Aridifimnn}tamporhry''mdramwnnntdrsrin0. T . iodtwny�)a0ntroBtafabblllyrndtaprgvpn�cnitp pfvitripgfaitdnparsOnhllnkTnnapkipii Ydnmaoe.FetpnartcfQOlden`grgQardKrgttee inh(linllcn•alongv,'deli4ary,e(culub and bwdm ct Uu sa;`Ond'was ayatoms,Sae. AN81/1ptf+raGnnty Cdfattn,086•fip attd BCSfOalidlnp Component 16023 Swingley Ridge Rd Safdty Uttarmn0on avnllnUtn irony TrussPfala irta{pyla,218 N.leo Sweat 5mltc 312,IUaxniidrin;VA 22313. Chesiergeld,MO 63017 Job - Pss--- Truss Type` - Qty Ply ISUILDING D ROOF VINEYARDVIEW 137936937 i 3597OR3 ; Roof Special 1' 1 Jab-Reference ootional Universal-Component-Corp:, EAST-HAVEN.CT 08512 - - 8,0tDaAug,11?017,MITtiVindurAde',Inc. Thu Jul 25 23:16:02 2019 Page 1 ID uH81G9fAM9_WQEtKnavHVNyuWBg-Z7y7fxaoyrsmYOLPflhgozY76C1 Ufuc7E114TOyuNRx .0.10• 2-2-11 4-2-7- 7_712--l-5 -14-5-12--- 1D•8 _2-2c11 2�i 1: 5 0 3 1 2-5 111 2-4-7 44 Scale 11 5 17 5x6= 4x4 - 7 16 15, 18 5x6 3- o ;12.00 12 c 2 f ._ 19 12 20 11 21 10 22 9 23 8 3x8 I I 1x4 II 4x4 = 3x6 = 44 = 2x4 II 2-2.11 4.7.7 94.10, 12-1-5 14.5�12a� 1 2.2-11' 7-4-12- 5.0.3 ' 2 511 r 2"4.7 - LOADING (psf/ SPACING- 2-0-0 CSI. DEFL. in ([cc) 1/dell Ltd PLATES GRIP TCLL(roof) 30.0 Plate Grip DOL 1 15 TC 0.50 Vert(LL) -008 10-11 >999 240 MT20 197/144 Snow(Pf/Pg) 385/50 0 Lumber DOL 1.15 i BC 0,46 Vert(CT) -011 10-11 >999 180 TCDL 10.0 Rep Stress Incr YES WB 0.60 Horz(CT) 0.01 8 n/a nla BCLL 0.0 * Code IBC20151TP12014 Matrix-S Weight,73 Ib FT=20% BCDL 1b.0 - - LUMBER- BRACING- TOP CHORD 2x4 SPF Not TOP CHORD Structural wood sheathing directly applied or 5-9-0 cc purlins, BOT CHORD 2x4 SPF No.2 except end verticals,and 2-0-0 cc purlins(5-8-1 max)'3-4,6-7, WEBS 2x3 SPF No.2 BOT CHORD Rigid ceiling directly applied or 10-0-0 cc bracing WEDGE Left-2x6 SPF No.2 REACTIONS. (Ib/size) 8=823/Mechanical,2=93910-5-8 Max Horz 2=240(LC 13) Max Uplift 8=-39(LC 11),2=-65(LC 14) FORCES. (lb)-Max.Comp/Max.Ten,-All forces 250(lb)or less except when shown, TOP CHORD 2-3=-973/114,3-4=101 B/159,4-5=-686(145,5-6=-553(164,6-7=-297/112, 7-8=-7921138 BOT CHORD 2-12=-251/566,11-12=-251/564,10-11=-252/1035,9-10=-106/309 WEBS 3-12=-57/266,3-11=-81/687,4-11=-426/116,4-1 0=-7 5211 7 5,5-1 0=-1 0 5137 5, 6-9=657/159,7-9=-127/736 NOTES- 1)Unbalanced roof live loads have been considered for this design. 2)Wind,ASCE 7-10;Vult=130mph(3-second gust)Vasd=103mph;TCDL=6.Opsf;BCDL=6.Opsf;h=25ft,8=45ft;L=24ft;eave=oft;Cat. II;Exp B;enclosed;MWFRS(directional)and C-C Exterior(2)-0-10-8 to 4-7-7,intedor(1)4-7-7 to 9-7-10,Extertor(2)9-7-10 to 12-1-5 zone;cantilever left and right exposed;end vertical left and right exposed;C-C for members and forces&MWFRS for reactions shown;Lumber DOL=1.60 plate grip DOL=1.60 3)TCLL:ASCE 7-10;Pr=30.0 psf(roof live load:Lumber DOL=1.15 Plate DOL=1.15);Pg=50 0 psf(ground snow);Pf=38,5 psf(flat roof snow:Lumber DOL=1.15 Plate DOL=1 15);Category Il;Exp B;Partially Exp;Ct=1 1,Lu=50-0-0 !! O'F N E 1W4/, 4)This truss has hePn designed for greater of min roof live load of 12,0 psf or 1,00 times flat roof load of 38.5 psf on overhangs iCV 01 non-concurrent with other live loads 5)Provide adequate drainage to prevent water ponding; 0s 6)This truss has been designed for a 10,0 psi bottom chord live load nonconcurrent with any other live loads. `ib 7)*This truss has been designed for a live load of 20.Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide ' will fit between the bottom chord and any other members. 8)Refer to girder(s)for truss to truss connections- _ 9)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift at joint(s)8 ((�_ UJ 10)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT at jt(s)2.This connection is for uplift only ��.` lbizsa� and does not consider lateral forces. �` �p 11)This truss has been designed for a moving concentrated load of 250,01b,live located at all mid panels and at all panel points along �i0 . 09943`` 'G✓S the Top Chord and Bottom Chord,nonconcurrent with any other live loads, 12)Graphical purlin representation does not depict the size or the orientation of the purlin along the top and/or bottom chord. > S S1 July 26,2019 j WARNING-Verify design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE M11•7473 rev 10/03/2013 BEFORE USE. X11' i Design valid for use only with MiTek@ conneelors,Thls design is based only upon parameters shown,and Is for an individual building component,not t i a truss system Before tmoilhe building diiclgpormust venfy the applicability of design parAmbL-j i trnil properly Incorporate this design into the overall building design. Brerang bfdicaled Is to pfevrnnl buckling of individual truss web andfor chord hiemhers only Additional temporary and pennenent bracing A/1iTOW is always required for stability and to prevent collapse with possible personal injury and property damage,For general guidance regarding the fabrication,storage,del;0-1 erection and bracing of trusses and truss systems,see ANSIITP11 Quality Criteria,DSB.B9 and SCSI Building Component � 16023 Swmgley Ridge Rd Safely Information nva1le from Truss Plate Institute,218 N Lee Street,Suite 312,Alexandria,VA 22314. ? Chesterfield,MO 63017 JriB. russ TnifisTytlu Qty --t Pty`—'BUILDING D ROOF'VINEYARD VIEW- 137938938 3b970R3 19 f�UUf Sperlat i31fde1` 1 1 _ Job Reference,(ppliorml, Universal Component Corp,, EAST HAVEN CT 06512 - - 8:01Ds`Aug112017MITaklndtrtrius,IhF,Thu,Ju125,23:16;Q32i119 PAgo,i, ID•uH8iG9iAM9 WOGtlUrzurtVNyuWBg•iKWVsHbet6 d9'?w6OQD3KASL,piklo00aHSHT4?iyuNRi�, 0-10-11 ` 1 -5-h — g:70 =2L13- 3:13 1t-3 14-Ot1. - 2-372 3-2-2 3-2.2 0-10-11 44 = Scale=1.54.5 8, '. 19- 10 --r _ - - - 44 = 3x6 5x6 = 5 8 r., xD' ' 4X6 _ i7 � - ;z 1 12 5x6 = 3 j �j 4r 14 �21 13' 22 12 23 - 11 24 10 25 g 4x6 = 3x6 = 44 = 3x8 = 4x4 =2x4 II 2x4 II NAILED NAILED 1 D111_�-3 7 _ ;----6-5-8- - - 3.7,i 0_ :12=8-13 14-5_12 — _ -_-- � _24-12 •3.2=2 342, 34-3- 'Plate ;i-3'Plate Offsets(X,Y)-- LOADING (psf) SPACING- 2-0-0 CSI._ DEFL. in (loc) I/deft Ltd PLATES GRIP TCLL(roof) 30.0 Plate Grip DOL 1,15 TC 0.31 Vert(LL) -0.06 12-13 >999 240 MT20 1971144 Snow(Pf/Pg) 36.5150 0 Lumber DOL 1 15 BC 0.54 Vert(CT) -0.09 12-13 >999 180 BCDL 10.0 0.0 Rep Stress Incr NO WB 0.42 Horz(CT) 0,01 9 n/a n/a BCDL- _- 10.0 Code IBC2015r1'PI2014 1 Matrbt-S Weight 82 Ib FT=20% LUMBER- BRACING- CHORD 2x4 SPF No.2 TOP CHORD Structural wood sheathing directly applied or 5-5-12 cc purlins, CHORD 2x6 SPF Not except end verticals,and 2-0-0 cc purlins(44-13 max.)`3-4,7-8 VV, 3S 2x3 SPF Not BOT CHORD Rigid ceding directly applied or 10-0-0 cc bracing, REACTIONS. (Ib/size) 9=831/Mechanical,2=965/0-5-8 Max Horz 2=231(LC 9) Max Uplift 9=41(LC 10),2=-91(LC 10) FORCES. (lb)-Max.Comp./Max Ten -All foirras 250(lb)or less except when shown TOP CHORD 2-3=-1056/34,3-4=-1704J97;,4-5=-1 074/78,5-6=-628/124,6-7=-613/118,7-8=-253163, B-9=-766/57 BOT CHORD 2-14=-147/614,13-14=-1511597,12-13=8611649,11-12=-78/708,10-11=321269 WEBS 4-13=-630/71,6-11=-1011426,7-10=-719/59,8-10=-41/735,3-14=0/326,3-13=-72/1237, 5-11=5851116,5-12=0/504,4-12=-994/91 NOTES. 1)Unbalanced roof live loads have been considered for this design, 2)Wind-ASCE 7-10,Vuit=130mph(3-second gust)Vasd=103mph;TCDL=6.Opsf;BCDL=6.Opsf,h=25ft;B=45ft;L=24ft;eave=oft;Cat. 11;Exp B;enclosed;MWFRS(directional);cantilever left and right exposed;end vertical left and right exposed;Lumber DOL=1.60 plate grip DOL=1.60 3)TCLL:ASCE 7-10;Pr--30,0 psf(roof live load:Lumber DOL=1.15 Plate DOL=1.15);Pg=50.0 psf(ground snow);Pf=38.5'psf(flat roof snow.Lumber DOL=1.15 Plate DOL=1.15);Category II;Exp B;Partially Exp.;Ct=1 1,Lu=50-0-0 4)This truss has been designed for greater of min roof live load of 12;0 psf or 1,00 times flat roof load of 38.5 psf on overhangs non-concurrent with other live loads. 5)Provide adequate drainage to prevent water ponding, 6)This truss hes been designed for a 10.0 p6f bottom chord live load nonconcurrent with any other live loads. 7)+This truss has been designed for a live load of 20.Opsf on the bottom chord 1n all areas where a rectangle 3-6-0 tall by 2-0.0 wide �� {L�(1);'JQ/y,� will fit between the bottom chord and any other members 8)Refer to girder(s)for truss to truss connections. "a4 9)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift atioint(s)9. ` 10)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT at jt(s)2.This connection is for uplift only and does not consider lateral forces. 11)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along jtt' W the Top Chord and Bottom Chord,nonconcurrent with any other live loads, 12)Graphical purlin representation does not depict the size or the orientation of the puriin along the top and/or bottom chord: fO 3 C1' 13) "NAILED"indicates 3-10d(0.148"x3")or 2-12d(0 148"x3 25")toe-nails.For more details refer to MiTek's ST-TOENAIL Detail. pggq�3_ 14) In the LOAD CASE(S)section,loads applied to the face of the truss are noted as front(F)or back(B) SS10tN D CASES) Standard July 26,2019 ®WARNING-Verily,design parameters and READ NOTES ON THIS AND INCLUDED fAITEK REFERENCE PAGE Mtt--7473 rev.ID10212015 BEFORE USE 0eslgri vngdfgrucc linty Yntri;fyti'rnl�+cgrsrlccUirr.,Ttdc}faslpri IaYrsiid`,Gr ri paramr;tnr�aturwri;nrM I}r11�r�n 41dlJlduul lttrVdht9 cOn�pOaonl;put ; alrusfsyelant,80"'o M $tvoNtgfrfoppUC Wlrtyafd)tulgnpo{�morcceandpropoijtfowwhiothirdoryigrirntolhoovoroll' �liOngAeslgn.sraanp lndre�rod is>abccknna of ndnAdval lrusswub aurum rtjnrd rr mtlnriatt t:A+ld tlennl terU racy will polindlolli ftdap" 'MiT 1C Il ttmdYlaifricn{ton, d5•a , lngOtlrnOsa�ondtnl6�cyctamo,sec Ak911TPtt,0un11tYCrirerta,D59�69artdBC&(�NildfngComponent t 16023SwrngloyRrdgeRd Slfetylnforniutfop Ti VAr"31•t,-` Chesterfield,MID 63017 Job Truss - fnfS Type -- --Qty Ply I UILDING'D ROOF,VINEYARDVIEW - _ 137936938 35970R3 19 1 Job Relidbnci Lopllottbl nlvsrsal Component Corp., EAST HAVEN CTOB512, 8.o10 s Aug'(1 2017.t�UTektntlUSU(,!-I Inc. Thu Jul 25 23.16:04 2019 Page 2 I D.uH61G9iAM9_WQEIKnavHVNyuWBg-V W4t4dcGTS6U mVnn7kltOdWZOhl7rpQh1 CAYHyuNRv LOAD CASE(S) Standard 1)Dead+Snow(balanced)-Lumber Increase=1.15,Plate Increase=1 15 Uniform Loads(plf) Vert:1-3=-97,3-4=97,4-6=-97,6-7=-97,7-8=-97,2-9=-20 Concentrated Loads(lb) Vert'`I3=33(F) ®WARNING-Verlry design pam nerers and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE MII-7473 rev 1010312015 BEFORE USE. 'pualpn vulnf tar use only�hlh f.U7asc tanrtsctors•Ttitp diidpn tc Dasa andyq uppn pnmre>rlat0 ut�rvm,pnd .,6uss ayu{byt•BuYn!a uan,ilso 4uirolhg du:Jljttur muaS vutl'P/Iha uppl+dtit�Uly of denirJu pptsmntera lord vioon ifryu IncIrrs}d�ivmduldll hlxaudldaivgnptmnlq000 n0 a,<craN tnritdrq,dCs[t[n-0racnQlndca;adfau+pravOnl'qucfdingo}[rict�ftiunfrn,c*vrtnandla�r#yrdrmm6c:icrxi;y,Addltfonut[un;trara:ynratgomfnrinttStuaclhp WOW 4:idwnyc regwred/Vi atn4llry aqd 19{rgvnn{uNWitau�4i�j»s,lAia paraw:N In ury nridproportydmm�go. go>aarN guldnnCn rogardiny the lbt.irGllpn,5E07Ege,dullvoryrydratUd»nrtd bra clitp'n1Yru soy mx1 truss syalvLnfi,acv 'AMS1fip11 Qtiallty C,ritarin,459.89 and HCSI BtdItl,Itlp.Component Chest S eld,Ny Ridge Rd salnty Informatlan ttv4Mtrto frau:Tniea P4[lo ImiSilto,2t0 N'Lao Sueol.Su71e 3t2,ASUxnnddu.VAaaat4. ---�• Chestedletd,M0 63017 Job L20 Qty Ply BUILDING D-ROOF'VINEYARD VIEW { 137938939 35970R3 I�Ronf Spocial i; 1 Jab Reference(o tlona0 UhiVCMI Componanl Corp.,, -FAST HAVEN-CT 06512 -- -"' " - — 8.010 sAug 11'2017.MITek Ihd4%de-s,Inc."Thu Jul2523.16:05 2019 Pagel ID ul1E1IG9iAM1i9_`1/QEKira'v14VNydlll'Eg-)tr i!r`crEmELPs4_LrFXPbAg4Q7RsLzawhykgyuNRu 1�1p• 3-7-11 3;7-3 — 3-8-11 1-17 4x4 = Scale=1.49.8 4 12 n t 13 12.00 124x4 = r 1X4 \\ 11 �,-"� i 14 6x6 = 3 615 )h. _ C 10 . 2 16 17 18 3x6 If 9 8 7 3x8 = 2x4 II 4x4 T i s7-?.-t4 =°_-- - .3.8-i1 - -rt•1.7" _ Plate Offsets(x;Y1�j2E�e,0•D.7 - LOADING (psf) SPACING- 2-0-0 CSL DEFL. in, (loc) I/deft Ud PLATES GRIP TCLL(roof) 30,0 Plate Grip DOL 1.15 TC 0.33 i Vert(LL) -021 2-9 >665 240 MT20 1971144 Snow(PF/Pg) 38.5/50,0 Lumber DOL 1,15 BC 0.66 1 Vert(CT) -028 2-9 >504 180 TCDL 10.0 Rep Stress Incr YES WB 0,24 Horz(CT) 0,01 7 n/a n/a BCLL BCDL 10.0 s Code IBC2015/TPI2014 Matrix-S Weight'58 Ib FT=20% LUMBER- - — — - — — BRACING. 'CHORD 2x4 SPF No,2 TOP CHORD Structural wood sheathing directly applied or 6-0-0-oc purlins, 'CHORD 2x4 SPF No'.2 except end verticals,and 2-0-0 oc purlins(6-0-0 max.):5-6. ..�3S 2x3 SPF No.2 BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing WEDGE Left 2x6 SPF No 2 REACTIONS. (Ib/size) 7=682/Mechanical,2=800/0-5-8 Max Horz 2=224(LC 13) Max Uplift 7=-30(LC 14),2=-62(LC 14) FORCES. (lb)-Max,ComplMax,Ten,-All forces 250(lb)or less except when shown._ TOP CHORD 2-3=7561115.3-4=-524/154,4-5=-514/133,6-7=-615/85 BOT CHORD 2-9=-187/448 WEBS 4-9=-971315,5-B=-643/163,6-B=-115/614 NOTES- 1)Unbalanced roof live loads have been considered for this design. 2)Wind,ASCE 7-10;Vult=130mph(3-second gust)Vasd=103mph;TCDL=6.Opsf;BCDL=6.Opsf,h=25ft;B=45ft;L=24ft,eave=oft,Cat- II;Exp B;enclosed,MWFRS(directional)and C-C Exterior(2)-0-10-8 to 2-1-B,Interior(1)2-1-8 to 7-2-14,Extenor(2)7-2-14 to 10-2-14,Interior(1)10-11-9 to 11-11-12 zone;cantilever left and right exposed;end vertical left and right exposed;C-C for members and forces&MWFRS for reactions shown;Lumber DOL=1,60 plate grip DOL=1 60 3)TCLL ASCE 7-10;Pr=30.0 psf(roof live load'Lumber DOL=1,15 Plate DOL=1.15);Pg=50.0 psf(ground snow);Pf=38.5 psf(flat roof snow:Lumber DOL=1 15 Plate DOL=1.15);Category II;Exp B;Partially Exp.;Ct=1:1,Lu=50-0-0 4)This truss has been designed for greater of min roof live load of 12,0 psf or 1.00 times flat roof load of 38 5 psf on overhangs non-concurrent with other live loads, 5)Provide adequate drainage to prevent water ponding- 6)This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads, doffti� Q 7)"This truss has been designed for a live load of 20.Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide will fit between the bottom chord and any other members. .C.O "?'' 0 8)Refer to girder(s)for truss to truss connections. 9)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift at joint(s)7. 10)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT at jt(s)2.This connection Is for uplift only AM and does not consider lateral forces. (` 11)This truss has been designed fora moving Concentrated load of 250,01b live located at all fnld panels and at all panel points along Z ' the Top Chord and Bottom Chord,nonconcurrent with any other live loads, �� ^ 12)Graphical puriin representation does not depict the size or the orientation of the purlin along the top and/or bottom chord, �pFESSI��- July 26,2019 ®WARNING-Verify design parameters and READ NOTES ON THIS AND INCLUDED MITER REFERENCE PAGE MR-7473 rev.1010312015 BEFORE USE r Deslyjn vnr�(sr u U oaty,wjlh M{TakF3 ed initctc?a.Chie desip{i is tiaapd onfy'upon parmnOWm shown;wta Ia 10 an 11)Md hutirf rip aompmwul,not, n'hnusayntmn 9tirorouza.UlaGGtldtnpddelUp"rmuutvarifythaApptlrtbiGyo<daaipnpammofemand'proaolyinrxu�snitrltlladaVonli'l over 0 In ad B1+Irltipindl;ntnbisloprwenlsuck/Ulpallndlvlduq{raus?'14a6atdrorctso�d�gmborbprdy.'Addifrnnattdarpo%dryandparmanontL•rxWng Is11I'by,raqul{avYlar tatiilily'OnRibpr(tvrlyd,Cntinlaodwltllph.s}bidp"rspnUlinjuryandifr4p01igduma0s. it tit! hit+Lntltm,aioi3ptdeIt nry,liracllon:•nd ulnrJi l7,N,Iiti iind'ttub3 SL"% aoq_ ANSlrrp110ilallly'Criferfa,659.89 and aC81 Building Component 16023 Swingley Ridge Rd $ aftity IltforlllUltOrl auallabla haM Truss,Firll'v InwIlta:2ld N.L ja Speal SQllq$1x:IiWxand(ia;VA22314,' Chesterfield,MO 63017 Job runs russType - Qty Ply BUILDING D ROOF VINEYARD VIEW 13793B940 '5970R3 T21 Common 4 1 Job Reference(optional) UgivOrsatComponentCorp., - EAST HAVEN CT'00512 - f3ff105,Aag(1-7.017MTekIndustries,crit:'Tfitu'fu12523;iG:06,20119 Panit'1 1D;uH01G9iAMa WtlEtltrcavHVNyuvV9b-RvCe1JJdtiN73MCO?eAvYmntypjpTgLRbpUj8L6Koy0gl 3.7411 I_ 7_-2_14 10 1-701 3.7-3 Scale 4x4 =' 4 12 12.00 112 1x4 13 O '• f/ 5`tiy4 6 � I 4 1 147 15 6 3x8 II 3x8 2x4 II = 7-2-14 12-1-0 j -y.girl - 4-10-2-- -------- ---- -- -- - - - - - ----- -- - - Plate Offsets(X�Y,j— �j2:Frlge;D O 71,L5:0.?•A,EJSa - - - -_— LOADING (psf) SPACING- 2-0-0 CSI. DEFL. in (loc) Ildefl Ud PLATES GRIP TCLL(roof) 30.0 Plate Grip DOL 1.15 TC 0.48 vert(LL) -0.22 2-7 >627 240 MT20 1971144 Snow(PfIPg) 38.5/50.0 Lumber DOL 115 BC 0.67 Vert(CT) -0.29 2-7 >484 180 TCDL 10.0 Rep Stress Incr YES WB 0.16 Horz(CT) 0.01 6 n/a n/a BCLL 0.0 Code IBC2015fTP12014 Matnx-S Weight:52 Its FT=20% BCDL__-_ 10.0 LUMBER- BRACING- TOP CHORD 2x4 SPF No.2 TOP CHORD Structural wood sheathing directly applied or 6.0-0 oc purlins, BOT CHORD 2x4 SPF No.2 except end verticals WEBS 2x3 SPF No.2 BOT CHORD Rigid tailing directly applied or 6-0-0 oc bracing. WEDGE Left-2x6 SPF No.2 REACTIONS. (Ib/size) 2=800/0-5-8,6=682/Mechanical Max Horz 2=213(LC 13) Max Uplift 2=-63(LC 14),6=-28(LC 14) FORCES. (lb)-Max CompdMax Ten.-All forces 250(lb)or less except when shown. TOP CHORD 2-3=753/112,3-4=-522/151,4-5=-550/112,5-6=-648/108 BOT CHORD 2-7=-135/447 WEBS 4-7=61/304,5-7=-7/305 NOTES- 1)Unbalanced roof live loads have been considered for this design. 2)Wind,ASCE 7-10;Vult=130mph(3-second gust)Vasd=103mph;TCDL=6.Opsf;BCDL=6.Opsf,h=25ft;B=45ft,L=24ft,eave=4ft;Cat, It;Exp B;enclosed;MWFRS(directional)and C-C Exterior(2)-0-10-B to 2-1-8,Interior(1)2-1-8 to 7-2-14,Exterior(2)7-2-14 to 10-2-14 zone,cantilever left and right exposed;end vertical left and right exposed,C-C for members and farces&MWFRS for reactions shown;Lumber DOL=1.60 plate gnp DOL=1.60 3)TCLL•ASCE 7-10;Pr=30.0 psf(roof live load,Lumber DOL=1.15 Plate DOL=1,15);Pg=50 0 psf(ground snow),Pf=38 5 psf(flat roof snow,Lumber DOL---1,15 Plate DOL=1.15);Category 11;Exp B;Partially Exp,Ct=1.1 4)This truss has been designed for greater of min roof live load of 12,0 psf or 1.00 times flat roof load of 3B.5 psf on overhangs ! �F �r� non-concurrent with other live loads. L +'Y 5)This truss has been designed for a 10.0 psf bottom chord live load nnnrnncurrent with any other live loads. -Q� 6)'This truss has been designed for a live load of 20.0psf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wideJO1+ P l will fit between the bottom chord and any other members. csO 7)Refer to girder(s)for truss to truss connections. 8)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift stjoint(s)6, 1 9)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT at jt(s)2.This connection is for uplift only LC and does not consider lateral forces, ai lit U 10)This truss has been designed for a moving concentrated load of 250.0lb live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. Z� ' Uig fiQ �a';Q99Q33 IN SSlO`,P~ July 26,2019 M Moro ®WARNING-Verify design parameters and READ NOTES DN THIS AND INCLUDED MI7E1f REFERENCE PAGE Mil-7473 rev.1010312015 BEFORE USE fJLsign Vlll 411V:U1,ptAlt�Vitlh !17oK 3w/Inuoln l{chic doalun to bnxop"ty upon pswn nlom ahovfn,and In Torah tndiafdonl hn ldl, wmrn anuntl rtes I u Uusnyn!orh:Heturu uve;ljte Cuilding'dps)jtist mustvmif� the ppl!lGiBdUlya!daslga,p�nmotoln nut/proPntlytnraglntato this donors Inir rtro anua!I 'buildlnpdesl0n,etn_Jtv,Jirufr,nitnfluioprovenitihr:,lingof ndividuniifuss.,v+bandor'c.`wrdmambalconly.itddWonultornpoidry'uhlperrppnonibrae'rltt WOW "Ill olwnytieeflUUed fo?dishilliviiilW io'ptovaaI'Cpllap[o%vilh pooniblu Qshiemil 101ury and proi}ntty dnmpgu,Fprggnplpl gpWpnCa lerjnldMg dlo, (apt{~ntlon,Olgloga-dcl4wy,o+edian;.nd,bhiiIng of ltussas a(r0 uu:a ny=�urnto.not ANSirrPli ttuality Crltoria;D5D•88 end SCSI Building Component 16023 Swrigley Ridge Rd Soffoty lotoimnoon nrratinbin frothTruss,plato inti luta.216N.Loci Strops 5uito 31x,,Alaxnndan;VA333,in, - a - Chesterfield,MO 63017 �y Job cuss - TFtuss3ype' "' -' Qty ]Ply BUILDING O Ii00F—NEYARD VIEW ,I'! 137938941 5970R3 22 f oof Spocial 1 1 Job Re!' nor a junal�; _ Universal Component Corp., EAST HAVEN-CT 06512 - --- _ 8.010 s Aug 11 2OT7 Mrfek(ndustifes,Inc.Thu Jul 25 23.16:06 2019 Page 1 ID.uHBIG91AM9_WQEtKnavHVNyuWBg-RvCeUJdW73MCD?eAuYmmyp)uPgTZbrxIBLhHc9yuNRt 2-0-9 - - - - 3.1-31 1' - 1x4 I I Scale=1.10.6 N - 5 X6.66 112 3 0 1x4 11 2x4 = 2•B•9.- -- - LOADING (psf) SPACING- 2-0-0 CSI. DEFL. In (loc) I/dell L/d PLATES GRIP TCLL(roof) 30.0 Plate Grip DOL 1,15 TC 0.16 Vert(LL) -0.01 2-4 >999 240 MT20 197/144 Snow(Pf/Pg) 38 5150.0 Lumber DOL 1.15 BC 0.15 Vert(CT) -0 01 2-4 >999 160 TCDL 10,0 Rep Stress Incr YES WB 0.00 Horz(CT) 0,00 2 n/a n/a BCLL 0,0 Cade IBC2015frP12014 Matrlx-S Weight 7 l FT 20% `BCQL 10,0 LUMBER- BRACING- TOP CHORD 2x4 SPF Not TOP CHORD Structural wood sheathing directly applied or 2-0-9 cc purlins, CHORD 2x4 SPF Not except end verticals: 3S 2x3 SPF No.2 BOT CHORD Rigid telling directly applied or 10-0-0 cc bracing. REACTIONS. (Ib/size) 4=46/Mechanical,2=278/0-6-10 Max Harz 4=-48(LC 12) Max Uplift 4=-1 B(LC 20),2=-64(LC 16) Max Grav 4=273(LC 32),2=320(LC 34) FORCES. (lb)-Max,Comp./Max.Ten.-All forces 250(lb)or less except when shown,. TOP CHORD 1-4=256/36 NOTES- 1)Wind:ASCE 7-10;Vult=130mph(3-second gust)Vasd=103mph;TCDL=6.Opsf;BCDL=6,Opsf;h=25ft;B=45ft;L=24ft;eave=4ft;Cat._, Il;Exp B;enclosed;MWFRS(directional)and C-C Exterior(2)zone;cantilever left and right exposed;end vertical left and right exposed;C-C for members and farces&MWFRS for reactions shown;Lumber DOL=1.60 plate grip DOL=1.60 2)TCLL ASCE 7-10;Pr--30.0 psf(roof live load Lumber DOL=1-15 Plate DOL=1.15);Pg=50.0 psf(ground snow),Pf=38.5 psf(flat roof snow,Lumber DOL=1.15 Plate DOL=1,15),Category Il;Exp B;Partially Exp.;Ct=1.1 3)Unbalanced snow loads have been considered for this design 4)This truss has been designed for greater of min roof live load of 12.0 psf or 1.00 times flat roof load of 38.5 psf on overhangs non-concurrent with other live loads, 5)This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads. 6)`This truss has been designed for a live load of 20.0psf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide will fit between the bottom chord and any other members. 7)Refer to girder(s)for truss to truss connections 8)Provide mechanical connection(by others)of truss to bearing plate capable df wdhstanding 100 Ib uplift at joint(s)4. -of NE 9)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT at jt(s)2.This connection is for uplift only and does not consider lateral forces; 10)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at'all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. * y VC. '-0994 ��FESS1Q�a�, July 26,2019 , ®WARNING.Verify design parameters and READ NOTES ON THIS AND INCLUDED MiTEKREFERENCE PAGE Mll-7473 rev.10103/2015 BEFORE USE. i Design valid Por use only with MITek®connectors-This design is based only upon parameters shown,and is for an individual building component,not ' a truss system.BaforotFs0,the building,d06tgiiirmusi venfy the applioabllily of design pnrmal0m atld properly incorporate this design into the overall r building design Braci ip Indicated isio prnvoll Wckimg of individual truss web and/or ttiivd rifainbafgoniy Additional temporary and permanent bracing is always required for'stability and to preirent'collapse with possible personal injury and property damage,.For general guidance regarding the r fabrication,storage,delivery,erection and bracing of trusses and truss systems,see ANSIITPII Quality Criteria,DSB•80 and BCSI Building Component 16023 Swingley Ridge Rd Safety Information available from Truss Plate Inslilule,218 N Lee Street,Suite 312,Alexandra,VA 22314. Chesterfield,MO 63017 Juts -- Truss TCLIssType ' - ` Q1y' Ply = BUILDING D ROOF VINEYARD VIEW - 137938942 359.on T23 Roof Special I7 1 Job Reference opEl,lpnnl) Universal Component Corp., EAST HAVEN CT 005121 - —'8,010 s Aug 11 2017,Mric 1ptlt slrJes,Inc,Thu Jul 25 23 16'06 2019 Page i ID:uH81G91AM9_WQEtKnavH VNyuWBg-NHKOv_fnXhcvGJoZozoEI Eoagd 193gE0cfAOh2yuNRr p t0•q� 3-7-i1 7-7-td 9-6-10 t4-5 12 tl-140- 11•, 3-7-32.9.12, 4-11-2—�� 4x4 = Scale 11 4 1 I 6x6 :- 4x4 = 12 6 r511 12700 121x4 \\ 11 -= -- 14 15 ". 3 10 1 J •i u5 16 9.. 17 8 18 7 3x8 11 2x4 II 3x8 = 4x4 = 7.2-14 S•F 10 14-5-'(2 7-2-14 - Plate O(fgets lX,Y).': LOADING (psf) SPACING- 2-0-0 CSI. DEFL. in (loc) I/defl L/d PLATES GRIP TCLL(roof) 30.0 Plate Grip DOL 1,15 TC 0.56 Vert(LL) -0.20 2-9 >839 240 MT20 197/144 Snow(Pf/Pg) 38 5/50.0 Lumber DOL 1,15 BC 0.65 Vert(CT) -028 2-9 >614 180 TCDL 10,0 Rep Stress Incr YES WB 0.33 Horz(CT) 0,01 7 n/a n/a BCLL 0.0 Weight 68 Ib FT=2o% BCDL _ 10.0 _. Code IBC2015/TP12014 Matrix-S _ LUMBER- BRACING- TOP CHORD 2x4 SPF No.2 TOP CHORD Structural wood sheathing directly applied or 5-11-2 cc purlins, BOT CHORD 2x4 SPF No.2 except end verticals,and 2-0-0 oc purlins(6-0-0 max.):5-6 WEBS 2x3 SPF No.2 BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing WEDGE Left 2x6 SPF No.2 REACTIONS. (Ib/size) 7=823/Mechanical,2=939/0-5-8 Max Horz 2=242(LC 13) Max Uplift 7=72(LC 11),2=-65(LC 14) FORCES (lb)-Max Comp./Max.Ten -All forces 250(lb)or less except when shown, TOP CHORD 2-3=-930/122.3-4=-706/162,4-5=-6611166,5-6=-512f125,6-7=-77511167 BOT CHORD 2-9=2521554,8-9=-154/521 WEBS 4-9=152/550,5-9=30131143,5-8=-501/151,6-8=-142/741 NOTES- 1)Unbalanced roof live loads have been considered for this design., 2)Wind-ASCE 7-10;Vult=130mph(3-second gust)Vasd=103mph;TCDL=6.Opsf;BCDL=6,Opsf;h=25ft,B=45ft;L=24ft;eave=4ft,Cat II,Exp B,enclosed;MWFRS(directional)and C-C Exterior(2)-0-10-8 to 2-1-8,Interior(1)2-1-8 to 7-2-14,Extericr(2)7-2-14 to 9-6-10 zone;cantilever left and right exposed;end vertical left and right exposed;C-C for members and forces&MWFRS for reactions shown;Lumber DOL=1.617 plate grip DOL=1.60 3)TCLL:ASCE 7-10;Pr=30.0 psf(roof live load.Lumber DOL=1.15 Plate DOL=1:15);P9=50.0 psf(ground snow),Pf=38,5 psi(flat roof snow.Lumber DOL=1.15 Plate DOL=1 A 5);Category II;Exp B,Partially Exp.;Ct=1.1,Lu=50-0-0 4)This truss has been designed for greater of min roof live load of 12.0 psf or 1 00 times flat roof load of 38 5 psf on overhangs non-concurrent with other live loads, �! OF NS_7s(� 5)Provide adequate drainage to prevent water ponding, �• �� 6)This truss has been designed for a 10,0 psf bottom chord live load nonconcurrent with any other live loads �O,Q` 1t/ 7)'This truss has been designed for a live load of 20.0psf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide �fl will fit between the bottom chord and any other members. 8)Refer to girder(s)for truss to truss connections. I 9)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift at joint(s)7.. �� 10) One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT at jt(s)2_This connection is for uplift only j ��✓ -LU and does not consider lateral forces; mP 11)This truss has been designed for a moving concentrated load of 250.0lb live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. ��- gyp-0 3n�•� 12)Graphical purlin representation does not depict the size or the orientation of the purlin along the top and/or bottom chord. .0 99+' �Or -SSI0- July 26,2019 -- ®WARNING-Verify design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE AIII-7473 rev,10103/2015 BEFORE USE. (. MANS, I f}c{gnzellQfOfvtila!dywitti"(17 _1t Tlsi�,d uEOniebgindariiy{lfrwlgarumdlvrsshoyW ondKfornnlndMdbal,bulldI 9compOno111,041 n tiLss sy4 am.9alwra'ueb,tl{u 11u40ing' gnat mdai witty Irio Onnptlrwlbllhy of tlesipn perinpoters and ptoporly Inap pnhio s dudiAu Ihtp 111n rrtrGiiR bURdnO d ipn,'Bmdnp IttdlG 10d f0 f0 plh1i101 nuddl ip Of!1div31ep11n13S Wnh wcdlarshtnd rriep belsocly,Addbarlol fatnpo ory`Ond pmmAncnitrnclhg ��j�d�( in "i.in atrlhilityirrw Ui provYud o5nny«with r>p§slble pwrionrd Injury.and prgpuny dgma0u,Far{pdno/nl gui 7GnrompurdMg Iha tnbd uaq, 14mg4 delivery,eroot;rar and bracing of uusss.arru truss aysbuns,sae ANSIrfPl/4tuai ry,Ctharla,DS9.99 and BCst Qdllding Component 16023 Sv ingley Ridge Rd Safoty'lit(ormnHnn'ovnlln6lefrmr7ruc.AlnfoblalliUlu,118;N.tansrmn3,SilUt<31�,Atcutgdiln,VA':12317, - _ Cheslerfield,M063017 _- Jot) _ Truss l Truss Type '— - Qty Ply ---"BUILDING D ROOF VINEYARD VIEW r 137938943' 6,5970113' 4 Roof Special f 1 I -Job Reference fo tlonal Universal Component Corp;, Ei+ST HAVEN CT 06512 — — —' '-" $,QSD AuQ,112017 MITek Industries,Inc,Thu Jul 25 23:16:09 20,19 Pagel ID:uHBIG91AM9_WQEtKnavHVNyuWBg-rUum7KfPl_ImtTNIahKTaRLFU 1 NYo6b9rJwxDUyuNRq p 10.q -3;.-11` 7-24.1 0.10- 3=7=11 3-7-3 1-8-4 5.6-10 4x4 Scale 114=l' 4 =G%G = _'drA t- 6 12 12,00 12 i T 1x4 \\ 11 _Z i 10 1 2 r 77 15 9 16 B 17 3x6 II ' 7 3xB = 4x4 = 4x4 II 7-2-14 I -- 7-2-14" Plate Offsels_(X — LOADING (psf) TCLL(roof) 30,0 SPACING- 2-0-0 CSI- DEFL. in (loc) I/defl Ltd PLATES GRIP Snow(Pf/Pg) 38 5/50.0 Plate Grip DOL 1.15 TC 0.81 Vert(LL) -0.20 2-9 >866 240 MT20 197/144 DL 10.0 Lumber DOL 1 15 h BC 0164 Vert(CT) -027 2-9 >632 180 TC BCD OA Rep Stress Incr YES I WB 0,39 Horz(CT) 0.01 7 n/a n/a BCDL_ 10.0 Code IBC2015ITPI2014 Matrix-S Weight,70lb FT 20% LUMBER- BRACING- 'CHORD 2x4 SPF No.2 TOP CHORD Structural wood sheathing directly applied or&11-2 oc,purlins, 'CHORD 2x4 SPF No.2 except end verticals,and 2-M oc purlins(5-10-0 max:):5-6. ...-3S 2x3 SPF No.2 BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing, WEDGE Left'2x6 SPF No 2 REACTIONS. (ib/size) 7=823/Mechanical,2=939/0-5-8 Max Horz 2=250(LC 13) Max Uplift 7=-89(LC 11),2=-64(LC 14) FORCES. (lb)-Max.Comp,/Max.Ten.-All forces 250(lb)or less except when shown, TOP CHORD 2-3=938/120,3-4=-706/159,4-5=-660/178,5-6=-490/132,6-7=7711182 BOTCHORD 2-9=-2741555,8-9=-170/497 WEBS 4-9=-169/610,5-9=-357/155,5-8=-4691165,6-8=154/703 NOTES- 1)Unbalanced roof live loads have been considered for this design. 2)Wind:ASCE 7-10;Vult=130mph(3-second gust)Vasd=103mph;TCDL=6 Opsf,BCDL=6.Opsf,h=25ft,B=45ft,L=24ft;eave=oft;Cat. Il;Exp B;enclosed;MWFRS(directional)and C-C Exterior(2)-0-10-8 to 2-1-8,Interior(1)2-1-8 to 7-2-14,Exterior(2)7-2-14 to a-11-2 zone;cantilever left and right exposed;end vertical left and right exposed;C-C for members and forces&MWFRS for reactions shown;Lumber DOL=1.60 plate grip DOL=1.60 3)TCLL'ASCE 7-10;Pr=30.0 psf(roof live load,Lumber DOL=1 A 5 Plate DOL=1.15);Pg=50.0 psf(ground snow);Pf=36 5 psf(flat roof snow-Lumber DOL=1 15 Plate DOL=1.15),Category II;Exp B;Partially Exp.;Ct=1 1,Lu=50-0-0 4)This truss has been designed for greater of min roof live load of 12.0 psf or 1.00 times flat roof load of 38.5 psf on overhangs non-concurrent with other live loads. 5)Provide adequate drainage to prevent water ponding. 6)This truss has been designed for a 10 0 psf bottom chord live load nonconcurrent with any other live loads �P4� w• Jt7y� O�� 7)`This truss has been designed for a live load of 20.Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide will fit between the bottom chard and any other members. 8)Refer to girder(s)for truss to truss connections. '` r 9)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding i00 Ib uplift at jolnt(s)7. 10)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT atjt(s)2:This connection is for uplift only and does not consider lateral forces. 11)This truss has been designed fora moving concentrated load of 250.OIb live located at all mid panels and at all panel points along (P the Top Chord and Bottom Chord,nonconcurrent with any other live loads. ;g. - O�/ A• � 12)Graphical purlin representation does not depict the size or the orientation of the purlin along the top and/or bottom chord. Qp• .0 94�`�f (.� July 26,2019 ®WARNING-Verify design parameters and READ NOTES ON THIS AND INCWDEO fdITEK REFERENCE PAGE MMI-7473 ray.1010312015 BEFORE USE 0(016fi,411 forw;donlyadlhSrTumcanrwctere,o;Jeslnnlut,aaabonjy,uC'oft'f+ammdters_Itiuwu:curdlmforymfakwomt*iRtingComponent,_pq n tnuiaystani 6afa"ro uss,pio liull6inp d0s}pnurmui4wtir 11111 appryetitiilliynf d0alpn por,mature:tuff pra�nity inrrtrponitb tlrt C dahl0'n.INo piofoverNtr !f ` I+ipdinp deslp,9miinp indlratgd li to,provent kjuekllgp w1alitblunl puss web Ondtnr t:ho d yiombars only:%yddiilon5i'Iempataiyo0n p9!mMon16(ccfng, I ;, ��e ;, is al YLyyss rr"yuird 10r stobdily,anti to pic xn!colf<Paa%Ih pmpmo pc rand(tnjurypnd,prOpatiydlsrtege:Forgenomt p l;pnnct:tapardGi'y int,- - di ! faknicallq+,aluc p%dupvtlifyy.ereilfun and 4ryclnp of,t ifsses aril Huss ayatnma,sem AN6ttTP,la Qunllty Ciiterin,D59 GJ and BC319ulldfnp t3omponent 16023 Swingley Ridge Rd snfaly lrtfdrmulion trv011nhl¢fraot Ttzess PJnit lnsitu(a;'218 N,LaaSnaal,S"pita 312:/Uoxnntlria,V(t 22354, chesterfield,M0 63017 Job fuss Truss Type Qty Ply UP LDiNG D ROOF VINEYARD,VIEW 137938944 35970113 T25 Raol,Sgv'de1 1 1 Jab Reference,o ttaial) - Universal Component Corp., EAST;HAVEN CT 06512 8.010 s Aug 11 2017 Mil'r:k Indusltfes.16u.Thu Jul 25 23 16.10 2019 Page 1 ID.uH81G91AM9_WQEtKnavHVNyuWBg-KgR9Kgg 18ttdVdyx76n6ftP W RIxXYHJ3zfVlxyuNRp 0 00 8 -3 7-11 7-2-14 - - 10 1 4 512- — ---- e3_7.11 3-7-3 iii 8-2-2 — i Scale:lb 40 = 4 '1 13 5x8 O 4x4 = 12 , 14- tf 12.00 121x4 x� 10 .. 2 - - - -15-- 9 16 8 ,+ 17 18 7 3xB It 4x4 II ' 3x6 = 4x4 = 7.2.14 B•3.10'i i'a_ °iz - -� P1ate Offset$(X YD- 12 - LOADING (psf) SPACING- 2-0-0 CSI. DEFL. in (loc) I/def] L/d PLATES GRIP TCLL(roof) 30.0 Plate Grip DOL 1.15 TC 0 B6 Vert(LL) -0,19 2-9 >891 240 MT20 197/144 Snow(Pf/Pg) 38.5/50'b Lumber DOL 1 15 BC 0.63 Vert(CT) -0,25 2-9 >652 1B0 TCDL 10.0 Rep Stress Incr YES WB 0.49 Horz(CT) 0.01 7 rile n/a BCLL 0.0 Code IBC20151TP12014 Matrix-S weight:72 lb FT 20% BCDL 10.0 - _ - LUMBER- = BRACING- TOP CHORD 2x4 SPF No 2 TOP CHORD Structural wood sheathing directly applied or 5-11-1 cc purlins, BOT CHORD 20 SPF No 2 except end verticals,and 2-0-0 cc purlins(4-1-0 max)'5-6. WEBS 2x3 SPF No.2 BOT CHORD Rigid ceding directly applied or 10-0-0 cc bracing WEDGE WEBS 1 Row at midpt 6-7 Left:2x6 SPF No 2 REACTIONS. (ib/size) 7=823/Mechanical,2=939/0-5-8 Max Horz 2=257(LC 13) Max Uplift 7=-106(LC 11),2=-62(LC 14) FORCES. (lb)-Max,Comp./Max,Ten -All forces 250(lb)or less except when shown. TOP CHORD 2-3=-938/118,3-4=4061157,4-5=6761188,5-6=-467/139,6-7=-768/198 BOT CHORD 2-9=2951560,8-9=-187/471 WEBS 4-9=-181/690,5-9=-463/166,5-8=-43611 B5,6-8=-1691663 NOTES- 1)Unbalanced roof live loads have been considered for this design. 2)Wind-ASCE 7-10;Vult=130mph(3-second gust)Vasd=103mph,TCDL=6.Opsf,BCDL=6.Opsf,h=25ft,B=45ft;L=24ft;eave=4ft,Cat. 11;Exp B;enclosed;MWFRS(directional)and C-C Exterior(2)-0-10-8 to 2-1-8,Interior(1)2-1-8 to 7-2-14,Exter]or(2)7-2-14 to 8-3-10 zone;cantilever left and right exposed,end vertical left and right exposed;C-C for members and forces$MWFRS for reactions shown;Lumber DOL=1,60 plate grip DOL-1,60 3)TCLL.ASCE 7-10,Pr=30.0 psf(roof live load-Lumber DOL=1,15 Plate DOL=1:15);Pg=50.0 psf(ground snow);Pf=38.5 psf(flat roof snow-Lumber DOL=1.15 Plate DOL=115);Category II,Exp B;Partially Exp,;Ct=1.1,Lu=501-0-0 4)This truss has been designed for greater of min roof live load of 12,0 psf or 1.00 times flat roof load of 38.5 psf on overhangs �^ non-concurrent with other live loads. �G 0� Re 5)Provide adequate drainage to prevent water ponding. P P�W 6)This truss has been designed for a 10.0 psf bottom chord live load ncnconcurrent with any other live loads. JQy 7)'This truss has been designed for a five load of 20.Opsf on the bottom chord In all areas where a rectangle 3-6-0 tall by2-0-0 wide 4 is will fit between the bottom chord and any other members,with BCDL=10.Opsf. yr • �$ °`� �� 8)Refer to girder(s)for truss to truss connections. 1 9)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift at joint(s)except(jt=1b) 7=106. t B `.i LU 10)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT at)t(s)2.This connection is for uplift only (Sl and does not consider lateral forces. 11)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along ��Q �C/Q•099A I'• the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 12)Graphical purlin representation does not depict the size or the orientation of the puriin along the top and/or bottom chord. ' q�FEsstQ�'P July 26,2019 ®WARNING-Verily design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE Mil-7473 rev,10/0312015 BEFORE USE. 1?dsffpFvnffd 1 vii oil I akpltonnaclr+r.Tho dds)pn;ia uaeo i onlyppgn pnmeirvtars„„-h rwn and in la-an,indivtduai hpildf90 FOmpwtnnr;not t a V,Ussyyre r;8arp n u�0 till puilifmg dnWgnoi rmrri vodry lhn ftpp1,rah1111y Uf dhu n pnt-pai els apu'pI Polly it, onttL Ilil8dhbl{,n inlo 0}c a✓Ga l hund(ntldat30n.131nsinDilldluladtstepaavgnl�uCkillq,pfindivklnslLussar3/nntligrerwrtlmcmhcri+onlY i�,ddihariq(tarrl�grgryand�nrm9nenihdGlpp WOW }s hlwnya,rtlR�7gd iqr slith lilyaltd to provonI collapselv}11i raq�lldo hernongl tn)Ury and pm0.01y,tlt0nnD7 i•at general gUtdA}ite rellill4li+f111111 i .lnLricndon.niu ggUU 4URvorryy Q.,V-1 and luttttiig gr,trlli q and truss gyetlena'see AN9U'fPH_t2untlly Criteria;DSD•80 and Ocat euildin0 Component 16023 Svringley Ridge Rd SalslyfMormnllon avallabldrrofioTruspPlnlaYnntl9Uu1,2111 LoaSfrnit,Sullo312,i\laxnridifa;VA22314, Chesterfield,MO 53017 Job Truss TfussTyp0 Qty P•y BUiLDINGD ROOF-VfNEYARUvimv - 137938945,j 35970R3 T2.6 1`Rcaf social, 1 1 'Universal Component Corp,`, - EAST HAVEN CT 06512 8.010 s Aug 11 2017-MlTrik&rdustrfes,Inc,Thu Jul 25 23:16 11 2019 Page 1 ID.uH81G91AM9_%,NQE4,'in$vHVN'yu?hi8g-os?XYOhfgc?U7nX7h5MxfsQc?r1 hG_gSldP2HNyuNRo �id .3-7-1. x,1 -• -7-2-14 (- 0 1Q 8 3-7-11 -3-7.3 4-$ 6-9-10 6x6 \\ Scale=1:492 4 0x0 = 04 11 S' A3--. 6 { 11 12.00 12 1x4 \\ ! /Z�/ } 3 �3 q 4 23x8 1� -11 - 14 8 15 7 4x4 = 4x4 = 7.8.2 Plate Offsets FZY)= [2.Edae.0-0r71,f4:Ed9e:O=2-81,f6:Edpe,O 2 Bl LOADING (psf) SPACING- 2-0-0 CSI. DEFL. In (loc) I/defl L/d PLATES GRIP TCLL(roof) 30.0 Plate Grip DOL 1.15 TC 0.75 Vert(LL) -028 2-8 >603 240 MT20 1971144 Snow TCDL(Pf/Pg) 38.5/500.0 I Lumber DOL 1.15 BC 0 73 Vert(CT) -037 2-8 >462 180 BCLL 00 * Rep Stress Incr YES WB 0,53 Horz(CT) 0.01 7 n/a n/a BGDL 10.0 Code IBC2015/TP12014 Matrlx-S Weight:63 lb FT 20% LUMBER. BRACING- CHORD 2x4 SPF No.2*Except' TOP CHORD Structural wood sheathing directly applied or 5-B-15 cc purlins, 5-6.2x4 SPF 210OF 1.8E except end verticals,and 2-0-0 cc purlins(6-0-0 max.)-5-6. _ 'CHORD 2x4 SPF No.2 BOT CHORD Rigid ceiling directly applied or 10-0-0 cc bracing. WEBS 2x3 SPF No,2 WEBS 1 Row at midpt 5-7 WEDGE Left-2x6 SPF No.2 REACTIONS. (Ib/size) 7=823/Mechanical,2=939/0-5-8 Max Horz 2=265(LC 13) Max Uplift 7=-124(LC 11),2=-60(LC 14) FORCES. (lb)-Max.CompJMax Ten.-All forces 250(ib)or less except when shown, TOP CHORD 2-3=-922/115,3-4=-681/148,6-7=-332/90 BOT CHORD 2-8=-311/567,7-8=-203/457 WEBS 5-8=0/406,5-7=-618/187 NOTES- 1)Unbalanced roof live loads have been considered for this design, 2)Wind-ASCE 7-10,Vult=130mph(3-second gust)Vasd=103mph;TCDL=6.Opsf;BCDL=6.Opsf;h=25ft;B=45ft;L=24ft;eave=oft;Cat. II;Exp B,enclosed;MWFRS(directional)and C-C Exterior(2)-0-10-8 to 2-1-8,Interior(1)2-1-8 to 7-2-14,Extenor(2)7-2-14 to 7-8-2 zone,cantilever left and right exposed;end vertical left and right exposed;C-C for members and forces&MWFRS for reactions shown;Lumber DOL=1.60 plate grip DOL=1.60 3)TCLL•ASCE 7-10;Pr=30,0 psf(roof live Iliad Lumber DOL=1.15 Plate DOL=1.15);Pg-50.0 psf(ground snow);Pf=38.6 psf(flat roof snow Lumber DOL=1.15 Plate DOL=1.15),Category II,Exp B;Partially Exp,;Ct=1.1,Lu=50-0-0 4)This truss has been designed for greater of min roof live load of 12.0 psf or 1 00 times flat roof load of 38 5 psf on overhangsf Of Ne'�r, - non-concurrent with other live loads, 5)Provide adequate drainage to prevent water ponding. Q- tN JD/y . O 6)This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads 7)*This truss has been designed for a live load of 20.Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide will fit between the bottom chord and any other members,with BCDL=10.Opsf. * 2 8)Refer to girder(s)for truss to truss connections. 9)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift atjoint(s)except Ot=lb) 7=124. LU 10) One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT atjt(s)2.This connection is for uplift only ✓'_ and does not consider lateral forces, 11)This truss has been designed far a moving concentrated load of 250.Olb live located at all mid panels and at all panel points along Ogg43. the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 4"Graphical puriin representation does not depict the size or the orientation of the purlln along the top and/or bottom chord. QF�bsto July 26,2019 7fabncahon, RNING-Venry design parameters and READ NOTES ON THIS AND INCLUOEO WTEK REFERENCE PAGE MII.7473 rev.1010312015 BEFORE USE re vaCd for use oplynith MITOR000n01000.Tida,dostrinin based oniyupenpnramot�s snovin,and!p!�M rtn Jnr(irjduol,be'�4ing,eanlpnennt nct,syetnm,Before br,a,Iho bididm¢Ildd lirsnr must vnrdyeWjnncnt tuP4m8 j�(�n16 ge,delivery,erection and bracing or trusses and truss systems,sea `AHa1fTP11,61ungtyCrttarla,058.8$pnd HCS!eulldlnp Component 16023 Swingley Ridge Rd Informodam available from Truss Plate Institute,218 N Lee Street,Suite 312,Alexandria,VA 22314. Cheslarield,MO 63017 =obcuss TrusgType Qty Pry BUILDING D ROOF VINEYARDVIEW 13793B94627 Roof Special 1 1 job Reference(optional) _ 0 Upiversal CampurientCorp,, EAST HAVEN CT 06512 $.q1 0—s-Aug 112017 MiTek Industries,Inc.-Thu Ju12523:16,22019 Page i ID:uH81G9iAM9_WQEtKnavH VNyuW Bg-G3ZvlMIHbv7 Lkw6KFplAC4znlENX)SWcXH8bgpyuNRn .94M- -3-1-11_- 7-2.14 .7110:1 14-5-12 0 10 l 3.7.11 ; 3-7-3 - -9-7-3- E7-11 Scale=1 8x8 \\ 4 6x6 44 II - - -12, - kr 11 �� ii 12 00 12 1x4 \\ 10 3 N c, N 9 ,✓ _ 13 8 14 15 7 3x8 11 4x4 4x4 = = 14-5-12 ; - 7-10-1 - . _'6-r-11 - Plate Offsets(X,Y} 2t,Edge 0,0-74.Edoe+(L3.81. 6(•Edge tl 7.8 , - - LOADING (psf) i SPACING- 2-0-0 CSI. DEFL in (loc) Well Lld PLATES GRIP TCLL(roof) 30,0 Plate Grip DOL 1.15 TC 075 Vert(LL) -0.30 2-8 >559 240 i MT20 1971144 Snow(Pf/Pg) 38,5/50 0 Lumber DOL 1 15 BC 0.75 Vert(CT) -041 2-8 >416 180 TCDL 10,0 Rep Stress Incr YES WB 0 51 Horz(CT) 0.01 7 nla n/a BCLL 0.0 Code iBC2015/TP12014 I Matrix-5 Weight:621b FT 20% BCDL .10.0 LUMBER- BRACING- TOP CHORD 2x4 SPF Not*Except* TOP CHORD Structural wood sheathing directly applied or 5-8-8 cc purlins, 5-6.2x4 SPF 210OF 1-.BE except end verticals,and 2-0-0 cc purlins(6-0-0 max.)'5-6. BOT CHORD 2x4 SPF Not BOT CHORD Rigid ceiling directly applied or 9-9-4 cc bracing. WEBS 2x3 SPF Not WEBS 1 Row at micipt 5-7 WEDGE Left 2x6 SPF No.2 REACTIONS. (lb/size) 7=823/Mechanical,2=939/0-5-8 Max Horz 2=263(LC 13) Max Uplift 7=-119(LC 11),2=-61(LC 14) FORCES. (fb)-Max.CompJMax.Ten.-A((forces 250(ib)or less except when shown. TOP CHORD 2-3=915/115,3-4=-6721146.6-7=-333/90 BOT CHORD 2-8=-306/557,7-8=-1971453 WEBS 5-13=01397.5-7=-614/180 NOTES- 1)Unbalanced roof live loads have been considered for this design. 2)Wind ASCE 7-10;Vult=130mph(3-second gust)Vasd=103mph;TCDL=6 Opsf;BCDL=6.Opsf,h=25ft;B=45ft;-L=24ft,eave=4ft,Cat, Il,Exp B;enclosed;MWFRS(directional)and C-C Exterior(2)-0-10-B to 2-1-8,Interior(1)2-1-B to 7-2-14,Exterior(2)7-2-14 to 7-10-1 zone,cantilever left and right exposed;end vertical left and right exposed;C-C for members and forces&MWFRS for reactions shown;Lumber DOL=1,60 plate grip DOL=1,60 3)TCLL ASCE 7-10;Pr=30.0 psf(roof live load-Lumber DOL=1.15 Plate DOL=1.15),Pg=50,0 psf(ground snow);Pf=38.5 psf(flat roof snow Lumber DOL=1.15 Plate DOL=1,15),Category ll;Exp B,Partially Exp.;Ct=1 1,Lu=50-0-0 4)This truss has been designed for greater of min roof live load of 12.0 psf or 1.00 times flat roof load of 38.5 psf on overhangs Q� �� non-concurrent with other live loads, � �w July, r 5)Provide adequate drainage to prevent water ponding: 6)This truss has been designed for a 10.0 psf bottom chord live toad nonconcurrnnt with any other live loads. 7)'This truss has been designed for a live load of 20 Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide will fit between the bottom chord and any other members,with BCDL=10,Opsf. + cc B)Refer to girder(s)for truss to truss connections. 9)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 lb uplift at jolnt(s)except Ot=1b) i 7=119. 10)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT atjt(s)2:This connection is for uplift only and does not consider lateral forces � �O �98r��j" .'a� 11)This truss has been designed for a moving concentrated load of 250 Olb live located at all mid panels and at all panel points along A ,✓ the Top Chord and Bottom Chord,nonconcurrent with any other live loads, R� ` 12) Graphical purlln representation does not depict the size or the orientation of the purlin along the top and/or bottom chord. fiEss`�SL¢ July 26,2019 ®WARNING-Verify design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE Mll-7473 rev.1010312015 BEFORE USE. cam. - - ., �.._y�,l „,..,�;��;:Yw,w;,�l..,i11y f^r rirtl:sl4ld,�,t �n�,,, ntlrLvisD1,not' Daiilg5 Vhffd'fvr ago 0niy Wiui,:iiTder.,fu+j9_n"Cti+u-„ i{s"p-,v , w,it:p.�.,�..,�.. e puciaya!ap.Frelnrd lice uis hu ldlog du 7gnoenplpi Jutlty iho oppirwNuity of destgnpilramdserc End Wopsffy I'r cortmratn ilrfe itngn YnfO.thp W✓rv41r ? hl!tidinlj design-,eracin3Tddtcaled i:,iP Pravgitt+ueltU9D of ind6idrlol truss Web andfof r;fi94m=mtarq w4.A 0011 M f i:uti t&m(mglry,'r�d pmmullmil Mnclhg , ek 15 aha'aya required frsstahll11y0rd tp'pt"upn!'cp1lnlKa,Wilti pxsiblo putaon0l inju}y-oml prufii:hy HnmuOu.For r,}enural 0ulilance mg�ding 1ha falalta1i0r1„sioro!Iq ctoGvoryryamclidn.nnd brariftgnl trusses and nuns Dyutpma;tee, ANSUfP11 tg+rrtiiiy CMetIA,t1S6-8B and IIGRi BW_IdhiO Component 16023 Svnngley Ridge Rd Saftiy)niamtat(ori avafiniilel:nni,Trus4anticlnatlWta,2latJ.'LenSVobt Sulle�12 VA 22014,' �ChesterOeld,M063017 Job, russ r0631yp8— — Qty---,I Ply- BUILDING D ROOF-VINEYARD VIEW 137938947 3597083 28 RcofSpecla6 t, 1 Job Reference(optional -- - _ __ - - - - Universal Component Corp., - EAAT-HAVEN CTOBS12 —` -' - - -- - __8010 Aup,t,S 2017,MCCek Ihdtrklries$lie T(Iu,Jut 2523:16;5.32. 119 Page-l't ID;uI��fG°7At1B�t'OEi11490 J;Jyv�:'9,, I My;l:•3itDF>~ ShkyuNkhii 7fl•8 37 iT 7-2=14 8.5-91� i' 14.5.12- 108' �3•�T1= ;- - 3.7.3 - {,1'2=,11 -' - 60.3 4x4 = Scale 1/41' 4 13 5x8 \\ 44 = 12 IZ0o tz r 1x4 \\ 11 3 I / m 10 ' i i 2 -- =15` 9 16-8 17 18 7 3x8 11 3x8 = 4x4 = 44 II 7-2-14 6y9 , 14.5 T2: t 7-2 i - 11-2-11 Plate offsets(x)', L:Edg6.0.n st o:4.0,U2.6f,nzdOu.0;2-e — LOADING (psf) SPACING- 2-0.0 ? CSL DEFL. in (loc) I/deft L/d PLATES GRIP TCLL(roof) 30,0 Plate Grip DOL 1 15 ? TC 0,81 ,i Vert(LL) -0.19 2-9 >886 240 MT20 197/144 Snow(Pf/Pg) 38.5!50Lumber DOL 1 15 BC 0,64 i Vert(CT) -0,26 2-9 >647 180 TCDL 10..0 Rep Stress Incr YES WB 0,44 Horz(CT) 0,01 7 n1a n/a BCLL 0.0 Code IBC2015/rP12014 Matrix-S Weight,71 Ib FT=20% BCDL _10.0 LUMBER- --^` — BRACING- �CHORD 2x4 SPF No,2 TOP CHORD Structural wood sheathing directly applied or 5-11-1 or,purlins, r CHORD 2x4 SPF No,2 except end verticals,and 2-0-0 oc purlins(4-94 max.):5-6. --_BS 2x3 SPF No 2 BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing., WEDGE WEBS 1 Row at midpt 6-7 Left:2x6 SPF No 2 REACTIONS. (ib/size) 7=823/Mechanical,2=93910-5-8 Max Horz 2=255(LC 13) Max Uplift 7=-102(LC 11),2=62(LC 14) FORCES. (lb)-Max,Comp./Max Ten_-All forces 250(lb)or less except when shown. TOP CHORD 2-3=938/118,3-4=-7061158,4-5=-667/185,5-5=-4721137,6-7=-769/194 BOT CHORD 2-9=-289/559,8-9=-182/477 WEBS 4-9=-1781663,5-9=-433/162,5-8=-444/179,6-8=-1651672 NOTES- 1)Unbalanced roof live loads have been considered for this design, 2)Wind'ASCE 7-10;Vult=130mph(3-second gust)Vasd=103mph;TCDL=6.Opsf,BCDL=6.Opsf;h=25ft,B=45ft,L=24ft;eave=4ft,Cat. 11;Exp B;enclosed;MWFRS(directional)and C-C Exterior(2)-0-10-8 to 2-1-B,Interior(1)2,14to 7-2-14,Exterior(2)7-2-14 to 8-5-9 zone;cantilever left and right exposed;end vertical left and right exposed;C-C for members and forces&MWFRS for reactions shown;Lumber DOL=1.60 plate grip DOL=1 60 3)TCLL:ASCE 7-10;Pr=30 0 psf(roof live load"Lumber DOL=1.15 Plate DOL=1 15);Pg=50.0 psf(ground snow);Pf=38.5 psf(flat roof snow-Lumber DOL=1.15 Plate DOL=1 15),Category 11;Exp B;Partially Exp;Ct=1.1,Lu=50-0-0 4)This truss has been designed for greater of min roof live load of 12,0 psf or 1.001rmes flat roof load of 38,5 psf on overhangs non-concurrent with other live loads. !50F 'Ne 5)Provide adequate drainage to prevent water ponding. 6)This truss has been designed fora 10.0 psf bottom chord live load noncon current with any other live loads. �� . �Q1ty Q�Q 7).This truss has been designed for a live load of 20.Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide �. ��. �' •ij will fit between the bottom chord and any other members,with BCDL=10.0psr, * • - �� , 8)Refer to girder(s)for truss to truss connections. 9)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift at joint(s)except Qt=1b) 7=102. it 1 ll!' 10) One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT at jt(s)2.This connection is for uplift only and does not consider lateral forces. th 11)This truss has been designed for a moving concentrated load of 250,01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. OA 06.943��: 12)Graphical purlin representation does not depict the size or the orientation of the pudin along the top and/or bottom chord. July 26,2019 A WARNING-Vertfy design paramelers and READ NOTES ON THIS ANA INCLUDED MITEK REFERENCEPAGE MR-7473 rev 90/03/2015 BEFORE USE ate pe Design_vnrldtnrlireoaly�lth`!l4T+ik�icamberer:+..37PstferJgn'Istrse�ilc+ilyuponpwvi4alut4c[lnlvn,dndl4taranrndiuiduerbul3tRnpe4rltyonean,mol I �• i n'truns4ye? 119otu+6asa,ttrotlulfdrKi,dii'clglsar,mustrahfKlhaaPpUar4 tyofdoi fl; romaierunodpioOtlyleeprowillallli6daiatiInIntuntworali. •�fi1 IxIlldnpd Ipii,B}nstnptrd:catndlslap+dvenZtldrkNnpefthdrvrdunluusiwatia nUiordmcmbare'dnly;AddUtonnl'rnmperarynnr!'permhricdtWnUnq, MTNC` blivuym reyuirnd Ids Ofulrlllyand l011r1IvOra'[ofIAP3a 1v,tli pb;a;Ihlo pRrOnaAl InjllrydrNl pcapuity'dar0aryn„Fol Oagamt pv;danan rogardrng(Ka r 1nBricatiut;atoned,delWrk-y�21.'t teWh it and Wndnn 6rhussrs And truss eyatems,aoa, ItNSIIIPH-4uotlty CAtnrib,OSB,8'!altd'BCSI Building Component 16023 Swingley Ridge Rd 'Safety,Inremtiilioii 11011able kamTM."Plato faOuila,218 N;Votf Streat,Sedta,31 L Atatnpddn;VA 2291 i.- Chesterfield,MO 63017 Job Truse Tin"Type -- -Qty Ply BUILDING D,ROOF VINEYARD VIEW 137938948 3597083 T29 Roof Special 1 1 Jo b Rafefe ce(optional) Universal Component Corp., FAST HAVEN CT 06512— 8.010 s A*11,2017,MiTek industries,Inc. Thu Jul 25 23.16:)5 3019 Page 1 ID:uHBIG9fAM9_WQEtKnavHVNyu W Bg-geF2NOkAugVwbOgvwxQtpibH6SQvCrJ2DFNGQByuNRk Q 10• 3-741 7-2-14 ( _9.1-1 Q=10• 3-7-11- 3-7.3 1-10.3 5-4-11 Scale 1h 44 = 4 13 bxb 4x4 — 6 f 12• - 1 12.00 12 14 16 -'1x4 3 2 _ -- 16 9 17 B 18 7 . axe II 2x4 II 3x8 = 4x4 = ' 7-2-14 9.3-1 1 14-5-12 7-Ti4 -IIAD 5.4.11 - _P.(ate OfiSetS' X,'Yl— . i2:�dgF 0.0• 5[ -t)�1=i2 0=3•fJ -- _ - - LOADING (psf) SPACING- 2-0-0 CSI, DEFL. in (loc) Ildefl L/d PLATES GRIP TCLL(roof) 30,0 Plate Grip DOL 1.15 TC 0.74 Vert(LL) -0.20 2-9 >859 240 MT20 197/144 Snow(Pf/Pg) 38,5/50.0 Lumber DOL 1,15 BC 0,65 Vert(CT) -0 27 2-9 >627 18D TCDL 100 Rep Stress Incr YES WB 0.38 Horz(CT) 0,01 7 n/a n/a BCLL 010 Weight 69 Ib FT=20% BCDL _ i0.0 Code iBC2015/TP12014 Matrix-S _ LUMBER- _ BRACING- TOP CHORD 2x4 SPF No.2 TOP CHORD Structural wood sheathing directly applied or 5-11-2 oc purlins, BOT CHORD 2x4 SPF No.2 except end verticals,and 2-0-0 oc puriins(6.0-0 max)'5-6 WEBS 2x3 SPF No,2 BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing WEDGE Left 2x6 SPF No.2 REACTIONS. (Ib/size) 7=8231Mechanfcal,2=939/0-5-8 Max Horz 2=248(LC 13) Max Uplift 7=-85(LC 11),2=-64(LC 14) FORCES. (lb)-Max.Comp IMax.Ten.-All forces 250(lb)or less except when shown. TOP CHORD 2-3=-938/121,3-4=706/180,4-5=-6591175,5-6=-496/130,6-7=-772/178 BOT CHORD 2-9=-2691554.8-9=166/503 WEBS 4-9=-1 65/692.5-9=342/151,5-8=477/161,6-B=-1511713 NOTES- 1)Unbalanced roof live loads have been considered for this design. 2)Wind:ASCE 7-10,Vult=130mph(3-second gust)Vasd=103mph,TCDL=6,Opsf;BCDL=6.Opsf,h=25ft,B=45ft;L=24ft;eave=4ft;Cat. ll;Exp B;enclosed;MWFRS(directional)and C-C Exterlor(2)-0-10-8 to 2-1-B,Intenor(1)2-1-8 to 7-2-14,Exterior(2)7-2-14 to 9-1-1 zone;cantilever left and right exposed;end vertical left and right exposed;C-C for members and forces&MWFRS for reactions shown;Lumber DOL=1.60 plate grip DOL=1,60 3)TCLL-ASCE 7-10;Pr--30.0 psf(roof live load.Lumber DOL=1.15 Plate DOL--1.15);P9=50 0 psf(ground snow);Pf=38.5 psf(flat roof snow:Lumber DOL=1.15 Plate DOL=1,15);Category II;Exp B,Partially Exp.,Ct=1 1,Lu=50-0-0 4)This truss has been designed for greater of min roof live load of 12,0 psf or 1.00 times flat roof load of 38.5 psf on overhangs non-concurrent with other live loads. f.�� 5)Provide adequate drainage to prevent water ponding, �P� (h� �dti� O 6)This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads 7)"This truss has been designed for a live load of 20 Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide CoQ t� will fit between the bottom chord and any other members. 8)Refer to girder(s)for truss to truss connections. 9)Provide mechanical connection(by others)of truss to beanng,plate capable of withstanding 100 Ib uplift atloint(s)7. 10)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT at jt(s)2.This connection is for uplift only and does not consider lateral forces. 11)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along - the Top Chord and Bottom Chord,nonconcurrent with any other live loads, 12)Graphical purlin representation does not depict the size or the orientation of the purl,n along the top and/or bottom chord R�FEssI July 26,2019 ®WARNING-Verily design parameters and READ NOTES ON THIS AND INCLUDED IdITEK REFERENCEPAGE MI1-7473 rev.10/03/2015 BEFORE USE 1 -d3ss&3f14d,iillldru9$ti0lt't4�IhS,,'�iF'FcncG.,c:t%ra,7tc'e8,teri''.`tr.JcdCal }l'c;:urt"p9ran,tar�ahae,{i;anVfsrotu�lautvtdunihui'qufOsempwwar.n9s t atelaasy¢lan%ftoforauao,pu 6uldipflda�ignern{u varHytiprappfip I`Yratdealan0'n6matamandproipriytnwttwtntb011¢4016n1gi¢tnaWWII I atruiap,dcrJflfa Brseipfudralatli¢top,oventbtJatlrijtntlndividuaUusroah'yadlafdswdmombame§q:nddlqunar.uu+jfarruynuu>>9rmgnaulbrasnq d3W9yyaratp1'13(at al{lhlgly and Iapfiryaal M1,iU;•Ga tti7(a paGCIb1111x'iG,9R91 fnl9,y�f3f)prapaSty dtaTlaga.F9r 0enaml gu:danm rognrfl nil lira iabdcaUbn,¢imago,dolU nry,maetWn rrd li�sorra otuussat ddd`bU¢¢Cyt icrn¢.9a9- APESRIPH"QitalJty"erutarin,ttSB.99 bnd BCa)Butltltllg Component Chest S Chesterfield, y 6301idge Rd Snfety'Information avalla to itbmTraSs P ie l0at)tuta 2t8 fd:Lao Sir�%t,.S911Q��-'aasonjida„VA 2231q, � Chestedleld,M0 63017 w Sob ruS. woType' - - — — -' Qty Ply BUI DtNCaD ROOF VINEYARD VIEW V 137938949 �5970R3 30 RoafSpecial 1 1 Universal Component Corp-, EAST HAVEN CT 06512! - - — w- 18,010 s/Cyg,11 2017 M,Tek Industries,Inc.Thu Jul 25 23:16116 2019 Page 1 ID.uH81G9iAM9_INQEtKnavH VNyulAlBg-8gpQbllofBdnDYP5Ufy6Mw7 WWs1?xJSBSv6pzayuNR) Q+10•$ &? 1'f 7-T.-t4 -- -- 9 8.8' -14-5-12_ 0.10 3-7-11 44 = Scare 1/4^=r 4 13 12 6x6 4x4 = 12,00 12 '- � - 1x4 3. 10 2 16 -9 17 8 18 3x8 II 7 3x8 = 4x4 = 2x4 II 7-2-14 9 B•9 ,14-512---- - .Plate•Offsels X;Yt�___[2tEdae O-0.7] - LOADING (psf) SPACING- 2-0-0 CSI, DEFL. In (loc) I/def! L/d PLATES GRIP TCLL(roof) 30,0 Plate Grlp DOL 1 15 TC 0.50 Vert(LL) -020 2-9 >832 240 MT20 197/144 Snow(Pf1Pg) 38.5150.0 Lumber DOL 1 15 BC Q.66 Vert(CT) -0.28 2-9 >611 180 BCDL 10,0BCLL 0,0i ; Rep Stress Incr YES WB 0.32 Horz(CT) 0,01 7 nla n/a BCDL _ _ 10.0 i Code IBC2015/TPI2014 Matrix-S Weight 68 lb FT 20% LUMBER. -- --__-- -- - -_ --^ -_--- � _- BRACING- - - CHORD 2x4 SPF Not TOP CHORD Structural wood sheathing directly applied or 5-11-2 cc purtins, CHORD 2x4 SPF No 2 except end verticals,and 2-0-0 cc purlins(6-0-0 max.)-5-6 _S 2x3 SPF No 2 BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing. WEDGE Left'2x6 SPF No 2 REACTIONS. (Ib/size) 7=823/Mechanical,2=939/0-5-8 Max Horz,2=240(LC 13) Max Uplift 7=67(LC 11),2=-65(LC 14) FORCES. (lb)-Max Comp./Max Ten -All forces 250(lb)or less except when shown TOP CHORD 2-3=-938/123,3-4=-706/162,4-5=-664/163,5-6=-518/123,6-7=-776/163 BOT CHORD 2-9=-2461554,8-9=-151/527 WEBS 4-9=148/538,5-9=-299/141,5-B=-5101149,6-8=-139/751 0 NOTES- 1)Unbalanced roof live loads have been considered for this design, 2)Wind:ASCE 7-10,Vult=130mph(3-second gust)Vasd=103mph;TCDL=6.Opsf;BCDL=6.Opsf,h=25ft;B=45ft;L=24ft,eave=4ft;Cat. 11;Exp B;enclosed;MWFRS(directional)and C-C Exterior(2)-0-10-8'to 2-1-8,Interior(1)2-1-8 to 7-2-14,ExterlOT(2)7-2-14 to 9-8-9 zone:cantilever left and right exposed:end vertical left and right exposed;C-C for members and forces&MWFRS for reactions shown;Lumber DOL=1.60 plate grip DOL=1 60 3)TOLL-ASCE 7-10;Pr-30 0 psf(roof live load:Lumber DOL=1.15 Plate DOL=1.15);Pg=50 0 psf(ground snow);Pf=38 5 psf(flat roof snow:Lumber DOL=1.15 Plate D0L=1 15);Category 11;Exp B:Partially Exp;Ct=1 1,L-u=50-0-0 4)This truss has been designed for greater of min roof live load of 12.0 psf or 1.00 times flat roof load of 38.5 psf on overhangs non-concurrent with other live loads, of UE 5)Provide adequate drainage to prevent water pnnding. �j Yv �• 6)This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads. �� •holy - 0 7)'This truss has been designed for a live load of 20.Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide �i(J ,G will fit between the bottom chord and any other members, �i�• 8)Refer to girder(s)for truss to truss connections: 9)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift at joint(s)7. 10) One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT at jt(s)2.This connection is for uplift only and does not consider lateral forces., t� t 11)This-truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 12) Graphical purlin representation does not depict the size or the orientation of the purlin along the top andlor bottom chord. 9�' Q�j9433 ',• '� �Q6ESS1 July 26;2019 ®WARNING-Verify design paramelers and READ NOTES ON THIS AND INCLUDED MITEKREFERENCE PAGE AIR-7473 rev.1010312015 BEFORE USE. U Desipa•11 anti'Idruse'onty wbli A$akficomirewi¢'rWs des[gn ld Bantle duty upbn Faintentetst;hpml,unit N'tor an litdiY)duaf Inilldn0 camprincoti not a�Uds.nyatat+t`.'Bofatu Usu'U/O IiuiCdnO r+aeignrrmttat t4nfy Ilio at pgat6i0ty at dool0n pjramotons and propae Oln6rtltir+il5 thip&S516+Ion>a ovpndl u;llldurbdeelgn,Bras(npltdfratddlitRprovertibu kpnQ�l -I'-ldr+nlliUuwe[sund+olChOsdnloii6615oitty;Addtt. .1t"nipdtary(mtdpamtltnoinlirndmJ' fy, ��kr fsd[wayamyutreulaNsintd111yluullbpro�runtccIT.-Aewllhpa*<Sl6loptiraopdilniut�•Nvl{u+tpnrtydprjtega:Forgencral$u111anc6rclttirtlwgthu -- iabriintioopp=itlorago,delilro y.mccL�n and tiring of wssev a*;d hJ s nya vftts:r oe ANSIr(Pfi rivallty Cdlcrta,QSa sg and BC9i Bulldlu'a Component 16023 Swingley Ridge Rd $ntety InT6rm.11 n nualfaBla tion,Trus ilta laattuia.:18 Nit a$S1rs L4 bp1tO312,.J�fnkpitddo,VA?23td„ Cheslertleld,MD 63D77 JoGTruss TttI5s Typo - Qty Phr BUILDING D ROOF VINEYARD VIEW 137936950 1 1 �597QR3 31 RoofSpecial job Reference o tional - - --- Universal Component Corp., EAST HAVEN CT 06512 - 3.0(,Ds Aug 11 2017 MiTek Industries,Inc.Thu d11L2S•?3:16;17 2019 Page 1 ID:uH81G91AM9-WQEtKnavHVNyuW Bg-cOMDo3mQQSlen_H2MTLu7girF56gmQLgZsMVI yuNRi QQ 10�t1 3=7.111 =i4 104-1 tl•.tU•E31 3-7-11 3-7 3 3i- 1��)° 1-1=71 scale.1h 4x4 4 F/ 1 13 2 6x6 = 4x64 1x4 = 12.00 12 �� 11 - rx -t - - 3 / -'�14' 16 9 10 ,2' 16 17 e 18 7 3x6 II 2x4 II 3x8 = 4x4 = 7-2-14 —I-- LOADING LOADING (psf) SPACING- 2-0-0 CSI. DEFL. rn (loc) I/defl Ud PLATES GRIP TCLL(roof) 30.0 Plate Grip DOL 1.15 TC 0.40 Vert(LL) -0 21 2-9 X809 240 MT20 197/144 Snow(Pf/Pg) 38.5/50.0 Lumber DOL 1.15 BC 0.66 Vert(CT) -0.28 2-9 ,599 180 TCDL 10.0 Rep Stress Incr YES WB 0.27 Horz(CT) 0,01 7 n/a n/a BCLL 0.0 Code IBC2015/TPI2014 Matrix-S Weight,66 Ib FT=20% BCDL -10.0 _ LUMBER- BRACING- TOP CHORD 2x4 SPF Not TOP CHORD Structural wood sheathing directly applied or 5-11-1 oc purlins, BOT CHORD 2x4 SPF No 2 except end verticals,and 2-0-0 oc purlins(6-0-0 max.)*5-6 WEBS 2x3 SPF No,2 BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing WEDGE Left:2x6 SPF No 2 REACTIONS. (Ib/size) 7=8231Mechanical,2=939/0-5-8 Max Horz 2=232(LC 13) Max Uplift 7=49(LC 11),2=-67(LC 14) FORCES. (lb)-Max.Comp/Max Ten.-All forces 250(lb)or less except when shown TOP CHORD 2-3=937/124,3-4=-705/163,4-5=679/152,5-6=-540/117,6-7=-781/149 BOT CHORD 2-9=-222/553,8-9=138/551 WEBS 4-9=130/495,5-9=-2741136,5-8=544/140,6-8=-131/791 NOTES- 1)Unbalanced roof live loads have been considered for this design. 2)Wind ASCE 7-10;Vult=130mph(3-second gust)Vasd=103mph,TCDL=6,Opsf,BCDL=6.Opsf,h=25ft,S=45ft;L=24ft;eave=4ft;Cat. 11;Exp B;enclosed;MWFRS(directional)and C-C Exterior(2)-0-10.8 to 2-1-8,Interior(1)2-1-8 to 7-2-14,Exterior(2)7-2-14 to 10-4-1 zone;cantilever left and right exposed,end vertical left and right exposed,C-C for members and forces&MWFRS for reactions shown;Lumber DOL=1.60 plate grip DOL=1 60 3)TCLL:ASCE 7-10;Pr=30 0 psf(roof live load*Lumber DOL=1,15 Plate DOL=1.15);Pg=50 0 psf(ground snow),Pf=38 5 psf(flat roof snow:Lumber DOL=1,15 Plate DOL=1 15),Category 11;Exp B,Partially Exp;Ct=1.1,Lu=50-0-0 4)This truss has been designed for greater of min roof live load of 12 0 psf or 1 00 times flat roof load of 38 5 psf on overhangs non-concurrent with other live loads,• Q� �� 5)Provide adequate drainage to prevent water ponding. �� J0., yQ� 6)This truss has been designed for a 10,0 psf bottom chord live load nonconcumen t with any other live loads. . 7)'This Ini9R has been designed for a live load of 20 Opsf on the bottom chord in ali areas where a rectangle 3-6-0 tall by 2-0-0 wide will fit between the bottom chord and any other members. *• • tin �2, /r 8)Refer to girder(s)for truss to truss connections. �f{ y L 9)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift at joint(s)7, 10)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT at jt(s)2.This connection Is for uplift only I i; I fLf and does not consider lateral forces. � Sb *� 11)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 12) Graphical purlin representation does not depict the size or the orientation of the purlln along the top and/or bottom chord, SFS$11 July 26,2019 ®WARNING-Venfy design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE MII.7473 rev.1010312015 BEFORE USE t�ts9'y)f oatirf iqr U4e afiiy+ntiiit,2Niiftw+tol�� r"=+�a,w uriy',i in t=cd,oolrav ol<01.p7r:77f ySL'c«,v::ff.:7n0,1.!or.J0up V tcuel4lEitRlflg gftlrall^Rt,lf^1 � •�� £ n Inisasyrebfom 4se. sU_n, 1110IfeT04,0 dadigrmf must y,0drylhn npnllcabNy o(dnaign pnmmnloru and pinperty Incnrpurard pili dnulgn insr to®ouarall i M'Tek, buNdtnndeslpn.BrcinglndiralndtsrofavlanUuC9lL7pQlUd:vtdn((ililuussvJuLw7dfar,ehofdinnmbbrSanly,AddHicnnircmp0ruryurulpn7rnnnof'lbraeina # ISO Waya lvgWrad Iorsm11113V Darepapl In01r/and MTpenyd0mage.For g0ncrpl,tiuldor.ce rc6sirding thu faCdGalltm.n:brallo,dofl6yry-a ssliafi gni t7n n0 of nassesa+7d lt7ssa3yslarna,suo +A"Sln p11 4uality Cffled11,osB•9g and Bcsi auvdiing Component 16023 Swingley Ridge Rd Snrely,lnre"rmol[on avhlfa6ln��nlTnrssptntofrmtiloln.:18t4t1 oSrreeL`S7f11o312:A1nxnnRda VA 22314, Caaasledield,MO63017 Job Truss Truss Type Qty ;Ply BUILDING D ROOF VINEYARD VIEW - i,i 137938951 597OR3 T32 Roof Special 1, 1 Job Reference to tional Universal Component Corp„ EAST HAVEN CT 06512 8.010 s Aug 11 201 M)T-el IndUatrles44no. Thu Ju1,25 23,18:18 2019 Page 1-— ID uH81G91AM9_WQEtKnavHVNyuWBOCwAOPm2AItVTrZUb3_aRLDliafRGPDQUv'Dbw1TyuNRh {!•1Li 8_ �_.3 7=1]_ - __ 7-2•td mw -mm:10=11-9: _ 1)10• 3-7-11 —,3_7 — —3-8-11 - 4x4�=a Scale,1/4"=1' 4 1213 i 12 00 12 1x4 11 14 6x6 = 4x4 = 3 -- 8 18 111 - 10 o f 2 V 17 -9 - 19 8 19 - - 3x8 I 7 3x8 = 4x4 = 1 x4 11 -- - --'7-244 ._ _ 10.119-— ---- ._ 14-5-12- _ 3-8-11 x3.0.3 Plate Offasts,(X,YI- 2( .Ed ze 0.0-71 — LOADING (psf) SPACING- 2-0-0 CSI,, DEFL. in (loc) I/clef! L/d PLATES GRIP TCLL(roof) 30,0 Plate Grip DOL 1,.15 TC 0.34 Vert(LL) -021 2-9 >791 240 MT20 197(144 Snow(Pf/Pg) 38.5/50.0 Lumber DOL 1,15 BC 0.67 Vert(CT) -0,29 2-9 >590 180 BCDLL 10,0 0,0 Rep Stress Incr YES WB 0.29 Horz(CT) 001 7 n/a n/a BCDL _ 10.0_ Code IBC20151TP12014 Matrix-S Weight:65 Ib FT=20% - - --- _ LUMBER- BRACING- 'CHORD 2x4 SPF No.2 TOP CHORD Structural wood sheathing directly applied or 5-11-1 oc purlins, F CHORD 2x4 SPF No 2 except end verticals,and 2-0-0 oc purlins(6-0-0 max) 5-6 BS 2x3 SPF No.2 BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing. WEDGE Left,2x6 SPF No 2 REACTIONS. (Ib/size) 7=823/Mechanical,2=93910-5-8 Max Horz 2=224(LC 13) Max Uplift 7=-35(LC 14),2=-68(LC 14) FORCES. (Ib)-Max.Corn pJM ax;,Ten.-All forces 250(Ib)or less except when shown. TOP CHORD 2-3=-937/122.3-4=-705/161.4-5=7001139.5-6=-562/110.6-7=785/136 BOT CHORD 2-9=-197/552,8-9=-127/576 WEBS 4-9=-1 091460,5-9=-262/130,5-8=582/137,6-8=-1261836 NOTES- 1)Unbalanced roof live loads have been considered for this design„ 2)Wind,ASCE 7-10,Vult=130mph(3-second gust)Vasd=103mph,TCDL=6.Opsf;BCDL=6,Opsf;h=25ft;B=45ft;L=24ft;save=4ft;Cat. II;Exp B;enclosed,MWFRS(directional)and C-C Exterior(2)-0-10-8 to 2-1-8,Interior(1)2-1-8 to 7-2-14,Exterior(2)7-2-14 to 10-2-14,Interior(1)10-11-9 to 14-4-8 zone;cantilever left and right exposed;and vertical left and right exposed;C-C for members and forces&MWFRS for reactions shown;Lumber DOL=1,60 plate grip DOL=1.60 3)TCLL.ASCE 7-10;Pr-30 0 psf(roof live load Lumber DOL=1.15 Plate DOL=1.15);Pg=50 0 psf(ground snow);Pf=38 5 psf(flat roof snow Lumber DOL=1,15 Plate DOL=1.15),Category ll;Exp B,Partially Exp.;Ct=1.1,Lu=50-0-0 4)This truss has been designed for greater of min foof live load of 12.0 psf or 1.00 times flat roof load of 38 5 psf on overhangs non-concurrent with other live loads. ` 41F NEtti 5)Provide adequate drainage to prevent water ponding- iriV 6)This truss has been designed for a 10-0 psi bottom chord live load nonconcurrent with any other live loads. 7)'This truss has been designed for a live load of 20 Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide S will fit between the bottom chord and any other members. vw= d 8)Refer to girder(s)for truss to truss connections, 9)Provide mechanical connection(by,others)of truss to bearing plate capable of withstanding 100 Ib uplift at iolnt(s)7 10)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT at Jt(s)2.This connection is for uplift only ! and does not consider lateral'forces. 11)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads: F O. 12)Graphical purlin representation does not depict the size or the orientation of the pudin along the top and/or bottom chord. �A. �A,'45 !� . July 26,2019 ®WARNING-Vcrity design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCEPAGE M11-7473 rev,1010312015 BEFORE USE Design valid for use only with MiTek®connectors.This design Is based only upon parameters shown,and is for an individual building component,not a truss system.6efore use,the building designer must venfy the applicability of design parameters and properly incorporate this design into the overall - budding design,Bracing indicated is to prevent buckling of individual truss web and/or chord members only.Additional temporary and permanent bracing WIN is always required for stability and to prevent collapse with possible personal injury and property damage For general guidance regarding the _ fabnratlon,storage,dalNeryryerection and bracing of trusses and truss systems,see AN51lr1311 Quality criteria,DSB-89 end BCSI Building Component 16D23 SWingley Ridge Rd Safety Information uvai'!a fromTruss Plate Institute,21 B N Lee Street,Suite 312,Alexandria,VA 22314: I Cheslemald,MO 63017 Job russ -- - -- TnICs Typa - - - Qty pry BUILDING D ROOF VINEYARD VIEW 137938952;1 35970R3 T33 Roa!-Speciale ? 1 _ Job Reference(cotional) Universal Component Corp„ EAST HAVEN CT 06512 `" 8 010 s Aug-11 2017 MiTek Industries,Inc. Thu Jul 25 23;16;19 2019 Page 1 IO.uH81G91AM9_WQEtKnavHVNyuWBg-ZPUYDIngx37M4?Bg9nVp YI2A3nS8fQdBtLTavyuNRg 0.10: 3•T-ii 7 2 i4 11-7-1 r 54.5 12i t}-1Q.g 0.7_17 3-7-3 r 4A,3 2-1041 4x4 = Scale 4 12 13 12,00 12 1x4 \\ 11 14 3 6x6 = 4x4 = 6 10 {{ 2 - _ - 16 9 17 8 18 ' 3xB II 7 3x8 = 4x4 = 1x4 II 7-2•ta 11-7.1 Ut512 7-2-14- - Sr1.3 2-10.11 -- LOADING (psf) SPACING- 2-0-0 CSI. DEFL. in (loc) Weill L/d PLATES GRIP TCLL(roof) 30,0 Plate Grip DOL 1.15 TC 0.41 Vert(LL) -D.22 2-9 >775 240 MT20 197/144 Snow(Pf/Pg) 38,5/50,0 Lumber DOL 1.15 BC 0.67 Vert(CT) -029 2-9 >585 180 TCDL 100 Rep Stress Incl YES WB 0.30 Horz(CT) 001 7 n/a n/a BCDL_ 10,0 Code IBC2015[TP]2014 Matrix-S Weight'63 Ib FT=20% LUMBER- — - BRACING- TOP CHORD 2x4 SPF No,2 TOP CHORD Structural wood sheathing directly applied or 5-11-0 oc purlins, BOT CHORD 2x4 SPF No,2 except end verticals,and 2-0-0 oc purlins(6-0-0 max) 5-6 WEBS 2x3 SPF No,2 BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing WEDGE Left 2x6 SPF No.2 REACTIONS- (Ib/size) 7=823/Mechanical,2=93910-5-8 Max Harz 2=217(LC 13) Max Uplift 7=-35(LC 14),2=-69(LC 14) FORCES. (lb)-Max Comp/Max Ten.-All forces 250(lb)or less except when shown. TOP CHORD 2-3=-937/120,34=-705/159,4-5=724/128.5-6=-584/105,6-7=791/121 BOT CHORD 2-9=1701552,8-9=-1 191603 WEBS 4-9=-89/445,5-9=-261/131,5-8=-625/138,6-8=-125/885 NOTES- 1)Unbalanced roof live loads have been considered for this design. 2)Wind ASCE 7-10,Vult=130mph(3-second gust)Vasd=103mph,TCDL=6 Opsf;BCDL=6.Opsf;h=25ft,B=45ft;L=24ft;eave=4ft;Cat. 11,Exp B,enclosed,MWFRS(directional)and C-C Extefici(2)-0-10-8 to 2-1-8,Interior(1)2-1-8 to 7-2-14,Extenor(2)7-2-14 to 10-2-14,Intenor(1)11-7-1 to 14-4-8 zone;cantilever left,and right exposed,end vertical left and right exposed;C-C for members and forces&MWFRS for reactions shown,Lumber DOL=1 60 plate grip DOL=1,60 3)TCLL.ASCE 7-10;Pr=30.0 psf(roof live load:Lumber DOL=1 15 Plate DOL=1.15);Pg=50.0 psf(ground snow),Pf=38,5 psf(flat roof snow,Lumber DOL=1-15 Plate DOL=1 15),Category II,Exp B;Partially Exp.;Ct=1 1,Lu=50-0-0 4)This truss has been designed for greater of min roof live load of 12.0 psf or 1.00 times flat roof load of 38 5 psf on overhangs non-concurrent with other live loads. �{ of NFA Y 5)Provide adequate drainage to prevent water ponding, V 6)This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loadsQ`0�� JO�� 7)"This truss has been designed for a live load of 20 Opsf on the bottom chord In all areas where a rectangle 3-6-0 tall by 2-0-0 wideCO 31� ? will fit between the bottom chord and any other members, 8)Refer to girder(s)for truss to truss connections '3 Z 9)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift atjoint(s)7. 10)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT at)t(s)2 This connection is for uplift only 'UJ and does not consider lateral,forces, v dx ` _ J 11)This truss has been designed for a moving concentrated load of 250 Olb live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads, �� O - �., 12)Graphical puriin representation does not depict the size or the orientation of the purlin along the top and/or bottom chord, a 990 SS10� July 26,2019 A WARNING-Verify design parameters and READ NOTES DN THIS,4ND INCL U^ED P+f1TEK REFERENCE FACE MIF7473 rev 10/0312015 BEFORE USE. atzifin vhltrl for use poly with MiTetx4[ag mart,Ttils dedan is tvlgnd lily upon paramolar`nphowo,and is for an Individual building component,not a IreBs'syntorn Befordt6so,the building aunvioi mirt;t varif•�,the npplir.11blity,of design wafllatort mid property Incorporate this design into the overall ,n buildingdwgn. Bra&oIndicated Istoltrtiventho`rAhgClIftdivirtdtllIlussweb and/or chard members only.Additional temporary and permanent bracing �A iVliTek is always required,for stability and to prevent cdiapse'wnh possible personal injury and property damage,For general guidance regarding the fabrication,rdorage,delivery,erection end bracing of trusses and truss systems,we ANSIfrPl1 Quality Criteria,DSB-89 and BCSI Building Component 16023 Swingley Ridge Rd Safety Informalloni available from Truss Plate institute,218 N Lee Street,Suite 312,Mexendna,VA 22314 Chesterfield,MO 63017 Jobruss-- ' - - TnissType — -` "' Qty Ply BUILDING D ROOF VINEYARD VIEW 137938953, 35970R3 34 Roof Special 1. 1 Job Reference(optional), _ Universal Comporunt Corp., EAST HAVEN CT 06512• - - .$.010 s.Aug,11 2017 MiTek Industries,Inc.Thu Jul 2523:8:212019 Page 1 ID.uH81G9n4M9_W QEtKnavHVNyuWBg-VncJeRpxTgF3KJ 13H CXH 3zrQKtTrcZxwbBgaeoyuNRe 10-10.1 = 12-2-9_-: -14.5-12. •iQ H; 3-7-11 -;3-7-3 3-7-3 40- Scale:1W--1' 4 �.. 13 -� 14 1200 121x4 \\ 15 12 1x4 �i 3 5 16 4x4 = 44 = N 3x8 11° 18 10 19 9 20 8 3x6'= 44 = 1x4 I! 7-2-14 12-2-9 7-2A4 4.11-4i. _Plate Offsets{X Y (2 ^d e 0 0.77 [Fi:O.7.•0 LOADING (psf) SPACING- 2-0-0 CSI. DEFL i"n (loc) Ildefl L/d PLATES GRIP TCLL(roof) 300 Plate Grip DOL 1 15 TC 0.31 Vert(LL) -0.23 2-10 >748 240 MT20 1971144 Snow(Pf/Pg) 38.5/50.0 Lumber DOL 1.15 BC 0.68 Vert(CT) -0,29 2-10 >578 180 TCDL 10,0 Rep Stress Incr YES WS 0.30 Horz(CT) 0,01 8 n/a n/a BCLL BCDL 10'0 k Code ISC2015ITP12014 Matr,(x-S Weight'62 lb FT 20% - --- =- - - LUMBER- BRACING- 'CHORD 2x4 SPF No,2 TOP CHORD Structural wood sheathing directly applied or 5-11-1 oc purlins, F CHORD 2x4 SPF No'.2 except end verticals,and 2-0-0 oc purlins(6-0-0 max.)'6-7. ___3S 2x3 SPF No,2 BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing. WEDGE Left'2x6 SPF Not REACTIONS. (lb/size) 8=823/Mechanical,2=939/0-5-8 Max Horz 2=209(LC 13) Max Uplift 8=-34(LC 14),2=-70(LC 14) FORCES. (lb)-Max.CompjMax.Ten,-All forces 250(lb)or less except when shown. TOP CHORD 2-3=-940/119,3-4=-707/159,4-5=-707/143,5-6=-788/108,6-7=603/81,7-8=-790/111 BOT CHORD 2-1 0=-1 421554,9-10=-102/576 WEBS 4-10=-116/475,5-10=-266/141,6-9=-6131125,7-9=-121/880 NOTES- 1)Unbalanced roof live loads have been considered for this design. 2)Wind:ASCE 7-10,Vult=130mph(3-second gust)Vasd=103mph:TCDL=6 Opsf;BCDL=6 OpsY,h=25ft;B=45ft;L=24ft;eave=4ft;Cat, Il;Exp B;enclosed,MWFRS(directional)and C-C Extenor(2)-0-10-8 to 2-1-8,Interior(1)2-1-8 to 7-2-14,Exterior(2)7-2-14 to 10-2-14,Interior(1)12-2-9 to 14-4-8 zone;cantilever left and right exposed;end vertical left and right exposed;C-C for members and forces$MWFRS for reactions shown;Lumber DOL=1.60 plate grip DOL=1.60 i 3)TCLL ASCE 7-10;Pr=30.0 psf(roof live load:Lumber DOL=1.15 Plate DOL=1.15);Pg=50.0 psf(ground snow);Pf=36.5 psf(flat roof snow:Lumber DOL=1 15 Plate DOL=1.15);Category Il;Exp B;Partially Exp.;Ct=1.1,Lu=50-0-0 4)This truss has been designed for greater of min roof live load of 12.0 psf or 1.00 times flat roof load of 38.5 psf on overhangs non-concurrent with other live loads, 5)Provide adequate drainage to prevent water ponding. V �' 6)This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads. 7)'This truss has been designed for a live load of 20.Opsf on the bottom chord In all areas where a rectangle 3-6-0 tall by 2-0-0 wide will fit between the bottom chord and any other members. 8)Refer to girder(s)for truss to truss connections. 9)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift at)olnt(s)8. 10)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT at jt(s)2.This connection is for uplift only and does not consider lateral forces. tn., LU 11)This truss has been designed for a moving concentrated load of 250.0Ib live located at all mid panels and at all panel points along + the Top Chord and Bottom Chord,nonconcurrent with any other live loads. O- ' 12)Graphical purlin representation does not depict the size or the orientation of the pudin along the top and/or bottom chord. •a��43,�. -�j y ,.- RaFFSS1Q�P July 26,2019 ®WARNING-vmfy design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE M11-7473 rev.10/032015BEFDRE USE 4 hrsta+iunlnl!m_uuudnlywltll,flJTclC cimnnttcra TittudlJytt7abneo4antyuponpammotehcattovm;andIsforranlndSyiduplpaisdngcomponant,ngt, �• a Uti3�e}morn;8gforn uac,ilio bvllding dentgOpralaot vprifythtrriPptltnt�titytof dnaign pafamaUmsand„raP iii Imao+p mto dili dnutpn into tKo wendf- p-p;�- 6uUfUtp'd8/ncfnpindlsnlnd(sloptnvwdburktlitpo6tvdlvldbafuusa'xbbandldrel2nrdMemhar�onll/•.Addlttanatlgmpa5ly/mdpemtmcrtfbradtlp MiTeik, I tG'atµmyaregpiradYe`rStatnlityOntllapmvant.uolloP-se5vlthpga9binpurx4i}n�inurY�ndfropgttvdmm�,•�,Fxflnmm�tpi+ioniesrepant+niluls fahiicttll Sn,at�rarm:'dultutt y,pfn�fbin and bft�utg a)hdssoaeaduie es ayatano,ilea`. NFStfiP11 Ctuntlty ChttoHa,DSG•69 and,tlCBfauitdtn®'Component 16023 swmglay Ridge Rd 8ofdfy,lnforinna”. o iWa iota G+mr Trampiotr3 tnah�t 3:21e N,Lec Slleor;SJN4 3i_?„ltamRdda.V(<?2811; Chestameld,MO 63017 Job russ Truss Type Qty PlyBUILDING D"ROOF VINEYARD VIEW — 137938954� i 3597OR3 35 TWO S'pt ciii. 1 1 _ _ __ - - _ Job'Reference tcAtionl Universal Component Corp„ EAST HAVEN'6706512, -8,010 s Aug 11'2817•MiTek Industries,Inc.`Thu Jul 25 23:16'22 2019 Page'1 ID.uH81G9iAM9-WQEtKnavHVNyuW _Bg-zAhrnpZE_NwxTtFgv2W bBNb3G p1 L044grZ7AEquNRd -1 3-7-41- - _,_ 7•?.-tA'=_�l - _111-104- _ 12•it7�'12 1 14 6 -7-f 1 f=r:3 3-7,3 .2.0.0 1-7-11 4x4 Scale V A 13 14 12.00 12 1x4 \\ 12 15 1x4 3 5 ry 16 44 = 4x4 = 7 N [V Q 2 10 19 9 20 3x6 11 8 3x8 = 4x4 - 1x4 II 7-2-14 12-10-1- 114-EA2 7-2-14 _ -- 5:1-3 _ ( 1=T1 �-- --- —- -'-•- - -- Plate Offsets(X Y,)-- 17'Edge 0-D 71 6'0 2-8 tF 3 Al LOADING (psf) SPACING- 2-0-0 CSI. DEFL. in (loc) I/deft L/d PLATES GRIP TCLL(roof) 30.0 Plate Grip DOL 1.15 TC 0.31 Vert(LL) -0,23 2-10 >727 240 MT20 197/144 Snow(Pf/Pg) 38-5/500 Lumber DOL 1.15 BC 0.58 Vert(CT) -0.30 2-10 >572 18D TCDL 10,0 Rep Stress Incr YES WB 0.31 Horz(CT) 0.01 8 rue n/a BCLL 0,0 Code IBC2015/TPI2014 Matrix-SWeight 61 Ib FT 20% BCDL 10.0 LUMBER- BRACING- TOP CHORD 2x4 SPF No.2 TOP CHORD Structural wood sheathing directly applied or 5-11-1 oc purlins, BOT CHORD 2x4 SPF No.2 except end verticals,and 2-0-0 oc purlins(6-0-0 max.)'6-7 WEBS 2x3 SPF No.2 BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing. WEDGE Left 2x6 SPF No,2 REACTIONS. (ib/size) 8=8231Mechanical,2=939/0-5-8 Max Horz 2=201(LC 13) Max Uplift 8=-33(LC 14),2=-70(LC 14) FORCES. (lb)-Max Comp/Max,Ten.-All forces 250(lb)or less except when shown. TOP CHORD 2-3=-940/119,34=-708/158,4-5=706/144,5-6=8 181110,6-7=-609162,7-8=798/93 BOT CHORD 2-10=-1131554,9-10=-84/572 WEBS 4-10=-1151474,5-10=-259/142,6-9=-636/121,7-9=-107/902 NOTES- 1)Unbalanced roof live loads have been considered for this design. 2)Wind'ASCE 7-10;Vult=130mph(3-second gust)Vasd=103mph;TCDL=6.Opsf,BCDL=6.Opsf;h=25ft,B=45ft;L=24ft;eave=4ft;Cat, II;Exp B;enclosed;MWFRS(directional)and C-C Exterior(2)-0-10-8 to 2-1-8,Intenor(1)2-1-8 to 7-2-14,Exterior(2)7-2-14 to 10-2-14,Intenor(1)12-1 DA to 14-4-8 zone,cantilever left and right exposed;end vertical left and light exposed;C-C for members and forces&MWFRS for reactions shown,Lumber DOL=1 60 plate grip DOL=1.60 3)TCLL ASCE 7-10;Pr=30 0 psf(roof live load:Lumber DOL=1,15 Plate DOL=1.15);Pg=50 O psf(ground snow),Pf=38 5 psf(flat roof snow Lumber DOL=1.15 Plate DOL=1 15);Category 11,Exp B;Partially Exp.;Ct=1.1,Lu=50-0-0 4)This truss has been designed for greater of min roof live load of 12.0 psf or 1.00 times flat roof load of 38.5 psf on overhangs non-concurrent with other live loads. QF NE 5)Provide adequate drainage to prevent water ponding. v JO 6)This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any otherlive loads. 7)`This truss has been designed for a live load of 20.Opsf on the bottom chord In all areas where a rectangle 3-6-0 tall by 2-0-0 wide 4 4 will fit between the bottom chord and any other members. " ilk � �• �L' 8)Refer to girder(s)for truss to truss connections. 9)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift at joint(s)8, !^ u 10)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT at jt(s)2,This connection Is for uplift only c .� and does not consider lateral forces. 11)This truss has been designed for a moving concentrated load of 250.O1b live located at all mid panels and at all panel points along 2 " the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 12)Graphical purlm representation does not depict the size or the orientation of the purlin along the top and/or bottom chord- dA -4,09, .,09,,9, July 26,2019 ( ®WARNING-Verify design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE MII.7473 rev 1010312015 BEFORE USE I • Design valid W use only wilh MITOk'nmeoaoeciors.This design!,bas,=d anly upon paramalein!Quin),and is for an individual building component,not F a truss system Before use,the bulldlag designer must verify the appltdubtity of design pGnmNnin znd properly incorporate this design into the overall N' budding design.Bracing indicated is to,prevent buckling of Individual truss web and/or chord members only.Additional temporary and permanent bracing MiTeW i is always required for stability and to prevent collapse with possible personal injury and property damage-For general guidance regarding the folu"on.aiorarm'delivery,erection and bracing of trusses and truss systems,see ANSIrIVII Quality Criteria,DSB•69 and BC81 Building Component 16023 Swmgley Ridge Rd SolotylnformtRlon available from Truss Plate Institute,216 N Lee Street,Suite 312,Alexandria,VA 22314, Chesterfield,MO 63017 Jobruss ---'- '- Truss Type '-- - Qty " - Pty BUILDING D ROOF VINEYARD VIEW 85970113 �36 I Roci5pecial 1 1! ( 137938955 _'1 jots Reference'C tl nal' - Universal CoMponent Corp, EAST HAVEN`Cl`05512-- -8.010 s Aug 112017 MiTek Industries,Inc,',Thu JUI25 23,16-23 2019 Page 1 ID.uH8109iAM9 WQEIKnavHVNyuWBg-RAk337gB7IVnZdSROdal8Owmmg8C4SOD3VJhjgyuNRc p 10-8 1�7.11_ - 7.2-14 1fY 1Lii-_ 13=54 tfyQ-S' �-�7•.$0;-" --'"E.'"._.3-73r ,3=7.3 { 27B •If��,3�. 4x4 = Scale=1 49,9 4 13 14 12.00 12 1x4 12 ` 15 ��.. 5x4 / 3 ` \ '` 16 4x4 = 11 v 44 = , 2 f,R' ) rb 3x8 II 18 10 19 9 20 8 3x8 = 1x4 II 44 = 77-14- _13•'`x9 - �a=5=i� 7=2-14------ 8-2.11. -.PlafcOffsetsfXY1- `2EdgarO•f7-71 6:0=2.0'0-311 - - - — - --- - LOADING (psf) SPACING- 2-0-0 CSI: DEFL. in (]or) I/deft L/d PLATES GRIP TCLL(roof) 30.0 Plate Grip DOL 1 15 TC 0.31 Vert(LL) -0.24 2-10 X712 240 MT20 197/144 Snow(Pf/Pg) 38 5/50.0 Lumber DOL 1.15 BC 0.68 Vert(CT) -030 2-10 >566 180 TCDL 10.0 Rep Stress Incr YES WB 0.33 Horz(CT) 0,01 8 n/a n/a BC • 10.0 Code IBC2015/TPI2014 Matrix-S _Weight:59 lb FT 20% BER- - -" - - - - BRACING- CHORD 2x4 SPF No.2 TOP CHORD Structural wood sheathing directly applied or 5-11-1 oc purlins, But CHORD 2x4 SPF No.2 except end verticals,and 2-0-0 cc puriins(6-M max.)'6-7 WEBS 2x3 SPF No.2 BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing. WEDGE Left'2x6 SPF No 2 REACTIONS. (Ib/size) 8=823/Mechanical,2=939/0-5-8 Max Horz 2=193(LC 13) Max Uplift 8=33(LC 14),2=-71(LC 14) FORCES. (lb)-Max CompJMax.Ten,-All forces 250(lb)or less except when shown. TOP CHORD 2-3=-940/117,3-4=708/156,4-5=7041149,5-6=-855/115,6-7=-627/47,7-8=-828/66 BOT CHORD 2-10=-63/555,9-10=-63/571 WEBS 4-10=-113/471,5-10=-255/144,6-9=-670/127.7-9=-92/957 NOTES- 1)Unbalanced roof live loads have been considered forthis design. 2)Wind:ASCE 7-10;Vult=13Omph(3-second gust)Vasd=103mph;TCDL=6.Opsf;BCDL=6.Opsf;h=25ft;B=45ft;L=24ft,eave=oft;Cat. 11,Exp B,enclosed;MWFRS(directional)and C-C Exterior(2)-0-10-8 to 2-1-8,Interlor(1)2-1.8 to 7-2-14,Exterior(2)7-2-14 to 10-2-14,Interior(1)13-5-9 to 14-4-8 zone;cantilever left and right exposed;end vertical left and right exposed;C-C for members and forces&MWFRS for reactions shown;Lumber DOL=1 60 plate grip DOL=1,60 3)TCLL:ASCE 7-10;Pr=30.0 psf(roof live load-Lumber DOL=1,15 Plate DOL=1,15),Pg=50.0 psf(ground snow);Pf=38.5 psf(flat roof snow-Lumber DOL=1 15 Plate DOL=1 15);Category II,Exp B;Partially Exp.;Ct=1 1,Lu=50-0-0 4)This truss has been de'slgned for greater of min roof live load of 12.0 psf or 1.00 times flat roof load of 38.5 psf on overhangs non-concurrent with other live loads, G! of Nl� 5)Provide adequate drainage to prpvpnt water ponding. 6)This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads, �� J 7)"This truss has been designed for a live load of 20 Opsf on the bottom chord In all areas where a rectangle 3-6-0 tall by 2-0-0 wide will fit between the bottom chord and any other members. 8)Refer to girder(s)for truss to truss connections. 9)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift at joint(6)8, CL' 10)'One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT at It(s)2.This connection is for uplift onlyUJI @_ and does not consider lateral farces. 11)This truss has been designed for a moving concentrated load of 250,01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. 12)Graphical purlin representation does not depict the size or the orientation.of the purlin along the top and/or bottom chord. Q ., ,O99i433 Qjr %S July July 26,2019' ®WARNING-Verify design parameters and READ NOTES ON TN15 AND INCLUDED MITEK REFERENCE PAGE Mir-7473 rev 1010312015 BEFORE USE. Oitj;nVs0t1lot, aNyrlOrR1FTrkDcannecworsTtiltrlcal�n,toboddoaly0ponp¢ramotorosltawh;ar> Ts,ix,onindwiduSlGaldln9cgml nantAFol' atro¢ssyAlctrl.bot6mD,n,IhgftgUqg,daeJOnaraqiioi,y 1hdAppliptillltyafda;,fjnp�rnmftisiantlpropa�ttylnu+parslettva'iladitininlFAtd/tu�-n�_ �tEY1 FmlfilingdrslDn>1lrrtlri9fddlcn[edialopravnriitivcJtnO'nfindvfddatuiiv�Uendtorelmritmnnrtrarri'urdl/Addit7oualfmnpar�yandpdrmarionl6rasiptl: ' f( i¢at�isyproRultt�dforsfngiltyoipftfipiov¢nteail�psevnthpagsiblappraonf�linluryundpropaifytdymvJn,Far11pd0Mpridntixre9tntuigBt4.- 1aFxicnOaF,ntur ja;dal{uur;Frsct4pn ,db fru sn7 nh3 hus#nymama,nda- ANS"Pl7 Qudl ty 6ritedd,089.89¢rid aCs{13utidiA(�Component 18023 Swmgley Rldga Rd satatylnfoiinanon dual!¢�tn,tfdmTruasPlarairauado.zl6N,Lees{real,5uao312,Atmmidrh,VA223,bt, ` Cheslerfleld,Mos3or7 Job fuss - ` - - Trus57yps Qty 'Ply BUILDING D ROOF VINEYARD VIEW 137938956' §5970R3 7 Rbof Spec3f3h 1 1 _ oh Reference notional) _ Universal Component Coffi„ EA37MA EN CT 06512 8.010 s Aug 112017 MiTek Industries,Inc. Thu Jul 25 2316125 2019,Pago 1 ID:uH81G9iAM9_WQEtKnavHVNyuWBg-NZrpUosRXvmVowbgW2cDDp?6NUgcYPvW WoonnZyuNRe ��10 3 7-117'2'1'1 10-7-15 14.1-1_ 1415512 •U 10 :)7.11 — 3-7� j 3 5;1 — (` 3.5-1 0.4.11 Scale= 44 s 13 14 12,00 12 1x4 \\ 12 15 4x4 \\ 5 3 16 f ! - {0x10 — r 'c 3xB It 17 10 18 9 6 3x0 = [ 7-2-1414-1-1 - 14.5 2 _ -7-2- _ _ 610.3 P:f, _ - 'Plato Olfsets(X Y)— LOADING (psf) SPACING- 2-0-0 CSI, DEFL. in (loc) I/dell L/d PLATES GRIP TCLL(roof) 30.0 Plate Gnp DOL 1 15 TC 030 Vert(LL) -0,24 2-10 >695 240 MT20 197/144 Snow(Pf/Pg) 38.51500 Lumber DOL 1.15 BC 069 Vert(CT) -0.31 2-10 >555 1B0 TCDL 10.0 Rep Stress Incr YES WB 0-18 Horz(CT) 0.01 B n/a n/a BCLL 0.0 ' Code IBC2015TTP12014 Matrix-S Weight SB ib FT=20% ,8Cdh '10,4 - - LUMBER- BRACING- TOP CHORD 2x4 SPF No.2'Except* TOP CHORD Structural wood sheathing directly applied or 5-11-3 cc purlins, 6-7:2x4 SPF 210OF 1 BE except end verticals,and 2-0-0 cc purlins(6-0-0 max.).6-7. BOT CHORD 2x4 SPF Not BOT CHORD Rigid ceding directly applied or 10-0-0 cc bracing. WEBS 2x3 SPF No,2*Except* 7-8,2x4 SPF 210OF 1.8E,6-9.2x4 SPF No.2 WEDGE Left 2x6 SPF No,2 REACTIONS. (Ib/size) 8=621/Mechanical,2=936/0-5-8 Max Horz 2=185(LC 13) Max Uplift B=-32(LC 14),2=-71(LC 14) FORCES. (lb)-Max,Comp/Max Ten.-All forces 250(lb)or less except when shown. TOP CHORD 2-3=9351116,3-4=-702/155,4-5=-6921155,5-6=-904/116,6-7=-660/47,7-8=-771/0 BOT CHORD 2-10=-52/553,9-10=-34/559,8-9=-64/563 WEBS 4-10=-118/476,5-10=-255/148,6-9=-77/507 NOTES- 1)Unbalanced roof live loads have been considered for this design., 2)Wind,ASCE 7-10,Vuit--130mph(3-second gust)Vasd=103mph,TCDL=6.Opsf;BCDL=6.Opsf;h=25ft,B=45ft;L=24ft,eave=oft,Cat, 11,Exp B;enclosed,MWFRS(directional)and C-C Extenor(2)-0-10-8 to 2-1-8,Interior(1)2-1-8 to 7-2-14,Exterior(2)7 -2-14 to 10-2-14 zone;cantilever left and right exposed,end vertical left and right exposed;C-C for members and forces&MWFRS for reactions shown,Lumber D0L=1 60 plate grip DOL=1.60 3)TCLL.ASCE 7-10,Pr=30.0 psf(roof live load,Lumber DOL=1,15 Plate DOL=1,15);Pg=50.0 psf(ground snow);Pf=38 5 psf(flat roof snow:Lumber DOL=1.15 Plate D0L=1 15);Category II;Exp B;Partially Exp,;Ct=1.1,Lu=50-0-0 G of,NEW 4)This truss has been designed for greater of min roof live load of 12.0 psf or 1.00 times flat roof load of 38.5 psf on overhangs non-concurrent with other live loads. 5)Provide adequate drainage to prevent water ponding. 6)This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads 7)'This truss has been designed for a live load of 20.Opsf on the bottom chord In all areas where a rectangle 3-6-0 tall by 2-0-0 wide will fit between the bottom chord and any other members. C' 1 8)Refer to girder(s)for truss to truss connections, w. 9)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift at joint(s)B. fn i 10)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT at jt(s)2.This connection is for uplift only it Y and does not consider lateral forces. O 11)This truss has been designed for a moving concentrated load of 250 Olb live located at all mid panels and at all panel points along �� .09g4`�3 <fi the Top Chord and Bottom Chord,nonconcurrent with any other live loads. F 12)Graphical purlin representation does not depict the size or the orientation of the pudin along the top and/or bottom chord. SS1� July 26,2019 WARNING-Verify design parameters and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE M11-7473 v.10103/2015 BEFORE USE. Vasign,vDRd for use only lwlh MiTek@ r rinnOdom ThsideWltin is bored only upon ppmmotomshovm,a4d k for pmindividuNretnitldiri j CVrrtpunu0ts tint a trUsr,ny;IM Before 0.0 the bugding,d b/gl?er rftt.t vrldry)he t ppN abil ly of des}gv pjr�aietrje nJid p Dpeily Inrery0rd[0 ditg'dutilpn/rite 1110 alrrag bugdidpdft'(gn.Bract/igindicated Is torxcvmdbucW9ofindwidual,trissweb rvidlorShard,pientbersMly,Addliloraltomparafynnlipmmanonfbrldria MGM(, is always required forstabili and to prevent collapse with possible personal mlury,zurw ilin_*Vaty domdgn.For�cgca ti al guldanrpgardktg otofabrication,storage,delivery,erection and bracing of trusses and truss systems,sea " ' AHSIITP,111Qp41 t 6hh rlal 9)S13-q9 and 66c91,euildIris Component 15023 Swingley Ridge Rd Safely Information available from Truss Plate Institute,218 N Lee Street,Suite 312,Alexandria,VA 22314. Chesterfield,MO 63017 Job cuss - �-- rtissType — -- Qty ply BUILDING D ROOF VINEYARD VIEW i 1 137938957r 95970R3 38 Common t! 1 Job Reference(otitional Universal Component Corp„ 'EAST HAVEN CT 06512 - _ - - B.g10,s Aud 1,7,2017•MiTFik.Industnes,Inc.Thu Jul 25'23:1627,2019,PEC96%1 fO:uH81Cg1fIhls�WUEil654V�igir+rt)Bu-,PG4 vdth INOG'LEl�dSeldE4NKHVPo8opi6HusSyuNRY II10 0 IQ-$ 5G-1100--1111, i 1i1i-5.13 17-1.0 22.712- -10-7 573 39y.75-tO t20•7.3, 5-7-3 Scale=176A 3,75 12 5x6 27 2B 3x8 6 8 &B 265r _ ii _ 9 29 % 4 6x12 10 3x1O 25, .-..r^ - 30 6x12 3x10 % 3 % 115x12 MT18H zz 23 24 /! ; 31 32 13 t 1� 12 33 -- 34 35 20 36 =37 !16 38 39 - 4'0-ry� � 6x12 = 22 21 19 18 17 15 14 6x12 = 2x4 It 5x12 MT1BH= 5xB = 5x12 MT18H = 2x4 III 13.5=13 17-1-0 + 22.0-2 20.34 33-10-7 33-5 10 45-4-4. 57-3 `--�i•T3 , .__ 57.3, -- - 57-3 5"7.3; "" ; Plato Offsets(X,Yi _ :0.0 0 0=2:zj,I 2'4�7-OA•1=8jr(3:0 4-13,0 3-0),!11:0 413+0-3.01.[12:0.0.0;0.3 r1 - _ - LOADING (psf) SPACING- 2-0-0 CSI. DEFL. in (]cc) I/def! Ud PLATES GRIP TCLL(roof) 30.0 Plate Grip DOL 1.15 i TC 0,60 Vert(LL) -062 18-19 >871 240 MT20 197/144 Snow(Pf/Pg) 38.5/50.0 { Lumber DOL 1.15 BC 0.73 Vert(CT) -0.96 18-19 >567 180 MT18H 197/144 BCLL TCDL10 10 0 Rep Stress Incr YES WB 0,85 Horz(CT) 0.34 12 n/a n1a SCOL 10:0 Code IBC2015/TP12014 Matrix-S Weight,200 Ib FT=20% BER- BRACING- CHORD 2x4 SPF 210OF 1.8E TOP CHORD Structural wood sheathing directly applied or 2-6-11 oc purlins. BOT CHORD 2x4 SPF 210OF 1 8E BOT CHORD Rigid ceiling directly applied or 10-0-0 cc bracing: WEBS 2x4 SPF No,2 WEBS 1 Row at midpt B-18,6-18- SLIDER -18,6-18SLIDER Left 2x4 SPF No.2 6-0-5,Right 2x4 SPF No,2 6.0-5 REACTIONS. (Ib/size) 2=2738/0-5-8,12=2738/0-5-8 Max Horz 2=77(LC 14) Max Uplift 2=137(LC 16),12=-137(LC 16) FORCES. (lb)-Max.Comp./Max.Ten,-All forces 250(lb)or less except when shown. TOP CHORD 2-3=-6779/434,3-4=-6213/438,4-6=-5342/419,6-7=43571392,7-8=-43571392, 8-10=-5342/419,10-11=-6213/438,11-12=-6779/434 BOT CHORD 2-22=-363/6291,21-22=-363/6291,19-21=-31615858,18-19=-24915022,17-18=-245/5022, 15-17=-311/5858,14-15=-360/6291,12-14=-360/6291 WEBS 7-18=-105/2042,8-18=-1678/127,8-17=01716,10-17=-1064/86,10-15=0/404, 11-16=-493/53,11-14=0/360,6-18=-1678/127,6-19=0/716,4-19=-1084/86,4-21=01404, 3-21=-493153,3-22=0/360 NOTES- 1)Unbalanced roof live loads have been considered for this design. 2)Wind:ASCE 7-10,Vult=130mph(3-second gust)Vasd=103mph;TCDL=6,Opsf;BCDL=6.Opsf;h=25ft;B=45ft;L=24ft;eave=6ft;Cat Il,Exp B;enclosed;MWFRS(directional)and C-C Exterior(2)-0-10-8 to 2-1-8,Interior(1)2-1-8 to 22-8-2,Exterior(2)22-8-2 to 25-8-2 zone,cantilever left and right exposed;and vertical left and right exposed;C-C for members and forces&MWFRS for reactions shown,Lumber DOL--1.60 plate grip DOL=1 60 3)TCLL ASCE 7-10;Pr=30.0 psf(rooflive load,Lumber DOL=1,15 Plate DOL=1.15),Pg=50.0 psf(ground snow);PF38.5 psf(flat or- NE' / roof snow.Lumber DOL=1.15 Plate SOI=1 15);Category Il;Exp B,Partially Exp.;Ct=1,1 4)Unbalanced snow loads have been considered for this design„ 5)This truss has been designed for greater of min roof live load of 12-0 psf or 1.00 times flat roof load of 38 5 psf on overhangs Q s' non-concurrent wllh other live loads 6)All plates are MT20 plates unless otherwise indicated, 'k 7)All plates are 3x6 MT20 unless otherwise indicated. i' CG 8)This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads. W 9)'This truss has been designed for a live load of 20,Opsf on the bottom chord In all areas where a rectangle 3-6-0 tall by 2-0-0 wide will fit between the bottom chord and any other members, 10)One RT4 USP connectors recommended to connect truss to bearing walls due to UPLIFT at jt(s)2 and 12.This connection is for �� . �O. SON- `' uplift only and does not consider lateral forces, d.G3_ 0994% 4- This truss has been designed for a moving concentrated load of 250,OIb live located at all mid panels and at all panel points along /S? the Top Chord and Bottom Chord,nonconcurrent with any other live loads. S. Julj 26,2019 ® WARNING-Verify design paramefers and READ NOTES ON THIS AND INCLUDED MITEK REFERENCE PAGE MIf-7473 rev 1010312015 BEFORE USE D la iIdtausa'unlyNlttif!lTelaalcrraieelnn-Thirdesi�nlsbnuddonly,uddn'peramole sndrm,dndisfaranlntllvidUnfl.lAdng,rAipl74norir,+aF r .1IMBNelyslepi,p0 1b,0sa,lhnbulidipg,rladlgppr{rlur•)arsfif{r cg a ppllCabiftyordaslpnapmmnietznrelpreHa+YiAewPrieminlxd0ii,lnuilathaaueaar tt twRllnpdrslgrt,tiro-.IngiruJl'ratnd mi;re<ler{ib4'okl�+R� A�idOelt+usstJelr'a,edloichard5nomba'rionlS.Add7rForarrnmp<ien�i'Cnlf oimenonibradng iV11T�k, ilriefwaytrruqutrodtorstpbill>yttnd'Soptnvspi'co)tnpaew9ipaast�)o[t�ta0na,j yiiryaafq,firoRe!iyJnmopq Fa0e8orof,p itlunrurardmfllN,+ lnl3tfcallrm,oxer„UG delteeryy neer qn ap8 b ad+htet uusse apd tlosssyM1 im,ltle, fWBIrTPH Q4dllty Grrferin;OSti 84 and UC9)BUIIdIt10 Lompanent 16023 Swingley Ridge Rd Sdtaly fnionrmtlon uvailubfo'SrgmTru&•t MOto 1nn14t016}7.18 N;LeA$170n1.Sdiler 3i?.hrnxpndrin`,VA'123ta_, Cheslerfeid,Mo 63017 ; obcuss Truss Type Qty PN BUILDING D ROOF VINEYARD VIEW 137938958 35970R3 Vol Valley 2 1 Job-Reference(optional -Universal Component-Corp., ""'" EAST HAVEN CT 06512" - - 8.010s Aug 112017 MITek Industries,Inc.Thu 4125 28:16.- 7019 Page 1 IDuHBIG91AM9 WOEtKnavHVNyuWBg-o8Xy6quKgga4fOKPBAgwrSdaohw6lmcyCmOSOuyuNRX 5.4.5 10-8-12 — - -5.$•6- � 3 4-8, 5x6 11 Scale= 2 12.00 12 / �- /7/ • g 10 - • 4x4 / 11 4 12 4x4 1x4 11 ,0,01, 10+8.72 LOADING (psf) SPACING- 2-D-0 CSI. DEFL. in (loc) ;I/deft L/d PLATES GRIP TCLL(roof) 30.0 Plate Grip DOL 1 15 TC 0.48 Vert(LL) n/a n/a 999 MT20 197/144 Snow(Pf/Pg) 38 5/50.0 Lumber DOL 1 15 BC 0.45 Vert(CT) n/a n/a 999 TCDL 1010 Rep Stress Incr YES W8 0,18 Horz(CT) 0.00 3 n/a nla BCLL 0.0 Code IBC2015(rP12014 Matrix-S Weight 321b FT=20% 9`CDL - LUMBER- BRACING- TOP CHORD 2x4 SPF No.2 TOP CHORD Structural wood sheathing directly applied or 6-0-0 cc purlins, BOT CHORD 2x4 SPF No.2 BOT CHORD Rigid ceding directly applied or 10-0-0 oc bracing. OTHERS 2x3 SPF No.2_ REACTIONS. (Ib/size) 1=356/10-8-4,3=356/10-8-4,4=462110-B-4 Max Horz 1=-113(LC 12) Max Uplift 1=-33(LC 14),3=-33(LC 14) FORCES. (lb)-Max Comp./Max Ten.-All forces 250(lb)or less except when shown. TOP CHORD 1-2=-320/84,2-3=-320184 WEBS 2-4=-292149 NOTES- 1)Unbalanced roof live loads have been considered for this design.- 2)Wind-ASCE 7-10;Vult=130mph(3-second gust)Vasd=103mph;TCDL=6.0psf;BCDL=6.Opsf;h=25ft;B=45ft;L=24ft;eave=4ft;Cat. 11,Exp B;enclosed,MWFRS(directional)and C-C Extencr(2)04-4 to 3-44,Interlor(1)3-4-4 to 54-6,Extenor(2)54-6 to 84-6 zone;cantilever left and right exposed;end vertical left and right exposed;C-C for members and forces&MWFRS for reactions shown;Lumber DOL=1.60 plate grip DOL=1 60 3)TCLL.ASCE 7-10,Pr=30 0 psf(roof live load:Lumber DOL=1-15 Plate DOL=1,15),Pg=50 0 psf(ground snow),Pf=38.5 psf(flat roof snow:Lumber DOL=1.15 Plate DOL=1 15);Category Il,Exp B;Partially Exp,;Ct=1,1 4)Gable requires continuous bottom chord bearing. 5)This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads 1 6)"This truss has been designed for a live load of 20.Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide will fit between the bottom chord and any other members. 7)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift at Joint(s)1,3 8)This truss has been designed for a moving concentrated load of 250.0Ib live located at all mid panels and at all panel points along G1F NS1,r, the Top Chord and Rottnm Chord,nonconcurrent with any other live loads, �y O v� LU c��,Q °•09945 ' 4r� R�FESS1 + July 26,2019 ®WARNING-Verily design parameters and READ NO TES ON THIS AND INCLUOED bfITEK REFERENCE PAGE M11-7473 rev.1010312015 BEFORE USE i 17Ca)1rr vtifdlfuruse crJy"'.1;A17TekG^'d0z:n lora This duSinn is based only uptm perapltijans Eaoy/fi,'u^ii to fnra91n3Viduril W00rtp comAnrl9pi,nol a� almspsyrlitm,Belo ra,use,the bu0dtgg deslgnar,mW vanfqq,the applicablldy of dnailln ltrittanbijr�t8 and gtop&y phis design Intl)lila atardll p Lvddlnp d igti.Braeirl0 0iOmted k to preaenl Imrghit of indNidual truss web e"tidf6t chCrd mbmOtir only-Addltiaml inmperory and pomianord liracmg MiTek is always iequired for stability and to prevent collapse with possible personal injury pal propariy,dRhrinOe,tint 90twIl1814111 ve fegaldiral IIIb' fabrication,storage,daiivory,erection and bracing of irusses and truss systems,soe ANSIrfPN aunllty,ciitbtlo,Os$-88 hind Beni 8u11t7ng,Component 16023 Swingley Ridge Rd safety infonnetion mallable from Truss Plate Institute,218 N Lee Street,Suite 312,Alexandria,VA 22314 Chesterfield,MO 63017 Job i Truss - Truss Type _ - Qty"=` 1ply BUtWING D ROOF VINEYARD VIEW 1379389591 B597OR3 V02 Valley 2 1 Job Reference o la 61� lfulversml Component Corp.,, EAST HAVEN_CT 06512= — "''"" — _ — 8.010 s Aug 11 2017 MiTek IfidustdOs,Inc;Thi,Ju)25 23.16:29 2019 Page 1 ID•uH81G91AN18 WQEtKnavHVNyUWBg-GK5KJAvybBGxHYvbitg9OfAn151QUFy6RQm7wKyuNRW 3.4-6 '6.8-12' 3-4-6 -- - 3.4-6 Scale,1/2°=1' 4x4 2 12,00 12 y' I 5 i -1 lo,. t V i O ,I' :lY+-hwa•;- _-_ --- _t''.r,�.e,.•=;r-....w.a�sn, Y=.v 4 •-! 2x4 // 7 1x4 It 8 2x4 O t;•a.s _ s-a-12� _ LOADING (psf) I SPACING- 2-0-0 CSI. DEFL. in (loc) ►/deft L/d PLATES GRIP TCLL(roof) 30 0 Plate Grip DOL 1.15 TC 0,33 Ved(LL) n/a n/a 999 MT20 197/144 Snow(PflPg) 38 5/50.0 Lumber DOL 1.15 BC 0,25 Vert(CT) n/a - n/a 999 TCDL 10,0 Rep Stress Incr YES WB 0.04 Horz(CT) 0.00 3 n/a n/a BCLL 0.0 Code IBC2015/TPI2014 Matrix-S Weight-20 Ib FT=20% acDl i1 o -- - _ — LUMBER- -- BRACING- CHORD 2x4 SPF No.2 TOP CHORD Structural wood sheathing directly applied or 6-0-0 oc purlins. CHORD 2x4 SPF No,2 BOT CHORD Rigid ceiling directly applied or 10-0-0 oc bracing. v i nERS 2x3 SPF No.2 REACTIONS. (Ib/size) 1=230/6-8-4.3=230/6-8-4,4=244/6-8-4 - Max Horz 1=68(LC 12) Max Uplift 1=29(LC 14),3=-29(LC 14) Max Grav 1=315(LC 33),3=315(LC 35),4=360(LC 38) FORCES (lb)-Max Comp,/Max.Ten,-All forces 250(ib)or less except when shown NOTES- 1)Unbalanced roof live loads have been considered for this design,; 2)Wind ASCE 7-10,Vult=130mph(3-second gust)Vasd=103mph,TCDL=6.Opsf;BCDL=6.Opsf:h=25ft;B=45ft,L=24ft;eave=4ft,Cat 11;Exp B,enclosed,MWFRS(directional)and C-C Exterior(2)zone;cantilever left and right exposed;end vertical left and right exposed;C-C for members and forces&MWFRS for reactions shown,Lumber DOL=1.60 plate gnp DOL=1x60 3)TCLL•ASCE 7-10;Pr=30.0 psf(roof live load,Lumber DOL=1.15 Plate DOL=1.15);Pg=50 0 psf(ground snow);Pf=38.5 psf(fiat roof snow•Lumber DOL=1.15 Plate DOL=1.15),Category Il;Exp B;Partially Exp;Ct=11 4)Gable requires continuous bottom chord bearing. 5)This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads. 6).This truss has been designed for a live load of 20.Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide will fit between the bottom chord and any other members. 7)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 Ib uplift at joint(s)1,3. 8)This truss has been designed for a moving concentrated load of 250.0111,live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. ' r m• r r Lu p99�33' SSI�� July 26,2019 ®WARNING-Verity design paramefers and READ NOTES ON THIS AND INCLUDED MREK REFERENCE PAGE M11-7473 rev 10103/2015 BEFORE USE �' OkWilfl yulld for use Dilly Wth fdi7dkEr`obllnat4a^,TWd6slfln,s bbsoo only upon 1tbr8matam sh6Ap,;9nd Id 1tw,�ml individual building C0114ipltdni,nor. �. tS in a cyaiom Betora usn,tho butldkrO das�ngr glurt,vw�tythe applErabnity of doatpn Pammatom pnd proyadytnrrxvordto U6n datLnLn llitsiwaritl hutlilltOdaJg'n Bra lrpindicaiud1610pTrw4r7lbus4lhpsGlMwiduarVusswabaulra�ctiold'himnbarnbndntbfa'ciflitMW Is always required far stability andtb prevent collapse with possible personal mjurycmd{tropaity daaia0a. FhrpAnriidl OrldanC�re0erding rho fabrication;Otorao,dggve erection and bracing of trusses and truss systems,Eee ,ANSt1TF41 qua ty Ciitarla;6S9.00 and SCSI Building Component 16023 Wrigley Ridge Rd Safety Infotmolton'wailn le from Truss Plate Institute,218 N Lee Street,Suite 312,Alexandna;VA 223147'- - '- " Chesterflaid,MO 63017 I Job " russ 77L85 Type Qty Pty d UJING D ROOF VINEYARD VIEW 137938960 3597OR3 03 +Valley' 2 1 Job Reference a goiial) Uniyelsal C6761p0tienl Corp„ EAST HAVEN CT 06512 8.010 s Attg 11 2017 MITek Industries;Inc.—Thu--Jul-2b 23:16'302019 Bafle 1 ID uH81G9iAM9_WQEtKnavHVNyuWBg-kWfiXWwaMROovhunibCOwti7ZVeWDitFg4VYSmyuNRV — 1-4-6 i 2.8.12 i -1-0-6 Scale: 4x4 = 2 12,00 12 f 4 ,-S - ,..r"d.'v",�x:. k_FY,.',•'`i`;I',"r`r,;%c;1'•r„`,E kk'":^'x'��`.':`.'.'�`s`-`:.•„s✓%t.';t':y"x�',k''.b',1+ o .�'l"S:�rrt.'4�+.i' ��} u•,.° .,Cr• :�'a•V`st:Y fw,Ci''S�/iti•.r�l�it-£f`a k`C..e.�.��ifr�t, 6 2x4 2x4 .«____.. •_..�.- �. 2-8-8- _ Plate Offsets LOADING (psf) SPACING- 2-0-0 CSI. DEFL in (loc) 1/dell L/d PLATES GRIP TCLL(roof) 30-0 Plate Grip DOL 1.15 TC 0.08 Vert(LL) n/a - n/a 999 MT20 197/144 Snow(Pf/Pg) 38 5/50.0 Lumber DOL 1 15 BC 0.19 Vert(CT) n/a - n/a 999 TCDL 10.0 Rep Stress Incr YES WB 0.00 Horz(CT) 000 3 n/a n/a BCLL 0.0 Code IBC2015(rP12014 Matrix-S Weight-6 lb FT=20% BCDL 10-0 = - LUMBER- BRACING- TOP CHORD 2x4 SPF No 2 TOP CHORD Structural wood sheathing directly applied or 2-8-12 cc purlins. BOT CHORD 2x4 SPF No 2 BOT CHORD Rigid ceiling directly applied or 10-0-0 cc bracing REACTIONS. (Ib/size) 1=118/2-8-4,3=1118/2-84 Max Horz 1=-23(LC 12) Max Uplift 1=5(LC 14),3=-5(LC 14) Max Grav 1=291(LC 33),3=291(LC 35) FORCES. (lb)-Max,Comp/Max Ten -All forces 250(ib)or less except when shown. NOTES- 1)Unbalanced roof live loads have been considered for this design. 2)Wind ASCE 7-10,Vult=130mph(3-second gust)Vasd=103mph,TCDL=6 Opsf,BCDL=6 Opsf,h=25ft,B=45ft;L=24ft;eave=4ft,Cat, II,Exp B,enclosed;MWFRS(directional)and C-C Exterior(2)zone;cantilever left and right exposed,end vertical left and nght exposed;C-C for members and forces&MWFRS for reactions shown,Lumber DOL=1 60 plate grip DOL=1.60 3)TCLL:ASCE 7-10;Pr-30.0 psf(roof live load,Lumber DOL=1.15 Plate DOL=1.15);Pg=50 0 psf(ground snow);Pf=38.5 psf(flat roof snow:Lumber DOL=1.15 Plate DOL=1 15);Category ll;Exp S,Partially Exp.;Ct=1.1 4)Gable requires continuous bottom chord bearing, 5)This truss has been designed for a 10.0 psf bottom chord live load nonconcurrent with any other live loads, 6)'This truss has been designed for a live load of 20.Opsf on the bottom chord in all areas where a rectangle 3-6-0 tall by 2-0-0 wide will fit between the bottom chord and any other members. 7)Provide mechanical connection(by others)of truss to bearing plate capable of withstanding 100 lb uplift at joint(s)1,3, 8)This truss has been designed for a moving concentrated load of 250.01b live located at all mid panels and at all panel points along the Top Chord and Bottom Chord,nonconcurrent with any other live loads. N4.°09943 July 26,2019 ®WARNING-Verily design parameters and READ NOTES ON THIS AND INCLUDED MITEKREFERENCE PAGE MII-7473 rev.10/03/2015 BEFORE USE IS be;lAu,v�id,foruso onjy%jl4 Nrjpnxn milpugomTpadquipnnidnoodonly upon paravittkiBahavn,denlisfor imInAridtinIbigindliigmiripmenl,not a hors syalhno Be lbi6 urs,Ilrtr 4uJduilj doatgadr niUsl vallly ibd aµpilcafµ:ltf of design pniitmutars oud proomlq doalgn hiio lbc overall Mel(balding dal lgn,Bmatng ind carpo is'Ipprnvant bixkling p1Jly}ry dear truss veb andlor ehrirdmambors onty A!Idillor:ll tarnfr?rrLy,onil pb!m:Y 4nl bracing /V1 16 01tVay5 itrtil(red fa:xlil4il4ly,nnd to{uuvaai COiiifta5e wii�poY;riWa p'waorisl mluryi and property damage.Fvr gene r01 guidance regarding the 14tuionlion,storage,doiNGry,erecdon and braddg of tnisses'and wss systems,sGe ANSIrTPH quality C1i10rf3,DSB-89 end BCSI Building Component Chest Sield, y Ridge Rd 3gr0ty In(ortnetlon n»iinhfe imm Truss Plate Insdlute,218 N Lee Stn:el,Su!{a 312,Alexandria,VA 22314. _ illi Chesterfield,MO 63017 Symb®Is u bering System Genera! Safety dotes PLATE LOCATION AND ORIENTATION ' 3 „ 4 6-4-8 dimensions shown in ft-in-sixteenths Failure to Follow Could Cause Pro ert 1 ri /4 Center plate on joint unless x,y _ P y Y offsets are indicated. (Drawings not to Scale) Damage or Personal Injury Dimensions are in ft-in-sixteenths. - Apply plates to both sides of truss 1 2 3 1, Additional stability bracing for truss system,e.g. and fully embed teeth. diagonal or X-bracing,is always required. See BCSI. TOP CHORDS Ct. c2.3 2 'Truss bracing must be designed by an engineer.For 4 wide truss spacing,individual lateral braces themselves i WE$S' ,r- may require bracing,or alternative Tor I --- bracing should be considered. O ci 2 O 3. Never exceed the design loading shown and never U 1�u, V slack materials on inadequately braced trusses, O a Q 4. Provide copies of this truss design to the building For 4 x 2 orientation,locate $ c5 H designer,erection supervisor,property owner and plates 0- tiid'from outside i` BOTTOM CHORDS all other interested parties. edge of truss. 8 7 6 5 5. Cut members to bear tightly against each other., 6, Place plates on each face of truss at each 1 This symbol indicates the JOINTS ARE GENERALLY NUMBERED/LETTERED CLOCKWISE joint and embed fully.Knots and wane at joint required direction of slots In AROUND THE TRUSS STARTING AT THE JOINT FARTHEST TO locations are regulated by ANSI/TPI 1. connectorlates. THE LEFT. P 7, Design assumes trusses will be suitably protected from CHORDS AND WEBS ARE IDENTIFIED BY END JOINT the ewronment in accord with ANSI/TPI 1. "Plate location details available In MiTek 20120 NUMBERS/LETTERS. software or Upo*1 request. B Unless otherwise noted,moisture content of lumber shall not exceed 19%at time of fabrication. PRODUCT CODE APPROVALS 9. Unless expressly noted,this design is not applicable for PLATE SIZE- use with fire retardant,preservative treated,or green lumber. ' i The first dimension is the plate ICC-ES Reports: 10,Camber is a non-structural consideration and is the 4 X 4 width measured perpendicular ESR-1311,ESR-1352,ESR1988 responsibility of truss fabricator.General practice is to to slots.Second dimension is ER-3907,ESR-2362, ESR-1397,ESR-3282 camber for dead load deflection. the length parallel to slots. 11.Plate type,size,orientation and location dimensions indicated are minimum plating requirements. LATERAL BRACING LOCATION 12,Lumber used shall be of the species and size,and d i in all respects,equal to or better than that Indicated by symbol shown and/or Trusses are designed for wind loads in the plane of the specified by,itext in the bracing section of the truss unless otherwise shown. 13.Top chords must be sheathed or purlins provided at output Use T or I bracing spacing indicated on design. if indicated. Lumber design values are in accordance with ANSI/TPI 1 J14.Bottom chords require lateral bracing at 10 ft.spacing, section 6.3 These truss designs rely on lumber values or less,if no ceiling is installed,unless otherwise noted: BEARING established by others. 15.Connections not shown are the responsibility of others, Indicates location where bearings 16.Do not cut or alter truss member or plate without prior ' (supports)occur. Icons vary but ©2012 MiTek®All Rights Reserved approval of an engineer. reaction section indicates joint number where bearings occur -`" 17.Install and load vertically unless indicated otherwise. Min size shown is for crushing only. �® f; 18.Use of green or treated lumber may pose unacceptable environmental,health or performance risks.,Consult with Industry Standards project engineer before use. j ANSI/TPI1: Natioral Design Specification for Metal is.Review all portions of this design(front,back,words Plate Connected Wood Truss Construction. and pictures)before use.Reviewing pictures alone is not sufficient. DSB-89. Design Standard for Bracing $ $ BCSI: Building Component Safety Information, 20 Design assumes manufacture in accordance with -Guide to Good Practice for HandlingANSMI 1 Quality Criteria. Installing i3,Bracing of Metal Plate �M k Connected Wood Trusses. MiTek Engineering Referer eet MII-7473 rev. 10/03/2015 6 I et bo o, V% APAN 11 71 A VIN BEATTY HARVEY COCO XA Eyi R—""% ELECTRICAL ARCHITECTS , < < P NEW YORK I MARYLAND APPROVED AS NOT INSPECTION REQUIRED 1300 Walt Whitman Road, New York, 11747 �.E�D�� /� p: (631)300-1010 DATE: _1B.P.# t'7•. ?s owner/developer FEE�� BY: Conifer Realty NOTIFY BUILDING DEPARTMENT AT 1000 University Avenue Suite 500 U"'m% T Rochester, NY 14607 765-1802 8 AM TO 4 PM FOR THE 585.324-0500 GR "� ElIkNn ["ml*' Ao"' NY 1 1944 FOLLOWING INSPECTIONS: I. FOUNDATION - TWO REQUIRED FOR POURED CONCRETETifUSS PLACFtiD1V'G RQU'g�:0 civil engineer 2. ROUGH - FRAMING & PLUMBING LKMA 3. INSULATION 437 &405 4. FINAL - CONSTRUCTION MUST South Country Road �' BE COMPLETE FOR C.O. Brookhaven, NY 11719 ALL CONSTRUCTION SHALL MEET THE 631.286.8668 Lr.�,% U1LwUm01h" 1 '1kN4' G TYI"—mkE REQUIREMENTS OF THE CODES OF NEW PLUM;',3ER,CERTIFICATION YORK STATE. NOT RESPONSIBLE FOR ON LEAD CONTENT BEFORE m.e.p. &f.p. DESIGN OR CONSTRUCTION ERRORS. CERTIFICATEOFOCCUPANCY 150 North Chestnut Street M/E Engineering, P.E. BUILDING # SOLDER USED IN WATER Rochester, NY 14604 ® 4 & 5585.288.5590 SUPPL�'SYSTEM CANNOT EXCEED 2/10 OF 1%LEAD. structural engineer TDM Consulting Engineerinq� 550 North County Road,Suite COMPLY WITH ALL CODES OF Saint James, NY 11780 uNEW YORK STATE & TOWN CODES 631.686.5234 %1 r ff 5A0m"' UED F01"""""`% C015" STrr=NX%kUCT10N AS REQUIRED AND CONDITIONS OF PLUMBING ;ALL'F'LUMBING WASTE . �n '&WATER LINES NEED SOUTFOLD TOWN PLANNING BOARD 1`� lmd,BEEORE COVERING key ,M SOUTHOLD TOWN TRUSTEES Aml RCH 15 2019 _ "---- — TRUE N.Y.S.DEC Hill 11 NORTH tfust provide Manuals 0 D, J and S as per o ° OCCUPANCY OR NYS Energy Code - G USE IS UNLAWFUL ° O - - - - WITHOUT CERTIFICATE - OF OCCUPANCY ° - - I I I I - I I I IElower door project - - - - - - - and ducti.,ork - - VINEYARD VIEW DRAINAGE INSPECTIONS ARE REQUIRED testin required. Contact TOS Engincering at 765-1560 before Q �' ' Backfill,OR Provide Engineer's Certification T - t"'^t th^drain^fie has faeen installed to Code. County Road 48 Greenport, NY 11944 ._ seal 00 NOT ' l PROCEED WITH , Y'F1R1t M SPE CTIM I w C�♦ JP�R E Dl r77 FRAJtiGUNTIL SURVEY AGR o C ti RE OF FOUNDATION LOJ : HAS BEEN APPROVED. RE 6tR�DEEF0RE IE OPENING �F in €'ire reparation OF NE`N required as per NyS Code issued„ date description 1 03/15/19 Issued For Construction i I 1 I I i I i I I f I I I I I I I F T7 I I I i I I I 1 1 I I I I I I I I I 1 I ------------------ J J__L J L -----'---__. J L ----_- 1 J J--L ----------------- J--L I 1 17 r I 1 I I I I I I I I I i I I I 1 I I ------------------I-----I-----�-__----- I ----1 ---------------------------I------I -----------__1 ____J ----------------- w j�cQ1 title COVER SHEET AMR T �^ REAL ESTATE DEVELOPMENT. CONSTRUCTION & MANAGEMENT - - �.....e.._ drawn by: --- checked by: --- scale: N.T.S. i project number: 10002 c scaled inch sheet number I I BUILDING A ABBREVIATIONS SYMBOLS DRAWING LIST -�-- # POUND OR NUMBER JAN. JANITORID & AND JST. JOIST < ANGLE JT. JOINT STANDARD REFERENCE BUBBLE @ AT DETAIL NUMBER z z [ CHANNEL LAV LAVATORY O A.L. CENTER LI14E L.M.B. LIQUID MARKER BOARD 1 w u z w vz LU DIA. DIAMETER OR ROUND LAM LAMINATE `-' _ `>" PERPENDICULAR LT. ' I 1 LIGHT DRAWING NUMBER 0) O0-1N O1 J Ol W 0) cn M J M -- A3.01 > M Z m > Z m LU m � O -i-i = o UJ m � `-i-i O "'-+ � o BEATTY HARVEY COCO A,B. ANCHOR BOLT M.D.O. MEDIUM DENSITY OVERLAY z u ' z -_ u � o r+ w cv W m O r` 0 v- w ci � m O n A R C H I T E CT S L L P AC. ASPHALT CONCRETE M.H. MANHOLE t J� DETAIL MARK OR u o 0 o 0 o LL o u o 0 o 0 o u o A.C.T. ACOUSTICAL CEILING TILE M.L. METAL LATH A3.01 0 w o w NEW YORK MARYLAND ENLARGED PLAN 0 < 0 w o < 0 w A,D. AREA DRAIN M.O. MASONRY OPENING o w N o w N 1300 Walt Whitman Road, New York, 11747 A A,N.S.I. AMERICAN NATIONAL STANDARDS MAX. MAXIMUM v=i `" c=n `" IA p:(631)300-1010 INSTITUTE MECH. MECHANICAL SHEET NO. SHEET TITLE "-' SHEET NO. SHEET TITLE `=' A.F.A. ABOVE FINISH FLOOR MET. METAL GENERAL PLUMBING owner/developer A.S.R. AUTOMATIC SPRINKLER RISER MFR. MANUFACTURER 1 ,,.Conifer Realty A/C AIR CONDITIONING MIN. MINIMUM SECTION CVR COVER SHEET • • • PO.01 SCHEDULE SYMBOLS AND NOTES-PLUMBING • • • 1000 O)i�rs1ty Avenue Suite 500 ACOUS ACOUSTICAL MISC. MISCELLANEOUS Ai.00 P_i, '�, LRo�chester,NY 14607 ADJ. ADJACENT/ADJUSTABLE MTD. MOUNTED GO.01 SYMBOL LEGEND,ABBREVIATIONS&DRAWING LIST • • • • PO.02 FIRE& BOOSTER PUMP PLAN • 585.324-0500 ALUM. ALUMINUM MTL. METAL CODE COMPLIANCE P1.00 UNDERGROUND FLOOR PLAN-PLUMBING • • • APPROX. APPROXIMATE MUL. MULLION1 `� 2019 ARCH ARCHITECTURAL CCO.00 CODE COMPLIANCE DATA&PLOT PLAN • • P1.01 FIRST FLOOR PLAN -PLUMBING • • • civil engineer JW- A`NP ACOUSTIC WALL PANEL (N) NEW 1 EXTERIOR ELEVATION CCO.01 BUILDING A EGRESS PLAN • • P1.02 SECOND FLOOR PLAN-PLUMBING • • LKMA ' 437&405 N. NORTH A�.00 ,y `;, :� , , . , s - ARCHITECTURAL P1.03 ROOF PLAN-PLUMBING • • ;(}"yS:outh Country Road BD.A. BOARD N.I.C. NOT IN CONTRACT ,- BLDG. BUILDING N.T.S. NOT TO SCALE Brookhaven, . BILK. BLOCK NO. NUMBER A0.01 BUILDING A SITE PLAN • • P2.00 RISER DIAGRAMS- PLUMBING • • 631.2288 68668 .8668 BLKG. BLOCKING NOM. NOMINAL 1 A1.00 BUILDING A FOUNDATION PLAN • • • P5.00 DETAILS- PLUMBING • • BM. BEAM m.e.p. &f.p. BOT. BOTTOM O.C. ON CENTER 4 A1.00 2 INTERIOR ELEVATION A1.01 BUILDING A FIRST FLOOR PLAN • • • • P5.01 DETAILS- PLUMBING • • M/E Engineering, P.E. B-_L_ BTR. BETTER O.D. OUTSIDE DIAMETER/OUTSIDE A1.02 BUILDING A SECOND FLOOR PLAN • • • • P5.02 FIRE PROTECTION DETAILS-PLUMBING • • I B 150 North Chestnut Street DIMENSION /OVERFLOW DRAIN 3 Rochester, NY 14604 C CARPET O.H. OVERHEAD A1.03 BUILDING A ROOF PLAN • • • P5.03 WATER SERVICE DETAILS-PLUMBING • • 585.288.5590 C.A. CATCH BASIN O.S. OVERFLOW SCUPPER ROOMNAME A2.00 BUILDING A FRONT& REAR ELEVATIONS • F. • • C.1. CAST IRON OFOFFICE C.J. CONTROL JOINT/ OFF. OPENING ROOMNAME 8c structural engineer 103 ROOMNUMBER A2.01 BUILDING A LEFT&RIGHT SIDE ELEVATIONS • • • CONSTRUCTION JOINT OPP OPPOSITEA3.01 BUILDING A FIRST FLOOR REFLECTED CEILING PLAN • • TDM Consulting Engineering C.P. CHECKERED PLATE 550 North County Road,Suite E C.T. CERAMIC TILE PT. PAINT/POINT 101 A3.02 BUILDING A SECOND FLOOR REFLECTED CEILING P-AN • • • Saint James, NY 11780 CAB. CABINET P.A. PLANTING AREA B DOOR NUMBER 631.686.5234 CFMF COLD FORM METAL FRAMING P.J. POUR JOINT A4.00 BUILDING A UNIT PLANS 61-ANSI 61&62 • • • • CI_ CENTER LINE P.L. PROPERTY LINE A4.01 BUILDING A UNIT PLANS C1 • • • • CLG. CEILING P.MET. PRESSED METAL P1 PARTITION TYPE CLR CLEAR PAN. PANEL A5.00 BUILDING A BUILDING SECTIONS • • • CMU CONCRETE MASONRY UNIT PL. PLATE key C ACCESSORIES A5.01 BUILDING A BUILDING SECTIONS • • • � " COL. COLUMN PLAM. PLASTIC LAMINATE O (SEE LEGEND) CONC. CONCRETE PLAS. PLASTER A6.00 WALL SECTIONS • • • rug" CONN. CONNECTION PLBG. PLUMBING + CONST. CONSTRUCTION PLYWD. PLYWOOD FIXTURE NUMBER A6.01 WALL SECTIONS • • • CONT. CONTINUOUS PR PAIR CO (SEE LEGEND) A6.02 WALL SECTIONS • • • + CTR CENTER PTD PAPER TOWEL DISPENSER CTSK. COUNTERSUNK PVMT. PAVEMENT A6.03 DECK PLANS, ELEVATION,SECTION &DETAILS • OWNER SUPPLIED D.F. DOUGLAS FIR/DRINKING Q.T. QUARRY TILE ITEMS (SEE LEGEND) A7.00 ACCESSIBILITY DETAILS&NOTES • • • FOUNTAIN A7.01 TYPICAL FRAMING &AIR SEALING DETAILS • • Oo D.O. DOOR OPENING R. RISER DRAWING REVISION NUMBER A7.02 TYPICAL FRAMING&AIR SEALING DETAILS • • D.S. DOWNSPOUT R.A. RETURN AIR " DBL. DOUBLE R.D. ROOF DRAIN A7.03 TYPICAL FRAMING &AIR SEALING DETAILS • • DEPT. DEPARTMENT R.F. RESILIENT FLOORING WINDOW LETTER DE:T. DETAIL RAD. RADIUS AO A7.04 TYPICAL FRAMING &AIR SEALING DETAILS • • TRUE a DIA. DIAMETER RB RESILIENT BASE (SEE LEGEND) A8.00 DOOR SCHEDULE&TYPES • • • project DIM, DIMENSION REF. REFERENCE �\ DN. DOWN REFRIG. REFRIGERATION / REFRIGERATOR COLUMN GRID LINE A8.00A DOOR DETAILS • • VINEYARD VIEW DR. DOOR REINF. REINFORCED A8.01 WINDOW SCHEDULE & DETAILS • • • DWG. DRAWING REQ'D REQUIRED DWR. DRAWER RESIL. RESILIENT BREAK LINE A9.00 STAIR PLANS,SECTIONS&DETAILS • • + E. EAST RV REVEAL A10.00 BATHROOM PLANS, ELEVATIONS& DETAILS • • • + f' DATUM ELEVATION County Road 48 E.J. EXPANSION JOINT A10.01 BATHROOM PLANS, ELEVATIONS& DETAILS • • • Greenport, NY 11944 E.T. EPDXY TOPPING S. SEALER p E.W.C. ELECTRIC WATER COOLER S.A. SUPPLY AIR A11.00 FINISH SCHEDULE &CLOSET DETAILS • • • seal EA. EACH S.A./V.D. SEE AUDIO/VISUAL DRAWINGS �� EARTH A11.01 FIRST FLOOR FINISH PLAN • • • t�cPD ASC EF EIFS SYSTEM S.C. SOLID CORE EL., ELEV. ELEVATION S.C.D. SEE CIVIL DRAWINGS A11.02 SECOND FLOOR FINISH PLAN • • • cl\ 0 G Pq�o �O ELEC. ELECTRICAL S.D. SCUPPER DRAIN /STORM DRAIN Al2.00 KITCHEN PLANS, ELEVATIONS& DETAILS • • J LJ`� to�l` ., .t. ENCL. ENCLOSURE S.E.D. SEE ELECTRICAL DRAWINGS SAND i 0 EC). EQUAL S.I.D. SEE INTERIOR DRAWINGS Al2.01 KITCHEN PLANS, ELEVATIONS& DETAILS • • • r' � ,' J �,' �. EQUIP. EQUIPMENT K.D. SEE KITCHEN DRAWINGS A13.01 FIRST FLOOR FURNITURE PLAN • • \/� G. "?�© E><;H. EXHAUST S.L.D. SEE LANDSCAPE DRAWINGS EXIST.,(E) EXISTING S.LD.D. SEE LIGHTING DESIGN DRAWINGS A13.02 SECOND FLOOR FURNITURE PLANOF • • �. ) --'` E><:P. EXPANSION /EXPOSED S.M.D. SEE MECHANICAL DRAWINGS CONCRETE EXT. EXTERIOR S.P.D. SEE PLUMBING DRAWINGS A14.00 PASSIVE RADON-RESISTANT SYSTEM • • • '_`"` S.S. STAINLESS STEEL/SERVICE SINK STRUCTURAL F.A. FIRE ALARM S.S.D. SEE STRUCTURAL DRAWINGS + F.B. FLAT BAR S.V. SHEET VINYL BRICK SO.10 GENERAL NOTES& LOADING • • E issued date description F.D. FLOOR DRAIN S.WF.D. SEE WATER FEATURE DRAWINGS F.E.C. FIRE EXTINGUISHER CABINET SEC. SECTION S0.20 SPECIAL INSPECTION REQUIREMENTS • • 1 03/15/19 Issued for Construction F.F. FLOOR FINISH / FACTORY FINISH SH. SHEATHING S1.00 FOUNDATION PLAN • • • 2 06/06/19 Project Bulletin #1 F.G. FINISH GRADE SHT. SHEET CONCRETE MASONRY S1.01 SECOND FLOOR FRAMING PLAN • • • 3 06/12/19 Proiect Bulletin #2 F.H. FIRE HYDRANT SHTG. SHEETING UNIT 0 4 07/01/19 Project Bulletin #4 F.L. FLOW LINE SIM. SIMILAR 51.02 ROOF FRAMING PLAN • • • F.O. FACE OF SL. SLIDING F.O.F. FACE OF FINISH SO. SOUTH 52.00 FOUNDATION SECTIONS • • • F.O.G. FACE OF GLASS SPEC. SPECIFICATION STEEL 52.01 FRAMING SECTIONS • • • F.O.M. FACE OF MASONRY SQ. SQUARE F.O.S. FACE OF STUD SSWP STAINLESS STEEL WALL PANEL 53.00 SHEAR WALL ELEVATIONS&DETAILS • • • F.O.SH. FACE OF SHEATHING ST STONE S3.10 TYPICAL WOOD DETAILS • • • F.S. FLOOR SINK/ FULL SIZE/FINISH STA. STATION SURFACE STD. STANDARD ROUGH WOOD 54.00 TYPICAL FOUNDATION DETAILS • • FDN. FOUNDATION STL. STEEL FIN. FINISH STOR. STORAGE HVAC FL., FLR. FLOOR STRUCT. STRUCTURAL HO.00 GENERAL NOTES&SYMBOLS- HVAC • • F FLUOR. FLUORESCENT SUSP. SUSPENDED FINISHED WOOD F FF: FIRE RATED / FRAME SWBD. SWITCHBOARD TRIM HO.01 SCHEDULES-HVAC • • FRP FIBERGLASS REINFORCED PLASTIC SYM. SYMMETRICAL HO.02 SITE PLAN -HVAC • • FIRT FIRE-RETARDANT TREATMENT FT. FOOT/FEET T. TRANSFORMER/TREAD ROUGH WOOD H1.01 FIRST FLOOR PLAN- HVAC • • • FTG. FOOTING T.A. TREE AREA BLOCKING FURR. FURRING T.B. TACKBOARD /TOWEL BAR H1.02 SECOND FLOOR PLAN-HVAC • • title T.C. TOP OF CONCRETE/TOP OF CURB H 1.03 ROOF PLAN -HVAC • • SYMBOL LEGEND G.B. GRAB BAR T.J. TOOL JOINT G.C. GENERAL CONTRACTOR T.O. TOP OF PLYWOOD H5.01 DETAILS-HVAC • • G.I. GALVANIZED IRON T.O.C. TOP OF CATCH BASIN H5.02 DETAILS-HVAC 0ABBREVIATIONS & G.S. GALVANIZED STEEL T.O.M. TOP OF MASONRY GA. GAUGE T.O.P. TOP OF PARAPET H5.03 PELICAN THERMOSTAT DETAILS-HVAC • • GALV. GALVANIZED T.O.W. TOP OF WALL RIGID INSULATION ELECTRICAL DRAWING LIST GFRG GLASS FIBER REINFORCED GYPSUM T.P.D. TOILET PAPER DISPENSER GL. GLASS T.S. TUBE STEEL EO.00 GENERAL NOTES AND SYMBOLS- ELECTRICAL • • GR. GRADE T.V. TELEVISION GRD. GROUND TEL. TELEPHONE E0.01 SITE PLAN-ELECTRICAL • • + GSM GALVANIZED SHEET METAL TER. TERRAllO BATT INSULATION E1.01 FIRST FLOOR PLAN - ELECTRICAL • • • GWB GYPSUM WALLBOARD THK. THICK drawn by: GYP. GYPSUM TYP. TYPICAL E1.02 SECOND FLOOR PLAN-ELECTRICAL • • • checked by: --- E1.03 ROOF PLAN -ELECTRICAL • • a_ H.B. HOSE BIB U.O.N. UNLESS OTHERWISE NOTED 0 GYPSUM SHEATHING scale: N.T.S. H.C. HOLLOW CORE OR WALL BOARD E4.01 DETAILS-ELECTRICAL • • H.M. HOLLOW METAL V.C.T. VINYL COMPOSITION TILE � E4.02 DETAILS-ELECTRICAL • • project number: 10002 H.P. HIGH POINT/HORSE POWER V.I.F. VERIFY IN FIELD HDR. HEADER VERT. VERTICAL E4.03 DETAILS-ELECTRICAL • El scaled inch HDW. HARDWAREo HDWD. HARDWOOD W WEST E5.01 ONE LINE DIAGRAMS-ELECTRICAL • sheet number a HGT., HT. HEIGHT W.C. WATER CLOSET/WALL COVERING E6.01 SCHEDULES-ELECTRICAL • / HORIZ. HORIZONTAL W.H. WATER HEATER HR. HOUR W.P. WEATHERPROOF/WATERPROOF E6.02 SCHEDULES-ELECTRICAL BUILDING A a W/ WITH I.D. INSIDE DIMENSION/INSIDE DIAMETERWD. WOOD INFO. INFORMATION WF WIDE FLANGE ' ---- m �INSUL. INSULATION WT WEIGHT @ + INTT. INTERIOR + + + + + + I + �f H 7T- I GO ,00 r A CODE COMPLIANCE DATA �;rDi LJ APPLICABLE CODES: • 602.5 TYPE V. • 915.1.3 FORCED-AIR FURNACES.CARBON MONOXIDE DETECTION SHALL BE PROVIDED IN DWELLING . . UNITS,SLEEPING UNITS AND CLASSROOMS SERVED BY A FUEL-BURNING,FORCED-AIR THE DRAWINGS ARE BASED ON THE CURRENT UNIFIED NEW YORK STATE BUILDING CODE AS OF FILING TYPE V CONSTRUCTION IS THAT TYPE OF CONSTRUCTION IN WHICH THE STRUCTURAL FURNACE. ". DATED THE 2015 INTERNATIONAL BUILDING CODE 3RD PRINTING WITHAPPLICABLE 2017 UNIFORM CODE ELEMENTS,EXTERIOR WALLS AND INTERIOR WALLS ARE OF ANY MATERIALS PERMITTED BY "_s�at SUPPLEMENT DATED OCTOBER 31,2017 AND THE FOLLOWING CODES AS ADOPTED BY THE STATE OF THIS CODE. EXCEPTION:CARBON MONOXIDE DETECTION SHALL NOT BE REQUIRED IN DWELLING UNITS, NEW YORK SLEEPING UNITS AND CLASSROOMS IF CARBON MONOXIDE DETECTION IS PROVIDED IN THE S23347o••E • 700 FIRE AND SMOKE PROTECTION FEATURES FIRST ROOM OR AREA SERVED BY EACH MAIN DUCT LEAVING THE FURNACE,AND THE CARBON j - - 2015 INTERNATIONAL BUILDING CODE 3RD PRINTING • 708 FIRE PARTITIONS MONOXIDE ALARM SIGNALS ARE AUTOMATICALLY TRANSMITTED TO AN APPROVED LOCATION. B E A T T Y HARVEY COC O M _ 2015 INTERNATIONAL EXISTING BUILDING CODE 5TH PRINTING • 708.1 GENERAL.THE FOLLOWING WALL ASSEMBLIES SHALL COMPLY WITH THIS SECTION. A R C H I T E C T S , L L P - 2015 INTERNATIONAL FIRE CODE 3RD PRINTING • 1000 MEANS OF EGRESS - - 42738' 2015 INTERNATIONAL ENERGY CONSERVATION CODE 2ND PRINTING SEPARATION WALLS AS REQUIRED BY SECTION 420.2 FOR GROUPS 1-1,R-1,R-2 AND R-3. • 1004 OCCUPANT LOAD NEW YORK I MARYLAND ' S2f 1330"B os oo• 2015 INTERNATIONAL PLUMBING CODE 3RD PRINTING '" ° f 1300 Walt Whitman Road, New York, 11747 I { I [ I I N 2015 INTERNATIONAL MECHANICAL CODE 3RD PRINTING • 708.3 FIRE-RESISTANCE RATING.FIRE PARTITIONS SHALL HAVE A FIRE-RESISTANCE RATING OF NOT OCCUPANCY LOAD TABLE BUILDING A A p: (631) 300-1010 2015 INTERNATIONAL FUEL GAS CODE 3RD PRINTING LESS THAN 1 HOUR. $- OCCUPANT UNIT BUILDING owner/developer 2016 NYS SUPPLEMENT TO THE ENERGY CONSERVATION CODE . 708.4 CONTINUITY.FIRE PARTITIONS SHALL EXTEND FROM THE TOP OF THE FOUNDATION OR GROSS LOAD OCCUPANT OCCUPANT Conifer Realty 2017 NYS UNIFORM CODE SUPPLEMENT TO THE BUILDING CODE FLOOR/CEILING ASSEMBLY BELOW TO THE UNDERSIDE OF THE FLOOR OR ROOF SHEATHING, UNIT AREA FACTOR LOAD LOAD 1000 University Avenue Suite 500 S.F. S.F./PERSON PERSONS PERSONS Rochester, NY 14607 UNIT TYPE QUANTITY ( ) ( ) (PERSONS) (PERSONS) Roches e , SLAB OR DECK ABOVE OR THE FIRE-RESISTANCE-RATED FLOOR/CEILING ASSEMBLY ABOVE, 585.324-0500 \ AMERICAN NATIONAL STANDARD(ICC Al 17.1 -2009) AND SHALL BE SECURELY ATTACHED THERETO.IN COMBUSTIBLE CONSTRUCTION WHERE THE B1 2 986 200 5 10 - FIRE PARTITIONS ARE NOT REQUIRED TO BE CONTINUOUS TO THE SHEATHING,DECK OR SLAB, I ° i • 300 BUILDING USE AND OCCUPANCY CLASSIFICATION THE SPACE BETWEEN THE CEILING AND THE SHEATHING,DECK OR SLAB ABOVE SHALL BE B2 2 1,054 200 6 12 PROPOSED BUILDINGS:4A&5A FIREBLOCKED OR DRAFTSTOPPED IN ACCORDANCE WITH SECTIONS 718.2 AND 718.3 AT THE civil engineer A USE&OCCUPANCY CLASS.: RESIDENTIAL GROUP R-2 MULTIPLE DWELLING BUILDINGS: RESIDENTIAL GROUP R-2 PARTITION LINE. C1 1 1,357 200 7 7 LKMA CONSTRUCTION CLASS.: VB TOTAL BUILDING OCCUPANT LOAD= 29 437&405 AUTOMATIC SPRINKLER SYSTEM: NFPA 13R • 400 SPECIAL DETAILED REQUIREMENTS BASED ON USE AND OCCUPANCY EXCEPTIONS: South Country Road W BUILDING HEIGHT: 25.33' . 420 GROUPS 1-1,R-1,R-2,R-3 AND R-4 Brookhaven, NY 11719 NUMBER OF STORIES: 2 . 420.2 SEPARATION WALLS. 631.286.8668 5.ATTIC FIREBLOCKING OR DRAFTSTOPPING IS NOT REQUIRED AT THE PARTITION LINE IN j z BUILDING AREA: STORY: 2,812 SQ.FT. GROUP R-2 BUILDINGS THAT DO NOT EXCEED FOUR STORIES ABOVE GRADE PLANE, BUILDING: 5,624 SQ.FT. WALLS SEPARATING DWELLING UNITS IN THE SAME BUILDING,WALLS SEPARATING SLEEPING PROVIDED THE ATTIC SPACE IS SUBDIVIDED BY DRAFTSTOPPING INTO AREAS NOT EXCEEDING m.e.p. &f.p. B ° •v; ° a ` J UNITS IN THE SAME BUILDING AND WALLS SEPARATING DWELLING OR SLEEPING UNITS FROM 3,000 SQUARE FEET OR ABOVE EVERY TWO DWELLING UNITS,WHICHEVER IS SMALLER. WE Engineering, P.E. OTHER OCCUPANCIES CONTIGUOUS TO THEM IN THE SAME BUILDNG SHALL BE CONSTRUCTED g 150 North Chestnut Street [ " ° • \ AS FIRE PARTITIONS IN ACCORDANCE WITH SECTION 708. 6.17IREBLOCKING OR DRAFTSTOPPING IS NOT REQUIRED AT THE PARTITION LINE IN BUILDINGS Rochester, NY 14604 ° ° ° EQUIPPED WITH AN AUTOMATIC SPRINKLER SYSTEM INSTALLED THROUGHOUT IN • 1006 NUMBER OF EXITS AND EXIT ACCESS DOORWAYS 585.288.5590 i ° ° 1 I' \ • 420.3 HORIZONTAL SEPARATION. *ACCORDANCE WITH SECTION 903.3.1.1 OR 903.3.1.2,PROVIDED THAT AUTOMATIC SPRINKLERS 1006.2 EGRESS FROM SPACES ° ARE INSTALLED IN COMBUSTIBLE FLOOR/CEILING AND ROOFICEILING SPACES. • 1006.2.1 EGRESS BASED ON OCCUPANT LOAD AND COMMON PATH OF EGRESS.TWO EXITS OR EXIT structural engineer f. __ / ��a °' • ` FLOOR ASSEMBLIES SEPARATING DWELLING UNITS IN THE SAME EUILDING, FLOOR ACCESS DOORWAYS FROM ANY SPACE SHALL BE PROVIDED WHERE THE DESIGN OCCUPANT ° ASSEMBLIES SEPARATING SLEEPING UNITS IN THE SAME BUILDING AND FLOOR ASSEMBLIES • 711 FLOOR AND ROOF ASSEMBLIES LOAD OR THE COMMON PATH OF EGRESS TRAVEL DISTANCE EXCEEDS THE FOLLOWING TDM Consulting Engineerin SEPARATING DWELLING OR SLEEPING UNITS FROM OTHER OCCUPANCIES CONTIGUOUS TO s 711.2.4.3 DWELLING UNITS AND SLEEPING UNITS VALUES. 550 North County Road,Suite THEM IN THE SAME BUILDING SHALL BE CONSTRUCTED AS HORIZONTAL ASSEMBLIES IN Saint James, NY 11780 j (D I ACCORDANCE WITH SECTION 711. HORIZONTAL ASSEMBLIES SERVING AS DWELLING OR SLEEPING UNIT SEPARATIONS IN MAXIMUM PATH OF EGRESS TRAVEL DISTANCE 631.686.5234 i • 420.5 AUTOMATIC SPRINKLER SYSTEM. ACCORDANCE WITH SECTION 420.3 SHALL BE NOT LESS THAN 1-HOUR FIRE-RESISTANCE-RATED OCCUPANCY OCCUPANT LOAD (WITH SPRINKLER SYSTEM) CONSTRUCTION. }� R-2 10 125' MULTIPLE DWELLING BUILDINGS: NFPA 13R (903.3.1.2) • •1006.3 EGRESS FROM STORIES OR OCCUPIED ROOFS. 800 INTERIOR FINISHES key • 803.1.1 INTERIOR WALL AND CEILING FINISH MATERIALS. GROUP R OCCUPANCIES SHALL BE EQUIPPED THROUGHOUT WITH AN AUTOMATIC SPRINKLER • 1006.3.1 EGRESS BASED ON OCCUPANT LOAD.A SINGLE EXIT OR ACCESS TO A SINGLE EXIT SHALL BE o JC SYSTEM IN ACCORDANCE WITH SECTION 903.2.8. INTERIOR WALL AND CEILING FINISH MATERIALS SHALL BE CLASSIFIED IN ACCORDANCE WITH PERMITTED IN ACCORDANCE WITH SECTION 1006.3.2. NORTH ASTM E84 OR UL 723.SUCH INTERIOR FINISH MATERIALS SHALL BE GROUPED IN THE f ° mss'\� • 420.6 FIRE ALARM SYSTEMS AND SMOKE ALARMS. FOLLOWING CLASSES IN ACCORDANCE WITH THEIR FLAME SPREAD AND SMOKE-DEVELOPED • 1006.3.2 SINGLE EXITS.A SINGLE EXIT OR ACCESS TO A SINGLE EXIT SHALL BE PERMITTED FROM ANY f �^ FIRE ALARM SYSTEMS AND SMOKE ALARMS SHALL BE PROVIDED IN GROUP 1-1,R-1,R-2 AND R-4 INDEXES. STORY OR OCCUPIED ROOF WHERE THE FOLLOWING CONDITION EXISTS; R. OCCUPANCIES IN ACCORDANCE WITH SECTIONS 907.2.6,907.2.8,907.2.9 AND 907.2.10, MAXIMUM NUMBER PATH OF EGRESS TRAVEL DISTANCE O a CLASS A:=FLAME SPREAD INDEX 0-25• SMOKE-DEVELOPED INDEX 0-450. - RESPECTIVELY.SINGLE OR MULTIPLE-STATION SMOKE ALARMS S-IALL BE PROVIDED IN STORY OCCUPANCY DWELLING UNITS WITH SPRINKLER SYSTEM GROUPS I-1,R-2,R-3 AND R-4 IN ACCORDANCE WITH SECTION 907.2.11. CLASS B:=FLAME SPREAD INDEX 26-75; SMOKE-DEVELOPED INDEX 0-450. ( ) CLASS C:=FLAME SPREAD INDEX 76-200;SMOKE-DEVELOPED INDEX 0-450. FIRST&SECOND R-2 4 125' / • 500 GENERAL BUILDING HEIGHTS AND AREAS ~ M • 803.11 INTERIOR FINISH REQUIREMENTS BASED ON GROUP. • 1030 EMERGENCY ESCAPE AND RESCUE o • 504 BUILDING HEIGHT AND NUMBER OF STORIES SPRINKLERED • 1030.1 GENERAL.IN ADDITION TO THE MEANS OF EGRESS REQUIRED BY THIS CHAPTER,PROVISIONS tion BUILDING NUMBER OF SHALL BE MADE FOR EMERGENCY ESCAPE AND EGRESS OPENINGS IN GROUP R-2 0 HEIGHT STORIES INTERIOR EXIT CORRIDORS AND OCCUPANCIES IN ACCORDANCE WITH TABLES 1006.3.2(1)AND 1006.3.2(2)AND R-3 GROUP STAIRWAYS AND ENCLOSURE FOR EXIT ROOMS AND OCCUPANCIES.BASEMENTS AND SLEEPING ROOMS BELOW THE FOURTH STORY ABOVE GRADE project BUILDING ALLOWED PROVIDED ALLOWED PROVIDED N22° RAMPS AND EXIT ACCESS STAIRWAYS ENCLOSED SPACES PLANE SHALL HAVE AT LEAST ONE EXTERIOR EMERGENCY ESCAPE AND RESCUE OPENING IN ACCOI m 1B pp„w \ - - A 60' 25.33' 3 2 PASSAGEWAYS AND RAMPS OR TORDANCE WITH THIS A YARD OR COURT THATON.SUCH OPENS TO A PUBLGC WAY. VINEYARD OPEN DIRECTLY INTO A PUBLIC WAY VINEYARD VIE W R-2 C C C ° - - oat°° • 506 BUILDING AREA •1100 ACCESSIBILITY o �� • 804 INTERIOR FLOOR FINISH • 1107 DWELLING UNITS AND SLEEPING UNITS 3 43 \ 58452 BUILDING AREA • 804.2 CLASSIFICATION.INTERIOR FLOOR FINISH AND FLOOR COVERING MATERIALS REQUIRED BY • 1107.6 GROUP R - D County Road 48 STORY BUILDING SECTION 804.2.2 TO BE OF CLASS I OR II MATERIALS SHALL BE CLASSIFIED IN ACCORDANCE y WITH NFPA 253. ANSI&HVI UNIT SUMMARY Greenport, NY 11944 BUILDING ALLOWED PROVIDED ALLOWED PROVIDED CLASS I >_ 0.45 watts/cm2 UNIT NUMBER sea A 12,250 2,812 24,500 5,624 CLASS II >_ 0.22 watts/cm2 BUILDING NUMBER UNIT TYPE ANSI HVI BRED A��, _ �_r___ • 804.4.2 MINIMUM CRITICAL RADIANT FLUX.IN ALL OCCUPANCIES INTERIOR FLOOR FINISH AND FLOOR 1C A3 102 105 J OR -t--- COVERING MATERIALS IN ENCLOSURES FOR STAIRWAYS AND RAMPS,EXIT PASSAGEWAYS, fv 1 PLOT PLAN CORRIDORS AND ROOMS OR SPACES NOT SEPARATED FROM CORRIDORS BY PARTITIONS 2B B3 202 -- �w O�A CC0.00 SCALE: 1° ' 1 OOH-�° j EXTENDING FROM THE FLOOR TO THE UNDERSIDE OF THE CEILING SHALL WITHSTAND A 36 83 302 -- r � MINIMUM CRITICAL RADIANT FLUX. 4A 61 �---s----- t_ �' 5A 61 403 501 S o2L � GROUP MINIMUM CRITICAL RADIANT FLUX --- GROSS AREA=2,812 SQ.FT. R-2 CLASS II 6D C3 604 OF NE`N '- 7D -- -- ._ F • 900 FIRE PROTECTION SYSTEMS issued date description • 506.3 FRONTAGE INCREASE: • 901.6 SUPERVISORY SERVICE.WHERE REQUIRED,FIRE PROTECTION SYSTEMS SHALL BE MONITORED TOTAL 5 2 .+ BY AN APPROVED SUPERVISING STATION IN ACCORDANCE WITH NFPA 72. •1200 INTERIOR ENVIRONMENT 1 03/15/19 Issued for Construction i • 901.6.1 AUTOMATIC SPRINKLER SYSTEMS SHALL BE MONITORED BY AN APPROVED SUPERVISING • 1207 SOUND TRANSMISSION 1 I STATION. •1207.2 AIR-BORNE SOUND.WALLS,PARTITIONS AND FLOOR/CEILING ASSEMBLIES SEPARATING r, `r DWELLING UNITS AND SLEEPING UNITS FROM EACH OTHER OR FROM PUBLIC OR SERVICE I i • 903.2.8 GROUP R.AN AUTOMATIC SPRINKLER SYSTEM INSTALLED IN ACCORDANCE WITH SECTION 903.3 AREAS SHALL HAVE A SOUND TRANSMISSION CLASS OF NOT LESS THAN 50,OR NOT LESS THAN TRUSS/JOIST IDENTIFICATION SIGN LL_ I - r - z - SHALL BE PROVIDED THROUGHOUT ALL BUILDINGS WITH A GROUP R FIRE AREA. 45 IF FIELD TESTED,FOR AIR-BORNE NOISE WHEN TESTED IN ACCORDANCE WITH ASTM E90. PERIMETER=236 FT. FRONTAGE=236 FT. • 906.1 WHERE REQUIRED.PORTABLE FIRE EXTINGUISHERS SHALL BE INSTALLED IN ALL OF THE • 1207.3 STRUCTURE-BORNE NOISE.FLOOR/CEILING ASSEMBLIES BETWEEN DWELLING UNITS AND Signs shall be supplied and installed by G.C.at all exterior building entrance doors,exterior exit FOLLOWING LOCATIONS: SLEEPING UNITS OR BETWEEN A DWELLING UNIT OR SLEEPING UNIT AND A PUBLIC OR SERVICE discharge doors,and fire department hose connections attached to the face of the building,not If=[F/P-0.25]W/30 AREA WITHIN THE STRUCTURE SHALL HAVE AN IMPACT INSULATION CLASS RATING OF NOT more than 12 inches horizontally from the latch side of the doorjamb,and not less than 42 /f=[236/236-0.25]30/30 1.GROUP A,B,E,F,H,I,M,R-1,R-2,R-4 AND S OCCUPANCIES. LESS THAN 50,OR NOT LESS THAN 45 IF FIELD TESTED,WHEN TESTED IN ACCORDANCE WITH inches nor more than 60 inches above the adjoining walking surface. rf=0.75 ASTM E492. Signs shall consist of a circle 6 inches in diameter,with a stroke width of 112 inch.The sign EXCEPTION:IN GROUP R-2 OCCUPANCIES,PORTABLE FIRE EXTINGUISHERS SHALL BE g g • 506.2 ALLOWABLE AREA DETERMINATION: REQUIRED ONLY IN LOCATIONS SPECIFIED IN ITEMS 2 THROUGH 6 WHERE EACH DWELLING UNIT BUILDING UNIT SUMMARY background shall be reflective white in color.The circle and contents shall be reflective red in IS PROVIDED WITH A PORTABLE FIRE EXTINGUISHER HAVING A MINIMUM RATING OF 1 A:10 B:C. F color,conforming to Pantone matching system(PMS)9187. • 506.2.3 SINGLE-OCCUPANCY,MULTISTORY BUILDING UNIT SUMMARY-BUILDING 4A Signs shall contain the roman alphanumeric designation of the construction type of the building, ALLOWABLE AREA FACTOR: A f=7,000 SQ.FT. 2.WITHIN 30 FEET(9144 mm)OF COMMERCIAL COOKING EQUIPMENT. I "I","Il","III","IV"or"V"to indicate the construction classification of the structure under section 3.IN AREAS WHERE FLAMMABLE OR COMBUSTIBLE LIQUIDS ARE STORED,USED OR DISPENSED. UNIT NO.OF GROSS AREA 602 of the BCNYS.The alphabetic designation for the structural components that are of truss 4.ON EACH FLOOR OF STRUCTURES UNDER CONSTRUCTION,EXCEPT GROUP R-3 FLOOR NUMBER UNIT TYPE BEDROOMS (S.F.) type construction,as follows: ALLOWABLE STORY AREA: Aa=[At+(NS x If)]x Sa Aa=[7,000 t(7,000 x 0.75)]x 1 OCCUPANCIES,IN ACCORDANCE WITH SECTION 3315.1 OF THE INTERNATIONAL FIRE CODE. 401 B1 2 986 "F" Floor framing,including girders and beams Aa=12,250SQ.FT. 5.WHERE REQUIRED BY THE INTERNATIONAL FIRE CODE SECTIONS INDICATED IN TABLE 906.1. "R" Roof framing 6.SPECIAL-HAZARD AREAS,INCLUDING BUT NOT LIMITED TO LABORATORIES,COMPUTER FIRST 402 C1 3 1,357 title "FR" Floor and Roof framing ALLOWABLE BUILDING AREA: Aa x ACTUAL NUMBER OF STORIES ROOMS AND GENERATOR ROOMS,WHERE REQUIRED BY THE FIRE CODE OFFICIAL. 403 B1 2 986 12,250 SQ.FT.x 2=24,500 SQ.FT. CODE THE SIGN SHOULD READ AS FOLLOWS: • 912.1 INSTALLATION.FIRE DEPARTMENT CONNECTIONS SHALL BE INSTALLED IN ACCORDANCE WITH 404 B2 2 1,054 6"DIAMETER • 600 TYPES OF CONSTRUCTION THE NFPA STANDARD APPLICABLE TO THE SYSTEM DESIGN AND SHALL COMPLY WITH SECOND 405 COMPLIANCE B2 2 1,054 , • 602 CONSTRUCTION CLASSIFICATION SECTIONS 912.2 THROUGH 912.6. MULTIPLE DWELLING BUILDINGS: TYPE VB • 914.4 EQUIPMENT ROOM IDENTIFICATION.FIRE PROTECTION EQUIPMENT SHALL BE IDENTIFIED IN AN DATA & PLOT APPROVED MANNER.ROOMS CONTAINING CONTROLS FOR AIR-CONDITIONING SYSTEMS, UNIT SUMMARY-BUILDING 5A • 602.1 GENERAL SPRINKLER RISERS AND VALVES OR OTHER FIRE DETECTION,SUPPRESSION OR CONTROL PLAN REFLECTIVE RED ELEMENTS SHALL BE IDENTIFIED FOR THE USE OF THE FIRE DEPARTMENT.APPROVED SIGNS UNIT NO.OF GROSS AREA (PMS)#187 THE BUILDING ELEMENTS SHALL HAVE A FIRE-RESISTANCE RATING NOT LESS THAN THAT REQUIRED TO IDENTIFY FIRE PROTECTION EQUIPMENT AND EQUIPMENT LOCATION SHALL BE FLOOR NUMBER UNIT TYPE BEDROOMS (S.F.) PANTON+ SPECIFIED IN THE FOLLOWING TABLE. CONSTRUCTED OF DURABLE MATERIALS,PERMANENTLY INSTALLED AND READILY VISIBLE. 501 61 2 986 drawn by: - N REFLECTIVE WHITE FIRE-RESISTANCE RATING REQUIREMENTS FOR BUILDING ELEMENTS(HOURS) • 915.1 GENERAL.CARBON MONOXIDE DETECTION SHALL BE INSTALLED IN NEW BUILDINGS IN FIRST 502 C1 3 1,357 ACCORDANCE WITH SECTIONS 915.1 THROUGH 915.6. checked by: --- BUILDING ELEMENT TYPE VB 503 61 2 986 • 915.1.1 WHERE REQUIRED.CARBON MONOXIDE DETECTION SHALL BE PROVIDED IN GROUP 1-1.1-2,1-4 504 B2 2 1,054 scale: AS NOTED Y2"STROKE PRIMARY STRUCTURAL FRAME 0 AND R OCCUPANCIES AND IN CLASSROOMS IN GROUP E OCCUPANCIES IN THE LOCATIONS SECOND BEARING WALLS SPECIFIED IN SECTION 915.2 WHERE ANY OF THE CONDITIONS IN SECTIONS 915.1.2 THROUGH 505 B2 2 1,054 project number: 10002 EXTERIOR 0 915.1.6 EXIST. scaled inch INTERIOR 0 0 • 915.1.2 FUEL-BURNING APPLIANCES AND FUEL BURNING FIREPLACES.CARBON MONOXIDE DETECTION she number 0 o NONBEARING WALLS AND PARTITIONS SHALL BE PROVIDED IN DWELLING UNITS,SLEEPING UNITS AND CLASSROOMS THAT CONTAIN A U >, EXTERIOR(FIRE SEPARATION DISTANCE>_30 FEET) 0 FUEL-BURNING APPLIANCE OR FUEL-BURNING FIREPLACE. INTERIOR o BUILDING A Z = FLOOR CONSTRUCTION AND ASSOCIATED SECONDARY MEMBERS 0 a� ROOF CONSTRUCTION AND ASSOCIATED SECONDARY MEMBERS 0 (ON O m + O# C 0 0 0 0 H + + a I COMPLIANCE CODE LEGEND r' (1 HR)RATED DEMISING WALL TO NEGRESS PATH ----------------- UNIT TYPE: B2 CONTINUE TO EXTERIOR WAL'_. UNIT TYPE: B2 ti USE GROUP: RESIDENITAL R-2 PROVIDE SINGLE SIDED'FLAMEBLOCK' USE GROUP: RESIDENITAL R-2 1 HR FIRE RATED PARTITION ---•—•------- GROSS AREA: 1054 S.F. RATED SHEATHING AT EXT.&'ONT. LD ipj' GROSS AREA: 1054 S.F. LOAD FACTOR: 200 S.F./PERSON TYPE'X'G.W.B.AT INTERIOR. LOAD FACTOR: 200 S.F./PERSON _ OCCUPANT LOAD: 6 PERSONS OCCUPANT LOAD: 6 PERSONSAM OCCUPANCY LOAD TABLE-BUILDING A OCCUPANT UNIT BUILDING 4 4 GROSS LOAD OCCUPANT OCCUPANT BEATTY HARVEY COCO ---_ UNIT AREA FACTOR LOAD LOAD A R C H I T E C T S , L L P '------• - -- -fl - ------ UNIT TYPE QUANTITY (S.F.) (S.F.IPERSON) (PERSONS) (PERSONS) NEW YORK I MARYLAND - -- -- ---_ -- -- ; B1 2 986 200 5 10 1300 Walt Whitman Road, New York, 11747 _ I , A p:(631)300-1010 + 1 I ® I B2 2 1,054 200 6 12 �' uCl I i I C1 1 1,357 200 7 7 owner/developer I � � 1 I Conifer Realty TOTAL BUILDING OCCUPANT LOAD= 29 1000 University Avenue Suite 500 ® ;----- Rochester,NY 14607 =44- 585.324-0500 ------- ---- - -- --- I civil engineer ' I I i ; 1 Li LKMA I I + , \\I� 437 &405 r ' i i I I I South Country Road Brookhaven, NY 11719 631.286.8668 m.e.p. &f.p. -- -- , o o M/E Engineering, P.E. g 150 North Chestnut Street r---I I Rochester,NY 14604 --1 1 r- --I--- � 585.288.5590 L-__ , structural engineer ---� TDM Consulting Engineering -- -- 550 North County Road,Suite E El / _ ® / \ El Saint James, NY 11780 i 1 631.686.5234 0 I LJI + L_------ I � _ � key I N PLAN i I a N MEANS OF EGRESS PATH MEANS OF EGRESS PATH ORIGIN: BEDROOM ORIGIN: BEDROOM TRUE ` o DISTANCE: 68' DISTANCE: 68' project KTBUILDING A - SECOND FLOOR EGRESS PLAN VINEYARD VIEW CC0.01 SCALE: 1/8"= 1'-0" (1HR)RATED DEMISING WALL TO CONTINUE TO -+ EXTERIOR WALL.PROVIDE SINGLE SIDED County Road 48 FLAMEBLOCKRATED SHEATHING AT EXT.&CONT. Greenport, NY 11944 TYPE'X'G.Vf.B.AT INTERIOR. seal UNIT TYPE: 131 UNIT TYPE: Cl UNIT TYPE: B1 --- USE GROUP: RESIDENITAL R-2 USE GROUP: RESIDENITAL R-2 USE GROUP: RESIDENITAL R-2 ��RE D ARc GROSS AREA: 986 S.F. GROSS AREA: 1357 S.F. GROSS AREA: 986 S.F. ��5 PE GERq LOAD FACTOR: 200 S.F./PERSON LOAD FACTOR: 200 S.F./PERSON LOAD FACTOR: 200 S.F./PERSON �O R OCCUPANT LOAD: 5 PERSONS OCCUPANT LOAD: 7 PERSONS OCCUPANT LOAD: 5 PERSONS iA r+ O 4 4 - I �� 021422 Cq� FOF NE\N I -- - i E issued date description I ' I ,1 1 03/15/19 Issued for Construction — i 0 � L� ; ® 2 07/01/19 Proiect Bulletin No.4 ® , � IIS ; I 1 ' u i ® ' 1 I I III , I III 1 1 1 I I Ott 1 1 L__-J _ F i ; III I I - --_ 1 I II I -I--, I i t 111 , -I I - I •• ��ll +. F 00 1 =RF- I , `- L� IIS 1 - 1 o p I __-J L--- title 1 _ BUILDING A EGRESS PLAN 113 drawn by: i © � �13 I checked by: --- scale: 1/8"= 1'-0" MEANS OF EGRESS PATH ORIGIN: 1ST FLR BDRM project number: 10002 c DISTANCE: 50' f scaled inch MEANS OF EGRESS PATH MEANS OF EGRESS PATH MEANS OF EGRESS PATH - ORIGIN: BEDROOM ORIGIN: 2ND FLR BDRM ORIGIN: BEDROOM sheet number DISTANCE: 59' DISTANCE: 65' DISTANCE: 59' 0 BUILDING A ----� 1 BUILDING A - FIRST FLOOR EGRESS PLAN o} CC0.01 SCALE: 118"= 1'-0" �- N W o �}- + + + + + + H CC0901 9 0 N Appendix E Area Calculations Appendix E Area Calculations CD Table One:Dwelling Unit Space Table One:Dwelling Unit Space Vineyard Views-Building 4A Vineyard Views-Building 5A Interior Gross Area Total Gross Interior Gross Area Total Gross Number of Total Interior Number of Total interior Dwelling Unit Space Gross Area Including Exterior Area including Dwelling Unit Space Gross Area Including Exterior Area Including Each Space Each Space Gross Area Walls Each Space Exterior Walls Each Space Each Space Gross Area Walls Each Space Exterior Walls Unit 61 2 Bedroom 2 919 1,838 986 1, 72 :: Unit Bl(2 Bedroom) 2 919 1,838 986 1,972 ( ) +�„ ,�, �.�'' � �, � • 2 985 1,970 1,054 2,10 Unit 622 Bedroom)Unit B2(2 Bedroom) 2 985 1,970 1,054 2,108 ( ) Unit C1(3 Bedroom) 1 1 1,310 1,310 1,357 1,357 Unit C1(3 Bedroom) 1 1,310 1 1,310 1 1,357 1,357 Totals 55,118 r` 5,437 Totals S 5,118 5,437 Table Two:Residential Common Space Table Two:Residential Common Space B E A T T Y HARVEY COC O 11 ineyard Views,Building 4A ri V ews-Bw dmg A ARCHITECTS L L P NEW YORK I MARYLAND Number of Interior Gross Area Total Gross Number of Interior Gross Area Total Gross Total Interior Total Interior 1300 Walt Whitman Road, New York, 11747 .S 23°34. „ Residential Common Space Gross Area Including Exterior Area Including Residential Common Space Gross Area Including Exterior Area Including 20 E Each Space Gross Area Each Space Gross Area A p: (631)300-1010 - - _ Each Space Walls Each Space Exterior Walls Each Space Walls Each Space Exterior Walls Water Service Rooms 1 28 28 31 31 Water Service Rooms 1 28 8 31 31 _ owner/developer Totals 1 28 31 Totals 1 28 31` - - Conifer Realty M _ _ 1000 University Avenue Suite 500 - _ Appendix E Area Calculations Appendix E Area Calculations Rochester, NY 14607 M 427.38' pp pp 585.324-0500 _ - S >'23;?O,, Table Three:Total Residential Interior Gross Area Percentages Table Three:Total Residential Interior Gross Area Percentages ineyard Views Building 4A ineyard Views-Building 5A �.� 106,,0p, civil engineer . \ N Percent of Percent of LKMA Totallnterior Totallnterior ::�. •1 ��: j o. •. . •_ Total Residential Space Total Interior Total Residential Space Total Interior Gross Area Gross Area 437 &405 Residential Gross Area Residential Gross Area South Country Road 11 - Brookhaven, NY 11719 Dwelling Unit Space 5,118 99.46% Dwelling Unit Space 5,118 99.46% 631.286.8668 Residential Common Space 28 0.54% Residential Common Space 28 0.54% Totals 5,146 : 100.00% Totals 5,146 100.00% m.e.p. &f.p. E M�OE orgth Ches'ineernugt StE. reet B { Table Four:Total Buildiing Gross Area Table Four:Total euildiing Gross Area Rochester, NY 14604 Buildin• Vineyard Views- 4A : : " ineyard Views-Building 5A 585.288.5590 I `• �.� i, : �. , I Total Total Gross Area �'•'•:.�>:.:.; '':q •':'•':::'•`:"' :".'•': :"'••:'•: Total Total Gross Area ... �, 4 Building Totals Interior Including Building Totals Interior Including Gross Area Exterior Walls Gross Area Exterior Walls structural engineer I.: .,'• { :' :' Residential Dwelling Unit Space 51118 5,437 Residential Dwelling Unit Space 5,118 5,437 . TDM Consulting Engineering ..�,• ., _ Residential Common Area 28 31 Residential Common Area 28 31 550 North County Road,Suite E Non-Residential Space 0 0 Non-Residential Space 0 0 Saint James, NY 11780 Grand Totals 5,146 5,468 Grand Totals 5,146 5,468 631.686.5234 ° O O .�� key '.�,... Q NORTH u C ♦ �S� PROPOSED BUILDINGS:4A O \ USE&OCCUPANCY CLASS.: RESIDENTIAL GROUP R-2 Z :o.:.,;,.;,:.:.:::.::::.•::;.:.:, CONSTRUCTION CLASS.: VB AUTOMATIC SPRINKLER SYSTEM: NFPA 13R o ♦ BUILDING HEIGHT: 25.33' O � R «:i.::.::�>':;:<:• ` o.:;:: .:..:.:.:.:....:.:..........:., 0 2 12 S .FT. BUILDING AREA: STORY: 8 0 ♦ 0 U 4 BUILDING: 62 S .FT. 5 Q i ♦ o 0 0 0 o - 0 project I �' O o ° �. o VINEYARD VIEW i ° i 0 �. D i' I D CouY 4 nt Road 8 Greenport, NY 11944 �. \. P - :A ♦ seal : D R ♦ E R ti F Q C� O PROPOSED BUILDINGS:5A USE&OCCUPANCY CLASS.: RESIDENTIAL GROUP R-2 t I..;; •�' CONSTRUCTION C LASS.: VB S:•� AUTOMATIC SPRINKLER SYSTEM: NFPA 13R 2 O F .y BUILDING HEIGHT: 25.33' OF E 0 OVA �.. N - 2 NUMBER F STORIES: U 0 BUILDING AREA. . • B STORY: 2,812 SQ FT - BUILDING 5,624 SO FT E ° -•� issued date description -}- ::` . u 1 03/15/19 Issued for Construction ° ° V: F Z � I I M title CID i M N BUILDING A SITE PLAN I � _ G� drawn by: --- checked by: --- CL scale: 1"=50'-0" project number: 10002 < O scaled inch sheet number 0 564.52' BUILDING A O CO SITE PLAN A0.01 SCALE: V= 50'-0" 0 CD .mow BEATTY HARVEY COCO A R C H I T E C T S , L L P NEW YORK I MARYLAND A 1300 Walt h tman Road, New York, 11747 p: (631)300-1010 owner/developer Conifer Realty 1000 University Avenue Suite 500 Rochester, NY 14607 585.324-0500 civil engineer LKMA 437 &405 South Country Road Brookhaven, NY 11719 631.286.8668 m.e.p. &f.p. M E Engineering, P.E. 150 North Chestnut Street Rochester, NY 14604 585.288.5590 structural engineer TDM Consulting Engineering 550 North County Road,Suite E Saint James, NY 11780 2 1 2 2 631.686.5234 A5.00 A5.01 A5.01 V-OO 58'0%" key TRUE 6'_8" 15'-94" 6'-8" 14'-5%" NORTH + 0 _N F - - - - - - - - - - I - - - - - - LN- - - - - - - - - - - - - - - - - - - � i - - - - - - - - - - - I ' I I I I .•• I I I I I �• ir'777 77"777!! 19'-3%" 2'-0" 14'-1 z„ 2'-0" 19'-3%" I ' •• project I I VINEYARD VIEW I � ' I I I I I I •.� I I �. I i i i i I �• I N I D I County Road 48 I I I I Greenport, NY 11944 \ I I I I I I o seal ED A/ cC I _ • I 1 N I I N I 0 2 0 . Q COQ` A2.01 I I-------- --------------� I I ----------------- ----I I A2.01 F ( I I I I I •• I v issued date description + A5.00 I I I A5.00 1 03/15/19 Issued for Construction , 2-0 j I j 1 ( 2'-0.. • •. I I I I I — I I I I I �.• r J i i i i L .�' •�_ I ' I �• I I • I I N I I I I N I •• I I I .• j I I � I '•� I I I I I ( � I I ° • I I � I '• I I I I I- - I — - - - - - - - -I- - - — I —I - I - - - - - - - - - - - - - - -- -- - _ - - - title 0 1 L - - - - - - - - - - -� ro — — —o " L - - - - - - - - - - -i F o N ' - - - - - - - - -- " '-1 BUILDING A N i N FOUNDATION I v I- °' � N I 10 -`- --- I L -1-I- Q I - `�' PLAN I O-I----------`�--d I I b---` ---------I_ L J L J L J L J 1'9" 10'-11y4" 1,9 (16" 6,_6„ 15'-14" 6,_6„ 6" 1,_9„ 10'-11%„ + 14'-5 4" drawn by: --- G 62'-0%" 2'-0" 29'-1y4" 1414'-5Y4"� 2'_0„ + checked by: -- scale: 3/16"= 1'-0" N aui project number: 10002 2 1 2 1 scaled inch Q A5.00 A5.01 A5.01 A2.00 sheet number 0 U 1 FOUNDATION PLAN BUILDING A m A1.00 SCALE: 3/16"= 1'-0" � 4H A ] 000 1 2 1 31 41 51 6 1 7 g g� -)- N 77 INTERIOR WALL ASSEMBLY LEGEND - �, I ®{ -- - - JL INTERIOR WALL ASSEMBLY SYMBOL I MATERIAL W WOOD STUDS FIRE RATING _. 0 NON-RATED - • ��.-„-„--�•.-,-:-~ too 1 1 HOUR RATED - - - I ., WH16A A G.W.B.ONE SIDE ONLY 112"RC-1 RESILIENT DOUBLE TOP PLATE 112"RC-1 RESILIENT DOUBLE TOP PLATE 112"RC-1 RESILIENT DOUBLE TOP PLATE 1/2"RC-1 RESILIENT----/ DOUBLE TOP PLATE 1/2"RC-1 RESILIENT----/ DOUBLE TOP PLATE 112"RC-1 RESILIENT DOUBLE TOP PLATE 1/2"RC-1 RESILIENT DOUBLE TOP PLATE CHANNEL AT 12"O.C. CHANNEL AT 12"O.C. CHANNEL AT 12"O.C. CHANNEL AT 12"O.C. CHANNEL AT 12"O.C. CHANNEL AT 12"O.C. CHANNEL AT 12"O.C. (1)LAYER 518"TYPE'X' (1)LAYER 518"TYPE'X' (1)LAYER 518"TYPE'X' (1)LAYER 518"TYPE'X' (1)LAYER 518"TYPE'X' (1)LAYER 518"TYPE'X' (1)LAYER 518"TYPE'X'STUD SIZE (1)LAYER 5/8 TYPE X' (1)LAYER 5/8'TYPE'X' (1)LAYER 5/8"TYPE'X' (1)LAYER 518"TYPE'X' (1)LAYER 5/8 TYPE'X` (1)LAYER 5/8"TYPE'X' (1)LAYER 518"TYPE X B E A T T Y HARVEY COC O G.W.B.(BOTH SIDES) G.W.B.(BOTH SIDES) G.W.B.(BOTH SIDES) G.W.B.(BOTH SIDES) G.W.B.(BOTH SIDES) G.W.B.(BOTH SIDES) G.W.B.(BOTH SIDES) A R C H I T E C T S , L L P 4 2 x 4(1 Y"x 3�") G.W.B. G.W.B. G.W.B. G.N.B. G.W.B. G.W.B. G.W.B. 6 2 x 6(1%"x 5Y2") 112"RC-1 RESILIENT 112"RC-1 RESILIENT 1/2"RC-1 RESILIENT NEW YORK I MARYLAND CROSS BRACED(TYP.) � CROSS BRACED(TYP.) CROSS BRACED(TYP.) CHANNEL AT 16"O.C. pp WALL TYPE CHANNEL AT I6 O.C. CHANNEL AT 16"O.C. 1300 Walt Whitman Road, Nevd',York, 11747 A I BLOCKING FOR GRAB BLOCKING FOR GRAB BLOCKING FOR GRAB BLOCKING FOR GRAB " BLOCKING FOR GRAB BLOCKING FOR GRAB 5"CONT.SOUND L p: (631)300-1010 . -� H SHEAR 3 CONT.SOUND 5 CONT.SOUND � BARS PER BATHROOM BARS PER BATHROOM BARS PER BATHROOM BARS PER BATHROOM BARS PER BATHROOM BARS PER BATHROOM ATTENUATION FIRE owner/developer ' D DEMISING ELEVATIONS ELEVATIONS ATTENUATION FIRE ELEVATIONS ELEVATIONS ATTENUATION FIRE ELEVATIONS ELEVATIONS BLANKETS BLANKETS BLANKETS RESILIENT CHANNEL 2x4 WOOD STUDS AT 16" 2x4 WOOD STUDS AT 16" 2x4 WOOD STUDS AT 16" 2x6 WOOD STUDS AT 16" 2x6 WOOD STUDS AT 16" 2x6 WOOD STUDS AT 16" 2x6 WOOD STUDS AT 16" 1s Conifer Realty (1)LAYER %Z'OSB (1)LAYER /2 OSB 1000 University Avenue Suite 500 O.C.U.O.N.SEE O.C.U.O.N.SEE O.C.U.O.N.SEE O.C.U.O.N.SEE O.C.U.O.N.SEE O.C.U.O.N.SEE O.C.U.O.N.SEE Rochester, NY 14507 STRUCTURAL PANEL STRUCTURAL PANEL ""'• "• NOT ACCEPTABLE AT DEMISING STRUCTURAL PLANS STRUCTURAL PLANS STRUCTURAL PLANS STRUCTURAL PLANS STRUCTURAL PLANS STRUCTURAL PLANS STRUCTURAL PLANS 585.324-0500 WALLS&CEILINGS FOR THIS FOR SPACING FOR SPACING FOR SPACING FCR SPACING FOR SPACING FOR SPACING FOR SPACING 77=- 718 PROJECT 518' 518" 518" 5/8" T1/4' 5/8" 518" 5112 518" 518" 5112 518' 518 51/2 5112 "� 5/8 5/8 ' 518" civil engineer 3112" 3112" 3112" 112" 112" 15/32' 112" LKMA 3l " 314' 7114" 7 7/32 7 23132" 15/32" °,n,.l "F ACCEPTABLE AT DEMISING 437&405 1 HR-RATED U.L.DES.0311 South Country Road ° 4 „2•_ WALLS&CEILINGS FOR THIS 1 HR RATED(U.L.DES.U311) 1 HR-RATED(U.L.DES.U311) NON-RATED ( ) Brookhaven, NY 11719 PROJECT W04A NON RATED W04 NON RATED W14 STC RATING:50(45 FIELD TESTED) W06 NON-RATED WD16 STC RATING:50(45 FIELD TESTED) WH06 SHEAR WH16 SHEAR 631.286.8668 STC RATING:50(45 FIELD TESTED) m.e.p. &f.p. B FLOOR PLAN NOTES M/E Engineering, P.E. 150 North Chestnut Street 1. A BLOWER DOOR TEST WILL BE CONDUCTED FOR EACH Rochester,NY 14604 UNIT BY A THIRD PARTY RATER TO MEET 0.3 CFM50/sf OF 585.288.5590 ENCLOSURE PER SECTION R402.4.1.3 OF THE NY 2016 2 1 2 2 structural engineer A5.00 A5.01 A5.01 A2.00 2. REFER TO ENGINEER'S SUBMITTED MECHANICAL MANUALS TDM ConsultingEngineering PER NYS ECC. 550 North County Road,SuiteE BUILDING 4A&5A BUILDING 4A ONLY BUILDING 4A&5A BUILDING 4A ONLY a. MANUAL-J:RESIDENTIAL LOAD CALCULATION Saint James, NY 11780 58'0 4" b. MANUAL-S:RESIDENTIAL EQUIPMENT SELECTION 631.686.5234 c. MANUAL-D:RESIDENTIAL DUCT SYSTEMS 14'- %" 6_8" 15'-9%" 6'_8' 14'-5%" 3. ALL GROUND FLOOR APARTMENT BATHROOMS SHALL MEET THE CRITERIA OF A"TYPE A Al 17.1-2009" 7'-2Y8" T-2%" 3.4" 3'4" 2'6" 5'4 8" 5'4%" 2'6.. 3,4.. 3,�" 7'2%" 7'-2y8" BATHROOM. key NE) PLAN a ° ,. 0 • O O 11, D r N "• CV azzz N ♦ N 1ST FLR EXTERIOR WALL CONSTRUCTION W04 1ST FLR EXTERIOR WALL CONSTRUCTION HARDIEPLANK LAP SIDING OVER o HARDIEPLANK LAP SIDING OVER CONTINUOUS AIR&WATER RESISTIVE w rRue o TELCO&WATER = CONTINUOUS AIR&WATER RESISTIVE BARRIER OVER Y2"EXTERIOR GRADE �' `" 1 " SERVICE ROOM -v z BARRIER OVER/ EXTERIOR GRADE project PLYWOOD SHEATHING FASTENED TO 2x6U WD16 W04 WOOD STUDS WITH R-21 BATT INSULATION F4 0-0 500 W14 PLYWOOD SHEATHING FASTENED TO 2x6 WD16 W04 WOOD STUDS WITH R-21 BATT INSULATION VINEYARD VIEW OVER CONTINUOUS VAPOR BARRIER AND%" o W04 W04 -I1� o OVER CONTINUOUS VAPOR BARRIER AND%" GYPSUM WALLBOARD ON INTERIOR SIDE. N .5!-0" W14 W04 W04 N GYPSUM WALLBOARD ON INTERIOR SIDE. W04 W04 FINISHED D W04 W06 I --� � �---- woo IIf III I ---- -- woo r===== L-----� �; woo County--===1 I G eenporf, NY 181944 �� -�I l lj Llo ----- W04 u - W04 \ I III ~O r ' o seal 0 - W04 r__ /1 Fs"C/ �. u BATHROOM-D O W04 I n I -- W04 Q W04 W04 i W04 W04 W04 W04 W04 OD W04 BATHROOM-2B4 �� WO4 BATHROOM-2B O lM BATHROOM-2A ° C3' BUILDING 5A ONLY Fy --� °r 'TYPE"B"Al "TYPE"B"A117.1-2009" �'TYPE"A"A117.1-2009" ---- r-, W04 W04 � d W04 -----, W04 W04 W04 ----- W04 W04 r-----, I _� 2 02 _, A2.01 v a, ---- O O --- --- --- ;;- -----,", -- - o o, A2.01 ----- O O -- \_/�F O ii av -- r- ---- r I0-" --�I--� '•.� ° r- , ----- - E WH06 i --- --- ' - --- i W04 ==i== -� > . W04 issued date description 1 iii W06 W04 iii i----- "' i -I E yah_ r=- - 1 I III I I l A5.00 W04A W14 ------- I a�_ O 0 p L_J--- W14 W04 WH06 W04A f ° A5.00 W14 W04 WHO6 W04A 1 03/15/19 Issued for Construction --- Cj-4 1 r----r��---- 00 I� 1 I C I W04 H N� ---- ; 2 06/06/19 Proiect Bulletin #1 _o rt- L --------- ��r--- ii J W04 ----- ----- --- \ W04 I a 2'-0" o _ __ 3 07101119 Proiect Bulletin #4 II - ' t II I I' I M II I I - II M c� L UNIT 403L-- UNIT 501 --- I I L-- -- OA NUMBER: 401 &501 --- --- UNIT NUMBER: 402&502 -------- UNIT UNIT NUMBER: 403 1 A ___ ___ UNIT TYPE: B1 --- --- UNIT TYPE: C1 --- --- UNIT TYPE: B1-ANSI O UNIT NUMBER: 503 A4.00 --- --- UNIT TYPE: B1 BEDROOMS: 2 W14 -------- BEDROOMS: 3 -------- W14 BEDROOMS: 2 -------- BEDROOMS: 2 GROSS AREA: 986 S.F. --- --- GROSS AREA: 1357 S.F. --------- GROSS AREA: 986 S.F. -� L M ANSI UNIT PLAN Z --- --- GROSS AREA: 986 S.F. NET AREA(HCR): 926 S.F. --- --- NET AREA(NCR): 1267 S.F. --- --- NET AREA HCR: 926 S.F. � L9 -------- 0!7y NET AREA(HCR): 926 S.F. 2 / --- - 16 1 -- --- 2 -- --- 2 F 0 A4.00 VVV A4.01 A4.00 OA A4.00 UNIT PLAN UNIT PLAN UNIT 503 PLAN UNIT 503 PLAN Cl) Al _ Al o Al N g •• °. •. aa. ° °© °� o q titley - .. a • • , o � - � N N - - 4.7„ OA .5--5Y4" 4.5., . . �, 4'-4" 6'-1" 6'-6Y4" °, T-9%" A; 6'-53 : •. .� BUILDING A 2 .4'-4' �, 4'-5" /a 4'-7' A " • °.� ° ° ' ' �.M •• •. '°• °' •a .' • ° �•• �, •; .p• s .o• .�•e• °• ^.� n� tn, .p.. •°• �s' �• FIRST FLOOR I�R . �•. - ..• .. . PLAN i n• 3 " 1 _ 3 0 11 - 15-1 _ _ 11-9. a 1 9 6 6-6 / s s s 1 9 1011/ r 1.9 C PARTIAL PLAN FOR BLDG-5 2'_0 14'-5/ 29'-1/" 14'-5/ 2'_0" Ili drawn by: checked by: � 62'-0%4" --- scale: 3/16"= V-0" U N project number: 10002 2 1 2 1 1 FIRST FLOOR PLAN scaled inch UA5.00 A5.01 A5.01 A2.00 A1.01 SCALE: 3/16" = 1'-0" a (BLDG-4 SHOWN) sheet number U .� -� BUILDING ,A - } m r-1 1 2 1 31 4 1 51 61 7 1 8 - INTERIOR WALL ASSEMBLY LEGEND INTERIOR WALL ASSEMBLY SYMBOL MATERIAL — — — W WOOD STUDS FIRE RATING 0 NON-RATEDAN& 1 1 HOUR RATED - �_ « « " WH16A A G.W.B.ONE SIDE ONLY 1/2 RC-1 RESILIENT DOUBLE TOP PLATE 112 RC-1 RESILIENT DOUBLE TOP PLATE 112 RC-1 RESILIENT DOUBLE TOP PLATE 112"RC-1 RESILIENT---IDOUBLE TOP PLATE 112"RC-1 RESILIENT DOUBLE TOP PLATE 1/2' RC-1 RESILIENT--IDOUBLE TOP PLATE 112 RC-1 RESILIENT DOUBLE TOP PLATE CHANNEL AT 12"O.C. CHANNEL AT 12"O.C. CHANNEL AT 12"O.C. CHANNEL AT 12"O.C. CHANNEL AT 12"O.C. , , CHANNEL AT 12"O.C. CHANNEL AT 12"O.C. « , , 1 LAYER 5/8"TYPE'X' (1)LAYER 518"TYPE'X' (1)LAYER 518"TYPE X (1)LAYER 518'TYPE'X (1)LAYER 5/8"TYPE X' (1)LAYER 518"TYPE'X' (1)LAYER 518 TYPE X (1)LAYER 5/8"TYPE X (1)LAYER 518' TYPE X (1)LAYER 518"TYPE X (1)LAYER 518 TYPE X B E AT T Y HARVEY COC O STUD SIZE ( ) G.W.B.(BOTH SIDES) G.W.B.(BOTH SIDES) (1)LAYER 518"TYPE'X' G.W.B.(BOTH SIDES) (1)LAYER 5/8"TYPE'X' G.W.B.(BOTH SIDES) G.W.B.(BOTH SIDES) G.W.B.(BOTH SIDES) (1)LAYER 5/8"TYPE'X' G.W.B.(BOTH SIDES) 4 2 x 4(1 Y"x 31 z") G.W.B. G.W.B. G.W.B. G.W.B. G.W.B. G.W.B. G.W.B. A R C H I T E C T S , L L P 6 2 x 6(12"x 52") 112"RC-1 RESILIENT 112"RC-1 RESILIENT 112"RC-1 RESILIENT NEW YORK I MARYLA^I D CROSS BRACED(TYP,) CROSS BRACED(TYP.) CROSS BRACED(TYP.) t) FCHANNEL AT 16"O.C. CHANNEL AT 16 O.C. CHANNEL AT 16"O.C. WALL TYPE 1300 Walt Whitman Road, New`York, 11747 A I BLOCKING FOR GRAB BLOCKING FOR GRAB « BLOCKING FOR GRAB BLOCKING FOR GRAB BLOCKING FOR GRAB BLOCKING FOR GRABF " A p:(631)300-1010 —� H SHEAR 3 CONT.SOUND 5 CONT.SOUND 5 CONT.SOUND + BARS PER BATHROOM BARS PER BATHROOM BARS PER BATHROOM BARS PER BATHROOM BARS PER BATHROOM BARS PER BATHROOM owner/developer D DEMISING ELEVATIONS ELEVATIONS ATTENUATION FIRE ELEVATIONS ELEVATIONS ATTENUATION FIRE ELEVATIONS ELEVATIONS ATTENUATION FIRE BLANKETS BLANKETS BLANKETS RESILIENT CHANNEL 2x4 WOOD STUDS AT 16" 2x4 WOOD STUDS AT 16" 2x4 WOOD STUDS AT 16" 2x6 WOOD STUDS AT 16" 2x6 WOOD STUDS AT 16" 2x6 WOOD STUDS AT 16" OSB (1)LAYER 132"OSB 1000 University Avenue Suite 500 (1)LAYERI32" 2x6 WOOD STUDS AT 16" Conifer Realty O.C.U.O.N.SEE O.C.U.O.N.SEE O.C.U.O.N.SEE O.C.U.O.N.SEE O.C.U.O.N.SEE O.C.U.O.N.SEE STRUCTURAL PANEL O.C.U.O.N.SEE STRUCTURAL PANEL Rochester, NY 14607 - pwa a -aE NOT ACCEPTABLE AT DEMISING STRUCTURAL PLANS STRUCTURAL PLANS STRUCTURAL PLANS STRUCTURAL PLANS STRUCTURAL PLANS STRUCTURAL PLANS STRUCTURAL PLANS 585.324-0500 `;. FOR SPACING FOR SPACINGL FOR SPACING FOR SPACING FOR SPACING FOR SPACING FOR SPACING D WALLS&CEILINGS FOR THIS 7/8 I PROJECT 5/8" + 5/8" b/8" 5/8" 518" 518" " 518" 5/8" 518" 518" " 518" : ' - " S 51/2 5112' 5112 5/8" 5112 518 civil engineer 3112" 3112" 3112" 112 112" 15132" 112" LKMA 1l " 3/ 1/4' 314 71/4 7 7132 723/32 15132 437 &405 ACCEPTABLE AT DEMISING 1 HR-RATED(U.L.DES.U311) South Country Road q WALLS&CEILINGS FOR THIS 1 HR-RATED(U.L.DES.U311) 1 HR-RATED(U.L.DES.U311) NON-RATED Brookhaven, NY 11719 NON RATED W04 NON-RATED PROJECT W14 STC RATING:50(45 FIELD TESTED) W06 NON-RATED WD16 STC RATING:50(45 FIELD TESTED) WH06 SHEAR (WE) SHEAR 631.286.8668 = , STC RATING:50(45 FIELD TESTED) m.e.p. &f.p. FLOOR PLAN NOTES M/E Engineering, P.E. R 150 North Chestnut Street 1. A BLOWER DOOR TEST WILL BE CONDUCTED FOR EACH Rochester,NY 14604 UNIT BY A THIRD PARTY RATER TO MEET 0.3 CFM501sf OF 585.288.5590 ENCLOSURE PER SECTION R402.4.1.3 OF THE NY 2016 structural engineer 2. REFER TO ENGINEER'S SUBMITTED MECHANICAL MANUALS TDM Consulting Engineering PER NYS ECC. 550 North County Road,Suite a. MANUAL-J:RESIDENTIAL LOAD CALCULATION Saint James, NY 11780 2 1 2 2 b. MANUAL-S:RESIDENTIAL EQUIPMENT SELECTION 631.686.5234 c. MANUAL-D:RESIDENTIAL DUCT SYSTEMS A5.00 A5.01 A5.01 A2.00 3. ALL GROUND FLOOR APARTMENT BATHROOMS SHALL MEET THE CRITERIA OF A"TYPE A Al 17.1-2009" 58'-04" BATHROOM. key 11T7 14'-[y4" 14' 4" 6,-8« 15-9%" 6-8" 14'-54" PLAN 7'-2%" 7'_2%" 3.4« 3,4« 7'-10%" 7'-10%" 3,�« 3,�, 7'2%" 7'2%" --- I o C CV © I O o — ti ' r• N� 2ND FLR EXTERIOR WALL CONSTRUCTION I 2ND FLR EXTERIOR WALL CONSTRUCTION W045 l a HARDIE-5/"x 1%"TRIM BATTENS OVER%" O I O i HARDIE- «x 1 n TRIM BATTENS OVER' TRUE PANELS(COORDINATE PANEL JOINTS WITH B B PANELS(COORDINATE PANEL JOINTS WITH TRIM BATTENS)OVER CONTINUOUS AIR& W04 TRIM BATTENS)OVER CONTINUOUS AIR& W04 project WATER RESISTIVE BARRIER OVER 2" i WATER RESISTIVE BARRIER OVER Y2" WD16 VINEYARD VIEW EXTERIOR GRADE PLYWOOD SHEATHING EXTERIOR GRADE PLYWOOD SHEATHING FASTENED TO 2x6 WOOD STUDS WITH R-21 W04 W04 W04 FASTENED TO 2x6 WOOD STUDS WITH R-21 W04 W04 BATT INSULATION OVER CONTINUOUS �T BATT INSULATION OVER CONTINUOUS VAPOR BARRIER AND 4"GYPSUM -� VAPOR BARRIER AND%"GYPSUM WALLBOARD ON INTERIOR SIDE. o W04 W06 I WALLBOARD ON INTERIOR SIDE. D yy _ r_=__= jzy) }� County Road 48 C1 �-----JI woo - ----- HIM, ------ I � -----�� woo woo -----��il , Greenport. NY 11944 ' 4 III o seal W0 M wo4 W04 W04 M BATHROOM•D �f D W04 ^ BATHROOM-28 W04 W04 W04 < 5 P G E C � D BATHROOM-2B o4 C, "TYPE"B"A117.1-2009° O W04 W04 I BATHROOM-28 c� ( - 10 TYPE"B"A117.12009" 0\ W04 w W04 i i TYPE"B"A117.1-2009" W04 W04 I I :L I R!toI � r-----�I - - - W04 — -----J r-----�I W04) ---- 4?' -- � W04 _ I �--------- '- o � 2 W04 21 - Off/ A2.01 r---- O O ---; W06 W04 I ` O O --- - LI O O --- wo4 --- O OL- -------- ---- - --- E 1 D --- ------ ------ O O W 0 I 1 I I issued date description W04 F+W04 ---A --- � A5.00 W04A 1 03/15/19 Issued for Construction --- --- _ 2 06/12/19 Project Bulletin #2 ' KITCHEN-B 5.00 ___ KITCHEN-B 2111 0 J W04 2'-0" 3 07/01/19 Project Bulletin #4 --- --- --- --- --- --- I Cl) --------- ----------- ------- --_ ___ II I -- --- --- --- --- --- W04 � � �-J --- -- --I-- -1 --- --- OA UNIT NUMBER: 404,504 --- --- W04 --- --- UNIT NUMBER: 405 OA --- --- UNIT NUMBER: 505 UNIT TYPE: B2 --- --- --- --- UNIT TYPE: B2 --- --- UNIT TYPE: B2 BEDROOMS: 2 W04 --- --- -- --- BEDROOMS: 2 -- GROSS AREA: 1054 S.F. ---- --- BEDROOMS: 2 - - -- W04 GROSS AREA: 1054 S.F. � � ------- GROSS AREA: 1054 S.F. v C? NET AREA(HCR): 1000 S.F. --- --- NET AREA(HCR): 1000 S.F. � --- --- NET AREA(HCR): 1000 S.F. W04 --- --- WD16 --- --- W04 ------- ` 3 2 4 ------- 3 F /C A4.00 A4.01 A4.00 L A4.00 t UNIT PLAN 4 UNIT PLAN (UNIT 405 PLAN UNIT 505 PLAN M B1 o - - - - - - - - - - - - - oo 61 - Q title N - - -- N F BUILDING A 7'-2%" T-2%8":114'-6%" 14-6 8" T-2%" SECOND FLOOR PLAN l 1 - - - - - - - - - - - - - 3 PARTIAL PLAN FOR BLDG-5 14'-54 A6.03 " 2'-0" 29'-1Y4" 14'-54" 2.4. drawn by: -- 62'-0 4« checked by: --- scale: 3/16"= V-0" 1 SECOND FLOOR PLAN project number. 10002 2 1 2 1 scaled inch UA5.00 A5.01 A5.01 A2.00 �O2 SCALE: 3/16" = 1'-0" (BLDG-4 SHOWN) sheet number 0 U BUILDING A cc _�� _� +4 � � 2+- 3T- 4i- + +6 � H9 A ] • 02 �+- 1 ROOF NOTES 1. DETAILS WHICH ARE DRAWN IN HALF SECTION SHALL BE CONSIDERED TO INDICATE THAT THE SAME CONDITION ..,.- EXISTS ON THE HALF NOT SHOWN. j 2. ALL DETAILS ARE MEANT TO SHOW MINIMUM y; . REQUIREMENTS.ANY REQUIREMENTS OF THE MANUFACTURER WHICH EXCEED THAT INDICATED SHALL ALSO BE SATISFIED. 3. ALL VERTICAL SURFACES WHICH ARE TO RECEIVE NEW FLASHING SHALL BE PREPARED IN ACCORDANCE WITH B E A T T Y HARVEY COC O MANUFACTURER'S DIRECTIONS WITHOUT ADDITIONAL COST ARC H I T E C T S , LLP TO THE CONTRACT. NEW YORK ( MARYLAND 4. CLEAN ALL DEBRIS FROM ALL ROOF AREAS. 1300 Wait Whitman Road, New York, 11747 A 5. ALTHOUGH DETAIL REFERENCES MAY BE SHOWN IN ONLY ,A p: (631)300-1010 ONE PLACE ON ROOF PLAN DRAWINGS.EACH SHALL BE -r CONSIDERED TYPICAL AND APPLICABLE TO ALL LOCATIONS owner/developer AND CONDITIONS SIMILAR TO THOSE WHERE THE DETAIL IS Conifer Realty INDICATED FOR THAT ROOF AREA. 1000 University Avenue Suite 500 6. THE CONTRACTOR SHALL ENSURE SAFETY AND STABILITY Rochester, NY 14607 OF THE STRUCTURE AT ALL TIMES DURING THE 585.324-0500 CONSTRUCTION TIMES. 7. REPLACE AND REPAIR TO ORIGINAL STATE ANY AND ALL CONDITIONS THAT WERE DAMAGED BY CONSTRUCTIONS civil engineer (INCLUDING WALKS,CURBS,WALLS,FLOORS,CEILINGS, LKMA ROOF STRUCTURE,ETC.) 437 &405 8. THE CONTRACTOR SHALL MAKE NO STRUCTURAL CHANGES South Country Road WITHOUT WRITTEN APPROVAL OF THE OWNER/ARCHITECT. Brookhaven, NY 11719 9. NO HAZARDOUS MATERIALS,SOLVENTS AND FUELS,ARE TO 631.286.8668 BE STORED ON THE ROOF(OVER NIGHT IS NOT ACCEPTABLE)INCLUDING EQUIPMENT OPERATED BY m.e.p. &f.p. COMBUSTIBLE FUELS,ALL HAZARDOUS MATERIALS SHALL M/E Engineering, P.E. B BE STORED IN LOCATIONS DIRECTED BY THE B 150 North Chestnut Street OWNER/GENERAL CONTRACTOR.THE STORAGE AREA WILL Rochester, NY 14604 BE WITHIN A REASONABLE DISTANCE FROM THE MAIN 585.288.5590 ROOF. 10. THE CONTRACTOR SHALL PROVIDE A FIRE WATCH WHEN structural engineer OPERATIONS ARE CONDUCTED WHICH INVOLVE OPEN FLAME WORK.A MINIMUM OF TWO(2)FIRE EXTINGUISHERS TDM Consulting Engineering SHALL BE ON THE ROOF AT ALL TIMES. 550 North County Road,Suite E 11. NO STORAGE(OTHER THAN FOR FLAMMABLE LIQUIDS)WILL Saint James, NY 11780 2 1 2 2 BE PROVIDED EITHER ON THE GROUND OR IN THE BUILDING. 631.686.5234 A5.00 A5.01 A5.01 A2.00 ALL STORAGE WILL BE ON THE ROOF WITHIN THE STRUCTURAL LIMITATIONS. 12. PROVIDE CRICKETS AT HIGH SIDE OF ALL SQUARE AND RECTANGULAR PENETRATIONS.PROVIDE ADDITIONAL BLOCKERS UNDER CURBS WHERE REQUIRED IN ORDER TO key MAINTAIN 8'FLASHING HEIGHT. TRUE 13. ALL OPEN ENDS OF FLASHING SHALL HAVE VERTICAL NORTH LEADER LEADER LEADER LEADER TERMINATION BARS. 14. PROVIDE FLASHING AND ALL ROOF PERIMETERS, + ROOF/WALL TRANSITIONS,CORNERS,PITCH CHANGES,AND + GUTTER GUTTER GUTTER GUTTER PENETRATIONS. 15. PROVIDE CONTINUOUS ICE AND WATER SHIELD EXTENDING O 1 1 1 _1021FROM THE LOWEST EDGES OF ALL ROOF SURFACES TO A POINT AT LEAST 24"INSIDE THE EXTERIOR WALL LINE OF 1 1 ATTIC DRAFTSTOPPING 1 1 THE BUILDING AT ALL ROOF EAVES AND AT LEAST 36"WIDE - O AT ALL VALLEYS. o 16. INSTALL ROOFING IN ACCORDANCE WITH NRCA AND MANUFACTURER'S WRITTEN RECOMMENDATIONS AND WRITTEN INSTRUCTIONS, - - - 17. USE STEP FLASHING AT SHINGLE ROOF/WALL TRANSITIONS, 18. ROOF VENTILATION:APPROXIMATELY 50%AT RIDGE VENTS. project 50%IN SOFFITS. 19. EXTEND VALLEY FLASHING MIN.12"ON BOTH SIDES OF VINEYARD VIEW - - - - - - - - - - - ----- - - - VALLEY 20. EXTEND RIDGE FLASHING MIN.12"ON BOTH SIDES OF RIDGE. 21. ALL GABLES MUST VENT ATTIC.DO NOT RUN PLYWOOD SUBSTRATE UNDER GABLES. ICE&WATER 22. ROOFING MATERIALS SHALL BE MINIMUM CLASS'C' County Road 48 MEMBRANE 23. ALL GUTTERS SHALL BE'K'TYPE-5"WIDE.DOWNSPOUTS Greenport, NY 11944 TO BE 3"DIAMETER PLAIN ROUND. seal 24. ALL ROOF PENETRATIONS OF FLUES,VENTS,CAPS,HOODS, RIDGE VENT ICE&WATER ETC.TO BE PRIMED AND PAINTED TO MATCH ROOF COLOR. F�E�ARG+y/ MEMBRANE 25. VENT FLASHING:EXTEND MINIMUM 6"ALL AROUND VENT. �5 �aRE - Z 26. LOCATE ROOF VENTS/PENETRATIONS TO REAR.ROOF �� ,�P -00 F0 'U SLOPES TO MINIMIZE VISIBILITY.GANG VENTS IN ATTIC GUTTER o ¢ GUTTER SPACE WHERE PERMITTED BY CODE.SEE MECHANICAL M o PLANS FOR FURTHER INFORMATION. i LEADER LEADER a 1 2 FBF NE`Ny A2.01 A2.01 E, E issued date description �- 1 M g 1 + A5.00 X a A5.00 1 03/15/19 Issued for Construction O ol N CV N + 1 1 1 1 title ICE&WATER- - 2 RIDGE VENT BUILDING A -- - - - _� - - -- ---- ROOF PLA N LEADER ( M _ LEADER GUTTER - --------- --- - �- - -- ---- -------- --- ------ - -- _ _ GUTTER DOWNSPOUT NOTES GUTTER GUTTER 1. TERMINATE DOWNSPOUT AT PVC BOOT WITH CLEANOUT AS LEADER LEADER SPECIFIED BY CIVIL ENGINEER.TIE INTO UNDERGROUND G + STORM WATER MANAGEMENT SYSTEM AS SPECIFIED BY -�- drawn by: --- CIVIL ENGINEER. checked by: --- scale: 3/16"= V-0" v; project number: 10002 2 1 2 1 scaled inch Q A5.00 A5.01 A5.01 A2.00 o sheet number U O U ROOF PLAN BUILDING A 1 a A1.03 SCALE: 3/16"= 1'-0" @ H A ]m 1 2+ 3+- + 6+- I +8 -y • -f -+- CM O EXTERIOR MATERIAL LEGEND TAG DESCRIPTION COLOR SPECIFICATION u 1 O HARDIE A DIE PANEL VERTICAL SIDING TBD 0 3/"x 2Y"HARDIE TRIM BATTEN BOARD TBD 3O 7Y,"HARDIE PLANK LAP SIDING TBD ® HARDIE PANEL TBD 50 5/4 x 31/2" HARDIE CORNER TRIM BOARD TBD B E A T T Y HARVEY COC O © 5/4 x 31/2" HARDIE WINDOW&DOOR TRIM BOARD TBD A R C H I T E C T S , L L P 7 ASPHALT SHINGLE ROOFING TBD NEW YORK I MARYLAND1300 Walt Whitman Road, New York, 11747 ® 36"x 80"FIBERGLASS ENTRANCE DOOR TBDI q p: (631)300-1010 90 36"x 80"METAL DOOR TBD owner/developer 10 72"x 80"DOUBLE DOOR TBD Conifer Realty 1000 University Avenue Suite 500 11 72"x 80"VINYL SLIDING PATIO DOOR WHITE Rochester, NY 14607 12 32"x 38"VINYL SINGLE HUNG WINDOW WHITE 585.324-0500 13 32"x 60"VINYL SINGLE HUNG WINDOW WHITE civil engineer 14 36"x 72" VINYL SINGLE HUNG WINDOW WHITE LKMA 15 32"x 36"SIMULATED PICTURE WINDOW WHITE 437 &405 South Country Road 16 WALL VENT LOUVER TBD Brookhaven, NY 11719 17 ALUMINUM GUTTER AND LEADER TBD 631.286.8668 18 6"x 6"CLASSIC VERSAWRAP COLUMN COVER TBD m.e.p. &f.p. 19 O ALUMINUM RAILING TBD M/E Engineering, P.E. g 150 North Chestnut Street 20 36"x 82"FULL LIGHT SINGLE STEEL DOOR TBD Rochester, NY 14604 /27_ 1 2 21 72"x 82"FULL LIGHT DOUBLE STEEL DOOR TBD 585.288.5590 A5.00 A5.01 A5.01 NOTES: structural engineer 1. PROVIDE ADD ALTERNATE FOR WINDOW AND DOOR BLACK FRAMES. 2. PROVIDE ADD ALTERNATE FOR EVERLAST SIDING. TDM Consulting Engineering 550 North County Road,Suite E T.O.ROOF TRUSS RIDGE Saint James, NY 11780 ELEV.+25'-4" 631.686.5234 UJ - - 12 1 12 44 412T 7 ;, 11 - — — - r key cJ TRUE __ NORTH 6 - T.O.SECOND FLOOR TOP PLATE ELEV.+17'-9" 4 2 A6.03 B1 B1 'i O . . r - 1 wzo 19 T 't 1 as 1 °° a� f 8 � = o _ __ _ _ --- T.O.SECOND FLOOR SUBFLOOR j ELEV.+9'-7 8" a 18 4 project / 3 VINEYARD VIEW 4 a, D T.O.FIRST FLOOR SLAB ++ $–a I'/ /// 49 \ J_ \ � I — County Road 48 ELEV.0'-0" Greenport, NY 11944 _ L- 1 J__L ---------- _L --------- -_-_ J L _1__L seal ' --- -�- - -{ --- r -- ---------------- -- JJ I I I I B.O.FOOTING ELEV.-3'-6" 19P E J p FO 5 r� 1 FRONT ELEVATION FO NE`N� A2.00 SCALE: 3/16"= 1'-0" E issued date description 2 1 2 1 03/15/19 Issued for Construction A5.01 A5.01 A5.00 - -- - - -- - - —-- - --_-1 --- --- -- — — - - - - - -- - -- --- --.. T.O.ROOF TRUSS RIDGE d - ELEV.+25'-4" j 7 LU 2_ - 12 -- -411 LU 14 F 13 _ T.O.SECOND FLOOR TOP PLATE -- ELEV.+1T-9" 71, INSTALL FLOODLIGHT FIXTURE 2 ON SOUTH ELEVATION OF 13 _ I �i BUILDING4 &5 ONLY. 1 LL. z C B G a O n 0 .' _ N title N _ _ ® ® — ®® — ® T.O.SECOND FLOOR SUBFLOOR BUILDING A �- — -- - --- ELEV. 9-7 FRONT & REAR 4 =� ELEVATIONS zo -- - - - B _ � drawn by: _ _ T.O.FIRST FLOOR SLAB A. CL -------------------------------_i -------------� ___ -------------------_ __ L--- ________ i------------------------------- ELEV.0'-0" checked by --- __J - I I -----------------1 I- 9 m scale: -r` -r � 3/16"= 1'-0" a -L---------4-------------------- L__J-.----- ----I --------- -----__ JB.O.FOOTING _____________ t__-- _-___ ELEV.-3'-6" project number: 10002 Q U scaled inch sheet number N = 2 REAR ELEVATION BUILDING A m A2.00 SCALE: 3/16" = 1'-0" 9 N z. CD M EXTERIOR MATERIAL LEGEND TAG DESCRIPTION COLOR SPECIFICATION 10 HARDIE PANEL VERTICAL SIDING TBD 20 3/"x 2Y"HARDIE TRIM BATTEN BOARD TBD 30 7Y,"HARDIE PLANK LAP SIDING TBD ® HARDIE PANEL TBD 50 514 x 31/2" HARDIE CORNER TRIM BOARD TBD B E A T T Y HARVEY COC O © 514 x 31/2" HARDIE WINDOW&DOOR TRIM BOARD TBD A R C H I T E C T S , L L P 70 ASPHALT SHINGLE ROOFING TBD NEW YORK I MARYLAND 1300 Walt Whitman Road, New York, 11747 + ® 36"x 80"FIBERGLASS ENTRANCE DOOR TBD q p: (631)300-1010 90 36"x 80"METAL DOOR TBD owner/developer 10 72"x 80"DOUBLE DOOR TBD Conifer Realty 1000 University Avenue Suite 500 11 72"x 80"VINYL SLIDING PATIO DOOR WHITE Rochester, NY 14607 12 32"x 38"VINYL SINGLE HUNG WINDOW WHITE 585.324-0500 13 32"x 60"VINYL SINGLE HUNG WINDOW WHITE civil engineer 14 36"x 72" VINYL SINGLE HUNG WINDOW WHITE LKMA 15 32"x 36"SIMULATED PICTURE WINDOW WHITE 437 &405 South Country 16 oad WALL VENT LOUVER TBD Brookhaven, NY 81719 17 ALUMINUM GUTTER AND LEADER TBD 631.286.8668 18 6"x 6"CLASSIC VERSAWRAP COLUMN COVER TBD m.e.p. &f.p. ALUMINUM RAILING TBD M/E Engineering, P.E. B 19 B 20 36"x 82"FULL LIGHT SINGLE STEEL DOOR TBD 150 North Chestnut Street Rochester, NY 14604 21 72"x 82"FULL LIGHT DOUBLE STEEL DOOR TBD 585.288.5590 1 A5.00 NOTES: structural engineer 1. PROVIDE ADD ALTERNATE FOR WINDOW AND DOOR BLACK FRAMES. TDM Consulting Engineering 7 2. PROVIDE ADD ALTERNATE FOR EVERLAST SIDING. 550 North County Road,Suite E T.O.ROOF TRUSS RIDGE Saint James, NY 11780 631.686.5234 ELEV.+25'-4" UJ 14 12 2 S - -�— - - -12" 21-T- -�_ ' — — — — — — — � key 17 TRUE C'! RT LU - - - - --- -T --- T.O.SECOND FLOOR TOP PLATE ° — — — — — - — — — — 13 ELEV.+17'9"Ir Fqr + --- 2 0o B A A 19 0 U-5 t; N __ O �, ------- T.O.SECOND FLOOR SUBFLOOR •' - = o ELEV.+9'-7%" ° 4 18 project 3orVINEYARD VIEW 4 A A T.O.FIRST FLOOR SLAB County Road 48 ELEV.0'-o" Greenport, NY 11944 -------- ---------------------- i i i i i seal -------------------------- -------------- � --1 L_L cn L -------------------------------------------------------------- -------L---------------------------------1----i �----� B.O.FOOTING \5,��ED G/�G,ti� — ELEV.-3'-6" <L� vJP ORE c C' O � i co �O i 0 1 LEFT SIDE ELEVATION oF=NE��` A2.01 SCALE: 3/16"= 1'-0" issued date description 1 03/15/19 Issued for Construction 1 A5.00 T.O.ROOF TRUSS RIDGE _ - ELEV.+25'-4" VP d -- 7 -12 - 12 2 ,12 14 17 ci LU - T.O.SECOND FLOOR TOP PLATE 13 — — - -- - - - - - - - - - - - - - ELEV.+17'-9" 6 19 , 00 "v z A A B ;�, title N o - 5 �, Ei T.O.SECOND FLOOR SUBFLOOR BUILDING A Ei U- I]- - = o — — — — ELEV.+9'-7 a" 18 4 LEFT & RIGHT SIDE LU 3 ELEVATIONS r D L F- D 4 0 , _ A + - - + drawn by: --- T.O.FIRST FLOOR SLAB checked by: --- ELEV.0'-0" r i i i i i i i 1 � - ----------- I � M scale: 3/16"= V-0" ------------------------------- ---------________---------------------------------------- --------- __ -� -----------------------------_.---1 ---_ __ { -------------_-____�__________________ _______ B.O.FOOTING project number: 10002 � � ----------�_____ ELEV.-3'-6" U C scaled inch sheet number o INSTALL FLOODLIGHT FIXTURE U BU SOUTH ELEVATION BUILDING A BUILDING 4A&5A ONLY.. 2 RIGHT SIDE ELEVATION a A2.01 SCALE: 3/16" = 1'-0" ca @4H A2001 l+ 1 1 + S+- 4+- 51 + +8 F- M LIGHTING FIXTURE LEGEND O TYPE SYMBOL DESCRIPTION TYPE SYMBOL DESCRIPTION TYPE SYMBOL DESCRIPTION NOTES: .ij A SURFACE MOUNTED LED E 0 SURFACE MOUNTED LED FE O SEMI-FLUSH MOUNT COMPACT FLUORESCENT 1. ALL CEILINGS BE MOUNTED TO THE UNDERSIDE OF THE STRUCTURE ABOVE ` UNLESS OTHERWISE NOTED. 2. ALL CEILINGS SHALL BE 5/"GWB UNLESS OTHERWISE NOTED. 1° `: '".' r.'. B SURFACE MOUNTED LED F1 C> WALL MOUNTED LED 3 LAMP VANITY LIGHT I SURFACE MOUNT LED 3. PROVIDE SUBMITTAL TO THE RESPONSIBLE PARTY OF THE MANUFACTURER'S CUT-SHEET FOR EACH TYPE OF LIGHT FIXTURE INSTALLED.WHERE APPLICABLE,ENSURE THE ENERGY STAR LABEL REMAINS ATTACHED TO THE C 0 SURFACE MOUNT LED FBFIXTURE. B E A T T Y HARVEY COC O 0 SURFACE MOUNTED LED CFL CEILING FAN WITH LIGHT 4. REFER TO MECHANICAL,FIRE PROTECTION&FIRE ALARM PLANS FOR ARC H I T E C T S , L L P COORDINATION LOCATION OF CEILING DEVICES. NEW YORK I MARYLAND A D 3 WALL MOUNTED EXTERIOR LANTERN FD 0 SURFACE MOUNTED LED 1300 Walt Whitman Road, New York, 11747 p: (631)300-1010 owner/developer Conifer Realty 1000 University Avenue Suite 500 Rochester, NY 14607 585.324-0500 civil engineer LKMA 437 &405 South Country Road Brookhaven, NY 11719 631.286.8668 m.e.p. &f.p. M E Engineering, P.E. B I_ ,B 150 North Chestnut Street Rochester, NY 14604 585.288.5590 structural engineer TDM Consulting Engineering 550 North County Road,Suite E Saint James, NY 11780 631.686.5234 key TRUE NORTH O ❑ 0 0 B 0 FD OB B J 0 B project J 0B VINEYARD VIEW g + LU ° � Q T_o�� ,,,_oounty Road 48 v A60VE SLAB ABO VE SLAB Greenport, NY 11944 OC F1 OC seal C RED AR E m O E �� C O N B O R E O B0 VE SLAB m� 0 0 O � a ABOVE SLAB O B F1 OC OE OE OC �qT o 22 y0Q�- \ / OC F1 F OF NE`N \ / III_ F \ / issued date description OE \ / q OE A --� A X 0 1 03/15/19 Issued for Construction D OC / \ OC / \ OC UNIT NUMBER \ / 0C 0C \ / UNIT NUMBER 401 &501 \/ UNIT NUMBER \/ 403&503 UNIT TYPE /\ 402&502 /\ UNIT TYPE B1 / \ UNIT TYPE / \ B1 / \ C' / \ ®B y B B / \ / \ / \ 0 / \ i C C O O C O OC C O 71— DD �Dtitle IF BUILDING A FIRST FLOOR REFLECTED 13 CEILING PLAN G drawn by: --- checked by: --- J scale: 3/16'= 1'-0" vi project number: 10002 scaled inch 0 NOTES: sheet number 0 1, CEILING HEIGHT IS 8'-0"ABOVE SLAB UNLESS OTHERWISE NOTED. BUILDING A 2. COORDINATE LIGHTING FIXTURES WITH ELECTRICAL FLOOR PLAN. _ FIRST FLOOR REFLECTED CEILING PLAN 3. COORDINATE FIRE PROTECTION SPRINKLER HEADS WITH FIRE PROTECTION FLOOR PLAN. A3.01 SCALE: 3/16" = 1'-0" no C + 41 g H A3e0 I 0 N LIGHTING FIXTURE LEGEND SYMBOL DESCRIPTION TYPE SYMBOL DESCRIPTION TYPE SYMBOL DESCRIPTION NOTES: Q .' TYPE A SURFACE MOUNTED LED E 0 SURFACE MOUNTED LED FE O SEMI-FLUSH MOUNT COMPACT FLUORESCENT 1. ALL CEILINGS BE MOUNTED TO THE UNDERSIDE OF THE STRUCTURE ABOVE UNLESS OTHERWISE NOTED. 2. ALL CEILINGS SHALL BE%"GWB UNLESS OTHERWISE NOTED. B OO SURFACE MOUNTED LED F1 WALL MOUNTED LED 3 LAMP VANITY LIGHT I SURFACE MOUNT LED 3. PROVIDE SUBMITTAL TO THE RESPONSIBLE PARTY OF THE MANUFACTURER'S CUT-SHEET FOR EACH TYPE OF LIGHT FIXTURE INSTALLED.WHERE APPLICABLE,ENSURE THE ENERGY STAR LABEL REMAINS ATTACHED TO THE B E A T T Y HARVEY COC O C 0 SURFACE MOUNT LED FB SURFACE MOUNTED LED CFL CEILING FAN WITH LIGHT FIXTURE. 4. REFER TO MECHANICAL,FIRE PROTECTION&FIRE ALARM PLANS FOR ARCHITECTS , L L P COORDINATION LOCATION OF CEILING DEVICES. NEw YORK I MARYLAND 1300 Walt Whitman Road, New York, 11747 A l - D 3 WALL MOUNTED EXTERIOR LANTERN FD 0 SURFACE MOUNTED LED A p: (631)300-1010 owner/developer Conifer Realty 1000 University Avenue Suite 500 Rochester, NY 14607 585.324-0500 civil engineer LKMA 437 &405 South Country Road Brookhaven, NY 11719 631.286.8668 m.e.p. &f.p. M/E Engineering, P.E. 150 North Chestnut Street Rochester, NY 14604 585.288.5590 structural engineer TDM Consulting Engineering 550 North County Road,Suite E Saint James, NY 11780 631.686.5234 key TRUE NORTH I v B B 0 0 J g ®g project 0g VINEYARD VIEW 8 U) D o m + County Road 48 F_¢ Greenport, NY 11944 C F1 E C seal O 7 OE 71 $ °„° O "Ie A/� ABOVE B ABOVE �5 JutlE SUBFLOOR 0B SUBROOR 0ACCESS 0 0 ACCESS 0 ? PANEL OE O PANEL i 7-0" F1 OC 14�ABOVE ABOVE E_ F1 OC SUBFLOOR SUBFLOOR\ �y 0214 '1 O� OF NE`N OC E O issued date description C A 0B O 0B A 1 03/15/19 Issued for Construction D OC OC OE OC OC OC 06 B 0B OO UNIT NUMBER UNIT NUMBER UNIT NUMBER + 404&504 402&502 405&505 UNIT TYPE OE UNIT TYPE OE UNIT TYPE B2 C1 B2 - - - title BUILDING A N D FLOOR SECO 00R REFLECTED CEILING PLAN drawn by: --- checked by: --- CL scale: 3/16"= V-0" J J V; project number: 10002 0 scaled me U Q NOTES: sheet number 0 U U 1. CEILING HEIGHT IS 8'-0"ABOVE SUBFLOOR UNLESS OTHERWISE NOTED. BUILDING A 2. COORDINATE LIGHTING FIXTURES WITH ELECTRICAL FLOOR PLAN. r ri ` SECOND FLOOR REFLECTED CEILING PLAN 3. COORDINATE FIRE PROTECTION SPRINKLER HEADS WITH FIRE PROTECTION FLOOR PLAN. �A3.02 SCALE: 3116" = 1'-0" ca o �+ + + + + A3 * 02 M -� Lt- �F O N ti 44 BEATTY HARVEY COCO A R C H I T E C T S , L L P NEW YORK I MARYLAND A► 1300 Walt Whitman Road, New York, 11747 p:(631)300-1010 owner/developer Conifer Realty 1000 University Avenue Suite 500 Rochester, NY 14607 10'-1/" 10'-1Y4" 9'-10" 10'-1Y4" 9'-10" 9'-10" 10'4%" 585.324-0500 civil engineer LKMA 437 &405 South Country Road Brookhaven, NY 11719 631.286.8668 m.e.p. &f.p. M/E Engineering, P.E. \ B 150 North Chestnut Street BEDROOM BEDROOM BEDROOM - _ BEDROOM _ + Rochester,NY 14604 o BEDROOM BEDROOM o \ \ BEDROOM 585.288.5590 BEDROOM 0 0 structural engineer TDM Consulting Engineering 550 North County Road,Suite E 1 1 1 t Saint James, NY 11780 4'6%" 3� 5 4'-8/' 4 5 a 5 1/ 1� 4'8%" 4'-5%" 1X" 1�" 4'-5%" 4'-8%" -1� 631.686.5234 K2 EAK2 4 K2 Q O O K2Ar y Q O K2 K2 E K2 ----Ct 2'7" 1' 10%" =====C } \ ES=== 1'-10%" 2,_7„ , E�--- \ ,LH -�---- 1'-10%.. 2 7 ----, `� `� ---- O'- „ ------- `� CL II N NET O ------ ==€L -' I I E - � 4 -' I ��ET ---- I ET ---- N � � 2-7" 10/---J �� ETN J' �� ------- N CL 1L____ _� - -_- �� L___ key E �? N HALLWA o BULK N 1 1 HALLWAY 1 � HALLW M Ln LLWAY O PLAN C STORAGE N ` 1 N BULK A10.00 _ 1 - BULK STORAGE ® I A10.01 A10.00 1 _ 1 1 1 BULK N �; G1 I �__ 1 I � 1 G1 STORAGE G1 � STORAGE r, � N co in N 4'5a" 1 10' 1y" 1 u =� 1 1 F 1 \ i N 1If cN 1 10' 1/" O -5% �0 5,_14„ 1 " \ Ot , o BATHROOM-2A 1 1 BATHROOM 2B ) "' 1 10'-1Y4" 1 5/ 5' 1 a" a 4'-5;/4" 10-1/' F "TYPE"A"A117.1 2009" 1 �' 1 BATHROOM 2B 1 �a 1 TYPE 'A' AlA117.1-2009 1 ) BATHROOM-2B O rn TYPE B"A✓ 1171 2009" ✓ ✓✓✓✓✓✓✓✓✓ J co \O 4 1 ''`'''"""" 1 Q 1 "TYPE"B"A117.1-2009" ) I 4 ✓ ✓✓W✓�✓ O 1 L I F---- -- O 1 ----- - L MECH. ;�, -- MECH.;r ` �_ �� ------- 1 1 I i ,-�JNE-1�-, N -La1VEaV--, �* _ CLOSET _ L N o ' ( � 2 8 z ( LOSET MECH. 1 r ti O MECH. " CLOSETS 1 L CLOSET �, -- CLOSET I °' ETM ------- H I -----J o �— — — — — — — — O - L _ SET__J I - - _ - - - - - - — - - Cn C H .^ J � , reue �" _ --- - - -- 3-9 M, — — — — — — — — — — � � i 2'-8%" �0 3'_9�„ � i 2'-8%" i---------------i i----- --- -IIIi H 'CLOSED I -- — u I ----- --- 1 1 ----- O O project L II I r------- �O- 0 � ----iF--� O O 1 I N J N I ------ O O -----� VINEYARD VIEW __$__�---- ® ----4 1 I 1 iii 1 i 1 \ J3 ----- O O -- cn I Al2.01 �� 4.IYT T N 1 =_�__� r------- i I I N cfl �__�__ KITCHEN B N KITCHEN-13 _ g" B J1 I 1 J1 C�I 1 COAT -}- cLpsET N I I N -TI 1 A2 J1 �' 1 1 - C in M in CLOSET — `� I -----I I I I -fig' 1 1 — — — + County Road 48 r------- �� I 1 r _.� IICV _ I I 1'77-J '-- -- _, ,, I rte_ 1 --J 1 I KITCHEN-B ' Greenport, NY 11944 1 KITCHENLD-ANSI I 1 1 I 1 ----- ---- 1 - 1 I ----- I ------- i 1 1 -- seal 1 II '4 IL I � I i I 1 1 -~� ----- ---- ---- ----- L= 1 -------J 2'3/ „ --------- a 1 1 ; \j�E GE��Cyd 1 s 1 L-------J 1 -- ------� I ` — — — — — — — — — — — — --� 1 ----- ---- 1 I ---- ----- 1 -- -- 2,3� �C?app O �� I „ - - ------- 18' 1 z 2 3/ 18'-1 1 _ 3 „ I 2 3% 1 ----- ---- 1 1 3 I 18'-1 z° <n Al ---- 1 y2° ----- ---- 1 18'-2" M 1 2 1 ----- ---- 1 �, 1 ---- ----- 1 I issued date description A9.00 ----- ---- I LIVING ----- ---- 1 I ---- ----- 1 03/15/19 Issued for Construction 1 ----- ---- I ROOM 1 ----- ---- 1 z 1 ---- ----- 1 LIVING LIVING ROOM ROOM 1 I I 1 1 LIVING 2 06/12/19 Project Bulletin #2 1 ROOM 3 07/01/19 Project Bulletin #4 1 G1 BULK 1 1 1 STORAGE 1 1 1 1 1 I I N 1 I 1 a 8 LJ 'de °d Q < < ° d < n < A d-° ea e < o d C d B d° e 4 < < IAF\\\�71i1 e d title BUILDING A UNIT PLANS Bl -ANSI, Bl , UNIT 403 UNIT 501 - - & B2 UNIT NUMBER: 403 UNIT NUMBER: 401 &501 UNIT NUMBER: 503 UNIT NUMBER: 404,504 UNIT NUMBER: 505 UNIT NUMBER: 405 UNIT TYPE: B1-ANSI UNIT TYPE: B1 UNIT-TYPE: 81 UNIT TYPE: B2 UNIT TYPE: B2 UNIT TYPE: B2 0 BEDROOMS: 2 BEDROOMS: 2 BEDROOMS: 2 BEDROOMS: 2 BEDROOMS: 2 BEDROOMS: 2 drawn by: GROSS AREA: 986 S.F. GROSS AREA: 986 S.F. GROSS AREA: 986 S.F. GROSS AREA: 1054 S.F. GROSS AREA: 1054 S.F. GROSS AREA: 1054 S.F. NET AREA(HCR): 926 S.F. NET AREA(HCR): 926 S.F. NET AREA(HCR): 926 S.F. NET AREA(HCR): 1000 S.F. NET AREA(HCR): 1000 S.F. NET AREA(HCR): 1000 S.F. checked by: -- N OPPOSITE HAND OPPOSITE HAND scale: 114"= 1'-0" U 1 UNIT B1-ANSI - FIRST FLOOR PLAN 2 UNIT B1 - FIRST FLOOR PLAN 3 UNIT B2 - SECOND FLOOR PLAN 4 UNIT B2-BLDG 4A #405 - SECOND FLOOR PLAN project number: 10002 L scaled inch A4.00 SCALE: 114 - 11-01, -- - - - 0 A4.00 SCALE: 114" = 1'-0" A4.00 SCALE: 114" = 1'-0" A4.00 SCALE: 114" = 1'-0" "- sheet number U 4, O U BUILDING A NOTE: MEET TORE CRITEROIA OF ARTYPE A A117.1R-02 09SBATHROOM91 H A4000 . 0 .) i TJ I: BEATTY HARVEY COCO A R C H I T E C T S , L L P NEW YORK I MARYLAND 1300 Wait itman Road, New York, 11747 p: (631)300-1010 owner/developer Conifer Realty 1000 University Avenue Suite 500 Rochester,NY 14607 585.324-0500 e d ° civil engineer LKMA 437&405 South Country Road 10'3/„ 15 9/ Brookhaven, NY 11719 631.286.8668 m.e.p. &f.p. WE Engineering, P.E. B 150 North Chestnut Street Rochester,NY 14604 585.288.5590 2 1/ structural engineer r--I1� BEDROOM -Mo BEDROOM ”' TDM Consulting Engineering 0 550 North County Road,Suite E - \ Saint James, NY 11780 iii O N O N 631.686.5234 .11 S �ES I I 10 I T I �9ET 00 A6 6 I� N A10.00 i—r+�— N A10.00 E �— — — — — — — — — � O r- - - - - - - - - key r-- N I III ¶ q� I PLAN iii 3-3° 2'-7Y4" 5'AW' 2'_74^ ll \(\//jo( C HALLWAY N I _–_____� I HALLWAY N I -- 1 CgAAT M I ---- CLO$rT nI F I F O F— 1 2'-�/'" 45'_104" " O 7._1 4„ I 8,�„ I 7'-1Y4" 1 BATHROOM-D 1 1 BATHROOM-D 1 — \_ r�i I n r-i �.I � I o Pao 1 � W L Z Q I — — j j 1 \ L i N�J -- -- ---------- 1 L__J -- — 1 I I 1 - TRUE o - -- --- --- —— -- 1 3' I 4'2 4" 1'8�" ii i 1'_8 „ -------�--, 5 1 ---- ----- 1 Project I ii a 1 Al2.00 o I I N 1 ---- ----- I 1 - -,----- ==*== I 1 ---- ----- I M MECH, VINEYARD VIEW CLOSET v DDJJ__ ---- ----- i i i }41TCMEN-bC O O I I I -- – 11 D qJ ---- 1 ---- ----- 1 I -----r---- ----- O O' I 1 ---- ----- I \ County Road 48 -- -- I I I _ Greenport NY 11944 —__ _—__— II I I ; ; 1 I � �� L—LI-----JI� � I 1 ---- ----- I I I G1 � BULK � seal ------ ------ I I --f STORAGE ---- ----- �D A R Cyr / GES �-___ 31 o ' 4 rn F Zi FLOOR& ROOF ASSEMBLY LEGEND M O I FLOOR/CEILING ASSEMBLY: ROORCEILING ASSEMBLY: FLOOR/CEILING ASSEMBLY DRAFTSTOPPING 1-HR RATED U.L.DES.L521 1-HR RATED U.L.DES.P522 ROOFING SYSTEM 1-HR RATED U.L.DES.L521 SYSTEM NO.8 SYSTEM NO.8 30 YEAR ARCHITECTURAL SYSTEM NO.8 STC RATING: 50(45 FIELD TESTED) ASPHALT P,OOF SHINGLES IIC RATING: 50(45 FIELD TESTED) OVER 15LB BUILDING FELT SPECIFIED FLOORING,SEE WITH ICE 8 WATER SHIELD SPRAY FOAM BOARD IN FINISH PLANS AT ALL EAVES&VALLEYS PLACE ONE SIDE; %"DRAFTSTOPPING; 3/4"THICK'LEVELROCK' OVER%"EKTERIOR GRADE PROVIDE 1"WIDE BEAD STAGGER JOINTS BEATTY HARVEY COCO FLOOR UNDERLAYMENT PLYWOOD SHEATHING. OF INSULATION BY'DOW [L�Y/4"PARTICLEBOARD A R C H I T E C T S , L L P 3/4"ADVANTECH OR EQUAL I PITCHED VNOOD ROOF TRUSS BUILDING SOULUTIONS' T DRAFTSTOPPING SUBFLOOR PER STRUCTURAL PLANSOR APPROVED EQUAL OINTS NEW YORK MARYLAND A 1300 Walt Whitman Road, New York, 11747 - - 18"DEEP PARALLEL CHORD A p: (631)300-1010 WOOD TRUSSES PER FIBERGLASS INSULATION(R38) I owner/developer STRUCTURAL DWGS. BETWEEN TRUSSES RC-1 RESILIENT CHANNEL Conifer Realty —FIBERGLASS INSULATION(R19) AT 12"O.C. 1000 University Avenue Suite 500 BETWEEN TRUSSES . . . 1/2"RC-1 RESILIENT Rochester, (1)LAYER 1/8"TYPE'C'GWB585.324-0500 RC-1 RESILIENT CHANNEL CHANNEL AT 12"O.C. CAULK ALL AT 12"O.C. AND FINISHED JOINTS;SEE (1)LAYER 5/8"TYPE'X' PERIMETERS ERS WITH SPECIFICATIONS FLEXIBLE ACOUSTICAL (1)LAYER 5/8"TYPE'C'G.W.B. G.W.B. CAULKING(TYP.) civil engineer AND FINISHED JOINTS;SEE SPECIFICATIONS REFER TO PLANS AND 43L &405 WALL TYPE LEGEND South Country Road Brookhaven, NY 11719 631.286.8668 m.e.p. &f.p. f -I M E Engineering, P.E. g 150 North Chestnut Street Rochester, NY 14604 585.288.5590 2 2 1 2 2 OPP.HAND A6.02 A5.00A5.01 A5.01 A6.02 structural engineer ATTIC DRAFTSTOPPING.SEE TDM Consulting Engineering 1 FLOOR&ROOF ASSEMBLY r 1 550 North County Road,Suite E SIM. LEGEND FOR DETAIL _ I _ _� T.O.ROOF TRUSS RIDGE Saint James, NY 11780 I it ELEV.+25'4" 631.686.5234 I I 12 // 12 12 D/ Q 12 i ti key TRUE NORTH C _ _ T.O.SECOND FLOOR TOP PLATE ° ' I ELEV.+117'_9" UNIT TYPE: B2 , 11 I I I I I , UNIT TYPE: B2 BEDROOMS: 2 II II II II �j BULK �} CHEN HALLWAY I r� HALLWAY STORAGE full HALLWAY IT , BEDROOMS: 2 GROSS AREA: 1054 S.F. °�' a I� u U� C14 Ou L GROSS AREA: 1054 S.F. zo NET AREA(HCR): 1000 S.F. 1 1 "0 NET AREA(HCR): 1000 S.F. N a Oo \• _ Imo' �-�l 0LTJ qD\' '00T.O.SECOND FLOOR SUBFLOOR — - - oil - \ 8" o project —_ ' � II �� ❑�/ FF 11 ® ' T VINEYARD VIEW UNIT TYPE: B1 � '� - ;' I UNIT TYPE: 61 BEDROOMS: 2 COATI Im® . CHEN HALLWAY CLOSET HFR77 7M] ALLWAY KITCHEN CLOSET HALLWAY COAT II ' I ti GROSS AREA: 986 S.F. KIT BEDROOMS: 2 b, mo ®o U U P U GROSS AREA: 986 S.F. p NET AREA(HCR): 926 S.F. NET AREA(HCR): 926 S.F. Ll ' County Road 48 _ T.O.FIRST FLOOR SLAB - — ELEV.O'-o° Greenport, NY 11944 seal Lam,. B.O.FOOTING �PORE G. co/JPO 40 ELEV.-3'-6" UNIT TYPE: C1 * "moo BEDROOMS: 3 * I GROSS AREA: 1357 S.F. NET AREA(HCR): 1267 S.F. • �y�. 021422 0Q' 1 BUILDING A - BUILDING SECTION SOF Ny A5.00 SCALE: 3/16"= 1'-0" E issued date description -I- 1 03/15/19 Issued for Construction 2 1 1 - A6.00 A5.00 A6.00 r r J_ _ T.O.ROOF TRUSS RIDGE ELEV.+25'-4" 1 "111' _Y� 1 T.O.SECOND FLOOR TOP PLATE F+- ELEV.+17'-9" F 1 I 1 � LIVING I 91 1 ROOM - KITCHEN BATHROOM BEDROOM 1 I I N title T.O.SECOND FLOOR SUBFLOOR BUILDING A ELEV.+9'.7%" BUILDING i' SECTIONS LIVING 1 II ROOM IL_IL KITCHEN BATHROOM BEDROOM b' b : drawn --- I 1 + y' T.O.FIRST FLOOR SLAB ELEV.0'-0" b CL 4F4 .t I M scale: 3/16"- 1'-0" er' " B.O.FOOTING j. project number: 10002 ELEV.4-6" scaled inch Q - - - - - - - - - -- o sheet number U O U BUILDING A z 2 BUILDING BUILDING SECTION A5.00 SCALE: 3/16"= 1'-0" m A500 9H • r- + z 4 -}- -�- -�- N FLOOR& ROOF ASSEMBLY LEGEND CD FLOOR/CEILING ASSEMBLY: ROOF/CEILING ASSEMBLY: FLOOR/CEILING ASSEMBLY DRAFTSTOPPING 1-HR RATED U.L.DES.L521 1-HR RATED U.L.DES.P522 ROOFING SYSTEM 1 HR RATED U.L.DES.L521 SYSTEM NO.8 SYSTEM NO.8 30 YEAR ARCHITECTURAL SYSTEM NO.8 STC RATING: 50(45 FIELD TESTED) ASPHALT ROOF SHNGLES 11CRATING: 50(45 FIELD TESTED) OVER 15LB BUILDRIG FELT SPECIFIED FLOORING,SEE WITH ICE&WATER SHIELD SPRAY FOAM BOARD IN FINISH PLANS AT ALL EAVES&VALLEYS PLACE ONE SIDE; 3a"DRAFTSTOPPING; STAGGER JOINTS 3!4"THICK'LEVELROCK' OVER s/ BEATTY HARVEY C"EXTERIOR GRADE PROVIDE 1"WIDE BEAD O C O FLOOR UNDERLAYMENT PLYWOOD SHEATFING. OF INSULATION BY'DOW 3/"PARTICLEBOARD A R C H I T E C T S , L L P PITCHED WOOD ROOF TRUSS BUILDING SOULUTIONS' �AT DRAFTSTOPPING NEW YORK I MARYLAND 314"ADVANTECH OR EQUAL I OR APPROVED EQUAL JOINTS SUBFLOOR PER STRUCTURAL PLANS 1300 Walt Whitman Road, New York, 11747 A I A p: (631)300-1010 + -- - 18"DEEP PARALLEL CHORD FIBERGLASS INSULATION R38 WOOD TRUSSES PER ( ) owner/developer STRUCTURAL DWGS. BETWEEN TRUSSES I FIBERGLASS INSULATION(R19) RC-1 RESILIENT CFANNEL -- Conifer Realty 1000 Universit Avenue Suite 500 AT 12"O.C. Rochester, (1)LAYER 5/8"TYPE'C'G.W.B. 1/2"RC-1 RESILIENT CAULK AT ALL 32 -0507 BETWEEN TRUSSES RC-1 RESILIENT CHANNEL AND FINISHED JOIPITS;SEE CHANNEL AT 12"O.C. PERIMETERS WITH 585.324-0500 AT 12"O.C. SPECIFICATIONS (1)LAYER 518"TYPE'X' FLEXIBLE ACOUSTICAL (1)LAYER 5/8"TYPE'C'G.W.B. G.W.B. CAULKING(TYP.) civil engineer AND FINISHED JOINTS;SEE REFER TO PLANS AND LKMA SPECIFICATIONS 437 &405 WALL TYPE LEGEND South Country Road Brookhaven, NY 11719 631.286.8668 m.e.p. &f.p. M/E Engineering, P.E. R, B 150 North Chestnut Street Rochester, NY 14604 585.288.5590 2 1 1 A6.01 A5.00 A6.01 structural engineer �.- - - - - - - - - - - -,� �,- - - - - - �� TDM Consulting Engineering 550 North County Road,Suite E T.O.ROOF TRUSS RIDGE Saint James, NY 11780 334 ELEV.+25'-4" -t - 11 TO RIDGE ^ I -- TO RIDGE I I LEVATION 1 i - 1 i 11 1 key NORTH T.O.SECOND FLOOR TOP PLATE ° 1 ELEV.+1 T-9" - 1 MECHANICAL BULK CLOSET ( STORAGE BEDROOM O /�� u Lut. u LL-t* aO , , i no 00 M ERD O T.O.SECOND FLOOR SUBFLOOR 1 i 1 ELEV.+9'-7 8 o i 1 project 2-0'ri I VINEYARD VIEW ENT AT MECHANICAL BULK 1 - IR CLOSET CLOSET STORAGE BEDROOM I I 6' ' �u ul� uL= 1 ' + i 1 �0 + County Road 48 T.O.FIRST FLOOR SLAB I" ELEV.0'0" Greenport, NY 11944 L ,../T s.`v,3nY r.fi ,h ..u✓./ ,`iJ ,,.Y >',,: sii, n"'. �.,.' .: `" y' seal F- A liI I , B 0 FOOTING ELEV.-3'-6" �S�PCGRE G. Cy�� ¢ cow �A 1 BUILDING A BUILDING SECTION OF NES A5.01 SCALE: 3/16"= 1'-0" issued date description -� + 1 03/15/19 Issued for Construction 1 1 _ A5.00 A6.02 r � T.O.ROOF TRUSS RIDGE -- - -i T \ 1 I ELEV.+25'-4, f3s/ TO RIDGE - TO RIDGE LEVA_10 LEVATION� ti _ I T.O.SECOND FLOOR TOP PLATE ' I ELEV.+17'-9" + 0 a' BEDROOM HALLWAY IIIA I BEDROOM I _ u u00 title kif I — _ — I T.O.SECOND FLOOR SUBFLOOR BUILDING A ELEV.+9'-7%" B U I L D I N G I� TELCO& SECTIONS D � 0 I I WATER LIVING CJAT I SERVICE ROOM CLIOSET � I ROOM I drawn by: --- LLII \ I I T.O.FIRST FLOOR SLAB checked --- ELEV.0'-0" Y r; .. �. I `�-�- I M scale: 3/16'= 1'-0.. B.O.FOOTING project number: 10002 ELEV.-3'-6" U L= scaled inch sheet number U O U BUILDING A 2 BUILDINGA - BUILDING SECTION A5.01 SCALE: 3/16"= 1'-0" m �- + 2+ 31- + �- �+- + —GIH A59 2�__ 3 4 5 6 7 T.O.ROOF TRUSS RIDGE T.O.ROOF TRUSS RIDGE { v V ELEV.+25'-4" I I I I I I I r..- -- I I I I ELEV.+25'4" I II II II � II II II II II II II II II II I � o I II II II II II II II II II II II II II II I M I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I �^• ' I I II II II II II II II II II II II II I � � ' I I II II II II II ii II II II II II II II I • 4"x 7Y"PVC RAKE BOARD I I I 4"x 7%"PVC RAKE BOARD VINYL SOFFIT PANEL j VINYL SOFFIT PANEL I. ROOF CONSTRUCTION ROOF CONSTRUCTION i. 30 YEAR ARCHITECTURAL ASPHALT ROOF 30 YEAR ARCHITECTURAL ASPHALT ROOF SHINGLES OVER 15LB BUILDING FELT WITH SHINGLES OVER 15LB BUILDING FELT WITH ICE&WATER SHIELD AT ALL EAVES& I I ICE&WATER SHIELD AT ALL EAVES& BEATTY HARVEY COCO � ARCHITECTS , LLP VALLEYS OVER Y44"EXTERIOR GRADE VALLEYS OVER 4"EXTERIOR GRADE NEW YORKMARYLAND PLYWOOD SHEATHING. i i PLYWOOD SHEATHING. � Ai ENGINEERED WOOD ROOF TRUSS i^� ENGINEERED WOOD ROOF TRUSS 1300 Walt Whitman Road, New York, 11747 I A I p: (631)300-1010 CONTINUOUS R-38 BATT INSULATION, i CONTINUOUS R-38 BATT INSULATION, ' -�- owner/developer TYPICAL FOR ALL ATTIC SPACES. I <\ TYPICAL FOR ALL ATTIC SPACES. Conifer Realty i 1000 University Avenue Suite 500 2x4 CROSSBAR&POST. 2x4 CROSSBAR&POST. Rochester, NY 14607 585.324-0500 AIR SEAL ALL PERIMETERS WITH FLEXIBLE AIR SEAL ALL PERIMETERS WITH FLEXIBLE ACOUSTICAL SEALANT,TYPICAL,WITH ACOUSTICAL SEALANT,TYPICAL,WITH JOINT TAPE. i JOINT TAPE. civil engineer CONTINUOUS DOUBLE 2x6 TOP PLATE, CONTINUOUS DOUBLE 2x6 TOP PLATE. 43L &MOS HEADER WITH RIGID INSULATION PER South Country Road SCHEDULE HEADER WITH RIGID INSULATION PER I I SCHEDULE Brookhaven, NY 11719 631.286.8668 CONTINUOUS ALUMINUM CONCEALED _ __ COUNTER FLASHING,TYPICAL. CONTINUOUS ALUMINUM CONCEALED m.e.p. & f.p. FLASHING,TYPICAL. 5/4 x 3%"HARDIE TRIM BOARDEngineering,M E P.E. B� I R 150 North Chestnut Street f h T.O.SECOND FLOOR TOP PLATE _ _ _ _ T.O.SECOND FLOOR TOP PLATE Rochester, NY 14604 ELEV.+17'-9" - - - - ---- - - ELEV. 17-91, 585.288.5590 .032"20GA.ALUMINUM CONTINUOUS BREAK METAL DRIP EDGE WITH KYNAR 500 structural engineer FINISH,MINIMUM 4"UP SIDING. 5/4 x 3%"HARDIE TRIM BOARD TDM Consulting Engineering 550 North County Road,Suite E VINYL SLIDING DOOR WITH INSULATED .032"20GA.ALUMINUM CONTINUOUS Saint James, NY 11780 LOW-E GLASS.REFER TO ELEVATIONS. BREAK METAL DRIP EDGE WITH KYNAR 500 631.686.5234 FINISH,MINIMUM 4"UP SIDING. VINYL WINDOW WITH INSULATED LOW-E GLASS.REFER TO ELEVATIONS. key N PLAN 2ND FLR EXTERIOR WALL CONSTRUCTION 5 HARDIE-34"x 2 Y"TRIM BATTENS OVER%6" A6.03 PANELS(COORDINATE PANEL JOINTS WITH - - - - - - - - - - - - - - - - - - - - - - - - - — — — — LIVING TRIM BATTENS)OVER CONTINUOUS AIR& f - - WATER RESISTIVE BARRIER OVER Y2" 00 r ED 1 ROOM BEDROOM EXTERIOR GRADE PLYWOOD SHEATHINGco �o C Y4"PLYWOOD SUBFLOOR FASTENED TO 2x6 WOOD STUDS WITH R-21 BATT INSULATION OVER CONTINUOUS CONTINUOUS ALUMINUM CONCEALED I I VAPOR BARRIER AND%'GYPSUM FLASHING,TYPICAL. I i WALLBOARD ON INTERIOR SIDE. - N N N 2x8 LEDGER BOARD FASTENED TO 2x8 1 I CONTINUOUS 2x6 BOTTOM PLATE ', BLOCKING REFER TO STRUCTURAL SECTION 5/S2.01 I I reue o 8"ENGINEERED WOOD FLOOR TRUSS project 18"ENGINEERED WOOD FLOOR TRUSS I I VINEYARD VIEW CONTINUOUS ALUMINUM CONCEALED POWDER COA-ED ALUMINUM RAILING FLASHING,TYPICAL. SYSTEM PER SPECIFICATION. I I FLOOR ASSEMBLY: FLOOR ASSEMBLY: 18"RIM JOIST I (IHR)RATED UL DES.L521: (1HR)RATED UL DES.L521: I D 1x6 TREX BOARD DECKING OVER 2x8 DECK A SEE FLOOR ASSEMBLY DETAIL SEE FLOOR ASSEMBLY DETAIL %6"HARDIE PANEL OVER 514 x 3Y"HARDIE County Road 48 JOISTS. I I SHOWN ON SHEET A5.00 SHOWN ON SHEET A5.00 TRIM BOARD Greenport, NY 11944OL C T.O.SECOND FLOOR SUBFLOOR I I T.O.SECOND FLOOR SUBFLOOR seal ELEV +9'7� . 8" 'Cp A C I, �R C\ ELEV.+9'-7 8" 1 I f- A'0 '��g 0 Rq T 4"x 7 4"PVC FACIA BOARD AIR SEAL ALL PERIMETERS WITH FLEXIBLE 2 x 8 BAND JOIST ` ACOUSTICAL SEALANT,TYPICAL,WITH Q tlli fb ( � O * JOINT TAPE. cn I til PRESSURE TREATED STRUCTURAL BEAM. ------ --------------------- -------------------------------- -------------------------------------------------------------------------------------- REFER TO STRUCTURAL SECTION 5/S2.01 1 ST FLR EXTERIOR WALL CONSTRUCTION CLAD BEAM WITH 1x PVC TRIM BOARD I � HARDIEPLANK LAP SIDING OVER AIR SEAL ALL PERIMETERS WITH FLEXIBLE I ', - CONTINUOUS AIR&WATER RESISTIVE TF Nl VERSAWRAP ACCENT WRAP WITH BASE ACOUSTICAL SEALANT,TYPICAL,WITH F BARRIER OVERY EXTERIOR GRADE CAP I JOINT TAPE. I PLYWOOD SHEATHING FASTENED TO 2x6 WOOD STUDS WITH R-21 BATT INSULATION E VERSAWRAP NOSE COVE MOULDING i i OVER CONTINUOUS VAPOR BARRIER ANDissued date description 6"x 6"CLASSIC VERSAWRAP COLUMN � I I %"GYPSUM WALLBOARD ON INTERIOR SIDE. 1 03/15/19 Issued for Construction COVER0 6 x 6 WOOD POST I CONTINUOUS DOUBLE 2x6 TOP PLATE CONTINUOUS DOUBLE 2x6 TOP PLATE. 2 07101119 Project Bulletin No.4 CONTINUOUS ALUMINUM CONCEALED CONTINUOUS ALUMINUM CONCEALED � FLASHING,TYPICAL. I FLASHING,TYPICAL. 514 x 3Y"HARDIE TRIM BOARD I 5/4 x 3%"HARDIE TRIM BOARD .032"20GA.ALUMINUM CONTINUOUS I .032"20GA.ALUMINUM CONTINUOUS b' BREAK METAL DRIP EDGE WITH KYNAR 500 _ I LIVING BREAK METAL DRIP EDGE WITH KYNAR 500 FINISH,MINIMUM 4"UP SIDING. U o I ROOM BEDROOM o FINISH,MINIMUM 4"UP SIDING. HEADER WITH RIGID INSULATION PER 6 I 6 q HEADER WITH RIGID INSULATION PER SCHEDULE I `D SCHEDULE I I � VINYL WINDOW WITH INSULATED LOW-E VINYL WINDOW INSULATED LOW-E F, I GLASS.REFER TO ELEVATIONS. I GLASS.REFER TO ELEVATIONS. 3/4"DIAMETER ANCHOR BOLT. I 3/"DIAMETER ANCHOR BOLT. I CONTINUOUS 2x6 PRESERVATIVE TREATED CONTINUOUS 2x6 PRESERVATIVE-TREATED I WOOD SILL PLATE WITH SILL SEAL FOAM WOOD SILL PLATE WITH SILL SEAL FOAM GASKET&SEALANT BETWEEN SILL PATE GASKET&SEALANT BETWEEN SILL PLATE I 4 AND SLAB AT INTERIOR EDGE title AND SLAB AT INTERIOR EDGE I14 CONT.2"(R-10)RIGID INSULATION VERSAWRAP ACCENT WRAP WITH BASE CONT.2"(R-10)RIGID INSULATION NAILED TO INSIDE OF FORMWORK TO 4"POURED CONCRETE SLAB ON GRADE CAP&BED MOULDING I 4"POURED CONCRETE SLAB ON GRADE I NAILED TO INSIDE OF FORMWORK TO REMAIN IN PACE. PROVIDE 2"MIN.AP REINFORCED WITH W.W.MESH WITH REINFORCED WITH W.W.MESH WITH O° I REMAIN IN PLACE. PROVIDE 2"MIN.LAP TO FOUNDATION INSULATION. HAUNCHED PERIMETER 6"LAYER OF RCA ° HAUNCHED PERIMETER OVER 6"LAYER OF I TO FOUNDATION INSULATION. AGGREGATE SIZE 1"TO 1 Y". WALL ° RCA AGGREGATE SIZE 1"T01 z". T.O.FIRST FLOOR SLAB I T.O.FIRST FLOOR SLAB SECTIONS . ° ELEV.0'-0" I .-. .�� " �RT ,x �.—,. . .�. r—WTD .�.• x—..—.• . "—a xo �I n n. a" —° •�.:,° CnELEV.0'-0" POURED CONCRETE PIER AND FOOTING '� FP Ll ° II� • o y II REFER TO STRUCTURAL SECTION 41 0 c 36 MIL.CLASS"A"VAPOR BARRIER UNDER- draw b --- S2.0 6 MIL.CLASS"A"VAPOR BARRIER UNDER , . u SAB TYPICAL. I \/\\/\ �1I i•i u ° //\//\// //\//\//\// ° II 2"RIGID INSULATION(R-1 0AT BUILDING chec ed by: --- �:, all, 2 RIGID INSULATION(R-1 0)AT BUILDINGii. PERIMETER, r, scale: 3/4"= 1'-0" = _ _ T= PERIMETER, a /\\\/\\\//�\/\\\/\\\� \/\\/\\/\\/\\/\\ n. / / / / / / FOUNDATION WALL FACE TO 24 BELOW } bl ° TION WALL FACE TO 24 BELOW a '/ / / / / /\/\/\/\/\i II • ADJACENT GRADE ro 4ADJAC TGRADE II /\\x project number: 10002 1 J I +I I� a II ,, \\j/` j \ scaled inch I I \ \ \ ` /` '. REINFORCED POURED CONCRETE STEM Q ,C °. REINFQ CED POURED CONCRETE STEM a JI ° \/ e WALL AND SPREAD FOOTING.REFER TO �__---� WALL -rte: \��\\�� ./i o � sheet number o A D SPREAD FOOTING.REFER TO - STRUCTURAL DRAWINGS. �v VI V �__=_----__<---S�JC URAL DRAWINGS. _`__-- I 2 WALL SECTION 1 WALL SECTION a B.O.FOOTING o e----n=-�=6 � B.O.FOOTING '. ° . '° , � ELEV. 3-6" ELEV, 3-6" BUILDING A �I NATURAL SOILS OR UNDISTURBED NATURAL SOILS OR FILL. ENGINEERED FILL. m �— — — — — — — — — — — — — — — — — — — — — — — — — — — — — — H i- 9H A6 ,000 N T.O.ROOF TRUSS RIDGE — _ + — 3 4 + 6 7 8w T.O.ROOF TRUSS RIDGE ELEV.+25'-4" ELEV.+25'4" ROOF CONSTRUCTION ?** 1 30 YEAR ARCHITECTURAL ASPHALT ROOF !: l SHINGLES OVER 15LB BUILDING FELT WITH ICE&WATER SHIELD AT ALL EAVES& VALLEYS OVER 3/"EXTERIOR GRADE ROOF CONSTRUCTION - - - PLYWOOD SHEATHING. 30 YEAR ARCHITECTURAL ASPHALT ROOF SHINGLES OVER 15LB BUILDING FELT WITH ENGINEERED WOOD ROOF TRUSS B E A T T Y HARVEY COC O ICE&WATER SHIELD AT ALL EAVES& ARCHITECTS , L L P VALLEYS OVER Y4"EXTERIOR GRADE WIND BAFFLE IN EACH BAY EXTENDING NEW YORK I MARYLAND PLYWOOD SHEATHING. 1300 Walt Whitman Road, New York, 11747 FULL HEIGHT OF INSULATION ^, IL r, ENGINEERED WOOD ROOF TRUSS CONTINUOUS R-38 BATT INSULATION, � owner/developerP. 00-1010 TYPICAL FOR ALL ATTIC SPACES. WIND BAFFLE IN EACH BAY EXTENDING FULL HEIGHT OF INSULATION -- -- - AIR SEAL ALL PERIMETERS WITH FLEXIBLE Conifer Realty ACOUSTICAL SEALANT,TYPICAL,WITH 1000 University Avenue Suite 500 CONTINUOUS R-38 BATT INSULATION, JOINT TAPE. Rochester, NY 14607 TYPICAL FOR ALL ATTIC SPACES. 585.324-0500 CONTINUOUS DOUBLE 2x6 TOP PLATE. VENTED VINYL SOFFIT PANEL VENTED VINYL SOFFIT PANEL civil engineer CONTINUOUS ALUMINUM GUTTER& � � � I I I I � � LKMA CONTINUOUS ALUMINUM GUTTER& GUTTER CLEAT. \ \ 437 &405 GUTTER CLEAT South Country Road HEADER WITH RIGID INSULATION PER Brookhaven, 1 1719 SCHEDULE 631.2288 6.8668 CONTINUOUS ALUMINUM CONCEALED I I I I FLASHING,TYPICAL. M/E Engineering, P.E. — — — J i 150 North Chestnut Street T.O.SECOND FLOOR TOP PLATE - - ----- - - - - -- - ELEV.+17'-9" _________ _ __ T.O.SECOND FLOOR TOP PLATERochester,585.288.5590 - ---------------------------------- ------------------------------------------------ ---------------------------------- - ELEV.+1T-9" CONTINUOUS DOUBLE 2x6 TOP PLATE. structural engineer 514 x 3Y"HARDIE TRIM BOARD TDM Consulting Engineering 550 North County Road,Suite E HARDIE-3/"x 2Y2"TRIM BATTENS OVER%6" .032"20GA.ALUMINUM CONTINUOUS Saint James, NY 11780 PANELS(COORDINATE PANEL JOINTS WITH D FLR EXTERIOR WALL CONSTRUCTION BREAK METAL DRIP EDGE WITH KYNAR 500 631.686.5234 � ,� TRIM BATTENS)OVER CONTINUOUS AIR& FINISH,MINIMUM 4"UP SIDING. WATER RESISTIVE BARRIER OVEVINYL WINDOW WITH INSULATED LOW-E RY2" ' GLASS.REFER TO ELEVATIONS. EXTERIOR GRADE PLYWOOD SHEATHING ,' FASTENED TO 2x6 WOOD STUDS WITH R-21 , key BATT INSULATION OVER CONTINUOUS , N VAPOR BARRIER AND/"GYPSUM PLAN WALLBOARD ON INTERIOR SIDE. ,' 2ND FLR EXTERIOR WALL CONSTRUCTION HARDIE-3/"x 2)/2"TRIM BATTENS OVER%6" TYPICAL. PANELS ALUMINUM FLASHING, /�; PANELS(COORDINATE PANEL JOINTS WITH C TRIM BATTENS)OVER CONTINUOUS WA ER ES STIVE BARRIEROVERY2" & \BO I O 2x8 LEDGER BOARD FASTENED TO WALL ' BEDROOM 4 STUDS. X 5o EXTERIOR GRADE PLYWOOD SHEATHING ,� � FASTENED TO 2x6 WOOD STUDS WITH R-21 ED . d ROOF CONSTRUCTION �' `D BATT INSULATION OVER CONTINUOUS 30 YEAR ARCHITECTURAL ASPHALT ROOF VAPOR BARRIER AND%"GYPSUM 0N SHINGLES OVER 15LB BUILDING FELT WITH �� WALLBOARD ON INTERIOR SIDE. N ICE&WATER SHIELD AT ALL EAVES& CONTINUOUS 2x6 BOTTOM PLATE N VALLEYS OVER Y'EXTERIOR GRADE \� TRUE PLYWOOD SHEATHING. %"PLYWOOD SUBFLOOR 18"ENGINEERED WOOD FLOOR TRUSS project POWDER COATED ALUMINUM RAILING �` VINEYARD VIEW A SYSTEM PER SPECIFICATION. CONTINUOUS ALUMINUM CONCEALED FLASHING,TYPICAL. 1 FLOOR ASSEMBLY: 18"RIM JOIST D 3 \\� (1HR)RATED UL DES.L521: Q SEE FLOOR ASSEMBLY DETAIL %6"HARDIE PANEL OVER 514 x 3%"HARDIE County Road 48 �\ SHOWN ON SHEET A5.00 TRIM BOARD Greenport, NY 11944 T.O.SECOND FLOOR SUBFLOOR T.O.SECOND FLOOR SUBFLOOR seal _ - -= - - - ELEV.+9'- 66-- 8 ...--.-_ 7%" F, � fYC ELEV.+9'-7%" — GER/l I� �' II AIR SEAL ALL PERIMETERS WITH FLEXIBLE ACOUSTICAL SEALANT,TYPICAL,WITH0 JOINT TAPE. *I ST FLR EXTERIOR WALL CONTINUOUS ALUMINUM GUTTER& I HARDIEPLANK LAP SIDING OVERRUCTION -� GUTTER CLEAT. - - --- - 3/"x 7%"PVC FACIA BOARD CONTINUOUS AIR&WATER RESISTIVE 21 BARRIER OVERY2"EXTERIOR GRADE O .� PLYWOOD SHEATHING FASTENED TO 2x6 TRIPLE 2"SOLID VINYL SOFFIT PANEL WOOD STUDS WITH R-21 BATT INSULATION O ME PRESSURE TREATED STRUCTURAL BEAM. OVER CONTINUOUS VAPOR BARRIER AND + REFER TO STRUCTURAL SECTION 51S2.01 SIDE.GYPSUM WALLBOARD ON INTERIOR issued date description CLAD BEAM WITH 1x PVC TRIM BOARD -� CONTINUOUS DOUBLE 2x6 TOP PLATE. 1 03/15/19 Issued for Construction 1ST FLR EXTERIOR WALL CONSTRUCTION 0 2 07101119 Proiect Bulletin No.4 HARDIEPLANK LAP SIDING OVER CONTINUOUS ALUMINUM CONCEALED CONTINUOUS AIR&WATER RESISTIVE FLASHING,TYPICAL. BARRIER OVER%"EXTERIOR GRADE PLYWOOD SHEATHING FASTENED TO 2x6 514 x 3%"HARDIE TRIM BOARD WOOD STUDS WITH R-21 BATT INSULATION 032"20GA.ALUMINUM CONTINUOUS a, OVER CONTINUOUS VAPOR BARRIER AND %"GYPSUM WALLBOARD ON INTERIOR BREAK METAL DRIP EDGE WITH KYNAR 500 SIDE. ENTRY FINISH,MINIMUM 4"UP SIDING. STAIRS BEDROOM o .032"20GA.ALUMINUM CONTINUOUS HEADER WITH RIGID INSULATION PER BREAK METAL DRIP EDGE WITH KYNAR 500 c o SCHEDULE FINISH,MINIMUM 4"UP SIDING. `o 514 x 3Y"HARDIE TRIM BOARD VINYL WINDOW WITH INSULATED LOW-E GLASS.REFER TO ELEVATIONS. F HEADER WITH RIGID INSULATION PER SCHEDULE s/a"DIAMETER ANCHOR BOLT. INSULATED ENTRY DOOR. Q Q CONTINUOUS 2x6 PRESERVATIVE-TREATED 4 WOOD SILL PLATE WITH SILL SEAL FOAM 6"x 6"CLASSIC VERSAWRAP COLUMN CONT.2"(R-10)RIGID INSULATION GASKET&SEALANT BETWEEN SILL PLATE title COVER NAILED TO INSIDE OF FORMWORK TO CONT.2"(R-10)RIGID INSULATION AND SLAB AT INTERIOR EDGE NAILED TO INSIDE OF FORMWORK TO 4"POURED CONCRETE SLAB ON GRADE 4"POURED CONCRETE SLAB ON GRADE REMAIN IN PLACE. PROVIDE 2"MIN.LAP _ REMAIN IN PLACE. PROVIDE 2"MIN.LAP TO FOUNDATION INSULATION. TO FOUNDATION INSULATION. REINFORCED WITH W.W.MESH WITH REINFORCED WITH W.W.MESH WITH HAUNCHED PERIMETER OVER 6"LAYER OF WALL HAUNCHED PERIMETER OVER 6"LAYER OF RCA AGGREGATE SIZE 1"T01 Y". RCA AGGREGATE SIZE 1"TO 1 Y". T.O.FIRST FLOOR SLAB \° ' OIL T.O.FIRST FLOOR SLAB SECTIONS ELEV.O'-0" °' -- ° ° ° A4. —:.°-_'°� . °,• •�'°`—°.i_. :'—"_a; ° , a._...._r.,;-�. 9 °• _---�: ,,.--, f e° —•e ELEV.0'-0,. FP M POURED CONCRETE SLAB ON GRADE, 4 V�� `�� w --•- pll' o 0 0 0 0 0 o ulI' COLUMN PIER AND FOOTING,BEYOND. G 6 MIL.CLASS"A"VAPOR BARRIER UNDER C , II I drawn by: LL r JJ r, I SLAB,TYPICAL. --------I-------- I I \ \\ \\ \\ \ \ \ \ checked by: --- �\ . 2"RIGID INSULATION(R-10 AT BUILDING///// /O PERIMETER,UNDER SLAB �ZD , scale: 3/4"- 1'-0" J_ 1_ L_---- ------- T------ ------J- I FOUNDATION WALL FACE TO 24"BELOW -- ---------- ----------- ADJACENT GRADE 11 A.4 project number: 10002 . ° //\\//\\/\ \///�//� II. i REINFORCED POURED CONCRETE STEM scaled inch o i -`yJl \�\\/\\ 'i /�\/ p I��°=.T_= I WALL AND SPREAD FOOTING.REFER TO sheet number P=i=an=-==� 2 WALL SECTION 1 WALL SECTION STRUCTURAL DRAWINGS. U B.C. OOTING ------------------ L----------- BUILDING A OL ELEV.-3'-6" LT---------------�- ��\\ \ \'\ \ \ \ \ \ \ A6.01 : _ - A6.01 : _ - / / / / �/ / / / / / //\//\//\//\//\//\//\//\//\ \// \/\/\/\/\/\/\/\/\/ ELEV.-3-6" o \/\\/\\/\\/\\/\\/\\/\\/\\/ _ — — — — — UNDISTURBED NATURAL SOILS OR /� j\\\j\\\j� ENGINEERED FILL. N m j _ I _�_ I _ + 5T 6� 7r �—' H A6601 9 T.O.BOOETRUSS RIDGE 4 6 7 T.O.ROOF TRUSS RIDGE ELEV.+25'-4" — — — — — — .� M i - ELEV.+264" 41 o / ROOF CONSTRUCTION I I 30 YEAR ARCHITECTURAL ASPHALT ROOF // ROOF CONSTRUCTION �. SHINGLES OVER 15LB BUILDING FELT WITH / 30 YEAR ARCHITECTURAL ASPHALT ROOF ICE&WATER SHIELD AT ALL EAVES& / SHINGLES OVER 15LB BUILDING FELT WITH VALLEYS OVER 4"EXTERIOR GRADE / - - -J ICE&WATER SHIELD AT ALL EAVES& . PLYWOOD SHEATHING. / VALLEYS OVER 4"EXTERIOR GRADE / PLYWOOD SHEATHING. ENGINEERED WOOD ROOF TRUSS / / ENGINEERED WOOD ROOF TRUSS B E A T T Y H A R V EY C O C O CONTINUOUS R-38 BATT INSULATION, / L L P TYPICAL FOR ALL ATTIC SPACES. / WIND BAFFLE IN EACH BAY EXTENDING ARCHITECTS , / FULL HEIGHT OF INSULATION NEW YORK I MARYLAND ql - WIND BAFFLE IN EACH BAY EXTENDING /f`� ^ 1 300 Walt Whitman Road, New York, 11747 FULL HEIGHT OF INSULATION i \ CONTINUOUS R-38 BATT INSULATION, I A p: (631)300-1010 > TYPICAL FOR ALL ATTIC SPACES. owner/developer AIR SEAL ALL PERIMETERS WITH FLEXIBLE C ti ACOUSTICAL SEALANT,TYPICAL,WITH // �i _-_ VENTED VINYL SOFFIT PANEL Conifer Realty JOINT TAPE. / 1000 University Avenue Suite 500 / CONTINUOUS ALUMINUM GUTTER& Rochester, NY 14607 CONTINUOUS DOUBLE 2x6 TOP PLATE. / - � GUTTER CLEAT 585.324-0500 HEADER WITH RIGID INSULATION PER / AIR SEAL ALL PERIMETERS WITH FLEXIBLE SCHEDULE --- � ACOUSTICAL SEALANT,TYPICAL,WITH civil engineer JOINT TAPE. LKMA \ CONTINUOUS ALUMINUM CONCEALED 437& 405 CONTINUOUS DOUBLE 2x6 TOP PLATE. COUNTER FLASHING,TYPICAL. / 1 \ \ \ Country Road Brookhaven, R / ---- VENTED VINYL SOFFIT PANEL / _ — 631.286.8668 CONTINUOUS ALUMINUM GUTTER& GUTTER CLEAT. m.e.p. & f.p. B 1 M/E Engineering, P.E. / I h T.O.SECOND FLOOR TOP PLATE �[_ � �_ _ _ _ � L +B 150 North Chestnut Street ELEV.+17'-9" _ --------------------------------------- -- _ T.O.SECOND FLOOR TOP PLATE Rochester, NY 14604 - - ELEV.+17'-9" 585.288.5590 514 x 32"HARDIE TRIM BOARD structural engineer .032"20GA.ALUMINUM CONTINUOUS TDM Consulting Engineering BREAK METAL DRIP EDGE WITH KYNAR 500 , \ - 550 North County Road,Suite E FINISH,MINIMUM 4"UP SIDING. ' \ Saint James, NY 11780 7A / \ 631.686.5234 VINYL WINDOW WITH INSULATED LOW-E /- O O I % / \ \� _ _ ----- E-_ _?-_ _ _ =-S -j GLASS.REFER TO ELEVATIONS. �� •\ / ' key O \ / N PLAN 2ND FLR EXTERIOR WALL CONSTRUCTION "' �`\�\ O \ \ 0 O / '� 2ND FLR EXTERIOR WALL CONSTRUCTION AN PL HARDIE 3/"x 22"TRIM BATTENS OVER%6" HARDIE 3/"x 22"TRIM BATTENS OVER%6" PANELS(COORDINATE PANEL JOINTS WITH �� \ ' ' PANELS(COORDINATE PANEL JOINTS WITH TRIM BATTENS)OVER CONTINUOUS AIR& / TRIM BATTENS)OVER CONTINUOUS AIR& + WATER RESISTIVE BARRIER OVER2" / ` EXTERIOR GRADE PLYWOOD SHEATHING KITCHEN �� BEDROOM q WATER RESISTIVE BARRIER OVER2" co —FASTENED TO 2x6 WOOD STUDS WITH R-21 o / , � co EXTERIOR GRADE PLYWOOD SHEATHING EO BATT INSULATION OVER CONTINUOUS ®®® D 13- 00 FASTENED TO 2x6 WOOD STUDS WITH R-21 BATT INSULATION OVER CONTINUOUS / VAPOR BARRIER AND%"GYPSUM VAPOR BARRIER AND%"GYPSUM WALLBOARD ON INTERIOR SIDE. \ WALLBOARD ON INTERIOR SIDE. N CONTINUOUS 2x6 BOTTOM PLATE \`\ 3/"PLYWOOD SUBFLCOR CONTINUOUS 2x6 BOTTOM PLATE N \\ TRUE O p %"PLYWOOD SUBFLOOR 18"ENGINEERED WOOD FLOOR TRUSS - project 18"ENGINEERED WOOD FLOOR TRUSS CONTINUOUS ALUMINUM CONCEALED VINEYARD VIEW FLASHING,TYPICAL. \ ___ -� - � \ CONTINUOUS ALUMINUM CONCEALED \ FLASHING,TYPICAL. D 18"RIM JOIST a FLOOR ASSEMBLY: ® �,\ \\\� \\ � FLOOR ASSEMBLY: D ( (1 HR)RATED UL DES.L521: \\ 18"RIM JOIST (1HR)RATED UL DES.L521: D 616"HARDIE PANEL OVER 514 x 32"HARDIE SEE FLOOR ASSEMBLY DETAIL SEE FLOOR ASSEMBLY DETAIL TRIM BOARD SHOWN ON SHEET A5.00 %6"HARDIE PANEL OVER 514 x 32"HARDIE + County Road 48 SHOWN ON SHEET A5.00 TRIM BOARD OL T.O.SECOND FLOOR SUBFLOOR _ T.O.SECOND FLOOR SUBFLOOR Greenport, NY 11944 - ELEV.+9'-7%" IF seal ��pED ELEV.+9'-7/" I - 1 y AIR SEAL ALL PERIMETERS WITH FLEXIBLE Lo GE/3,q ACOUSTICAL SEALANT,TYPICAL,WITH 'I AIR SEAL ALL PERIMETERS WITH FLEXIBLE JOINT TAPE. ACOUSTICAL NACOUSTICAL SEALANT,TYPICAL,WITH JOINT TAPE. 1ST FLR EXTERIOR WALL CONSTRUCTION HARDIEPLANK LAP SIDING OVER A A A I 1ST FLR EXTERIOR WALL CONSTRUCTION CONTINUOUS AIR&WATER RESISTIVE ------------- HARDIEPLANK LAP SIDING OVER f/ BARRIER OVER 2"EXTERIOR GRADE CONTINUOUS AIR&WATER RESISTIVE -1 <1142. - PLYWOOD 142PLYWOOD SHEATHING FASTENED TO 2x6 BARRIER OVER2"EXTERIOR GRADE F WOOD STUDS WITH R-21 BATT INSULATION PLYWOOD SHEATHING FASTENED TO 2x6 OVER CONTINUOUS VAPOR BARRIER AND WOOD STUDS WITH R-21 BATT INSULATION OVER CONTINUOUS VAPOR BARRIER AND F e"GYPSUM WALLBOARD ON INTERIOR -f- SIDE. , \ %"GYPSUM WALLBOARD ON INTERIOR issued date description -- -- \� ,/ \\\ SIDE. CONTINUOUS DOUBLE 2x6 TOP PLATE. 1 03/15/19 Issued for Construction CONTINUOUS DOUBLE 2x6 TOP PLATE. � ,, �_ z=_ __S _� �/ \\ 2 07/01/19 Project Bulletin ino. CONTINUOUS ALUMINUM CONCEALED CONTINUOUS ALUMINUM CONCEALED - FLASHING,TYPICAL. _ _. _ �\_____ _ / FLASHING,TYPICAL. ! 2"HARDIE TRIM BOARD 514 x 32"HARDIE TRIM BOARD 514 x 3 ��\ � \ 0 O / / 6' 032"20GA.ALUMINUM CONTINUOUS \\ '� % / HEADER WITH RIGID INSULATION PER L ,' SCHEDULEa' BREAK METAL DRIP EDGE WITH KYNAR 500 TELCO&WATER SERVICE FINISH,MINIMUM 4"UP SIDING. o KITCHEN ROOM o INSULATED UTILITY ENTRY DOOR HEADER WITH RIGID INSULATION PER ^ ^ ' zo SCHEDULE ®®® 9. O® �/' VINYL WINDOW WITH INSULATED LOW-E \ F GLASS.REFER TO ELEVATIONS. \ %"DIAMETER ANCHOR BOLT. /' \\\ F CONTINUOUS 2x6 PRESERVATIVE-TREATEDo WOOD SILL PLATE WITH SILL SEAL FOAM ' \ GASKET&SEALANT BETWEEN SILL PLATE AND SLAB AT INTERIOR EDGE title 4"POURED CONCRETE SLAB ON GRADE \ \\ CONT.2"(R-10)RIGID INSULATION REINFORCED WITH W.W. "POURED CONCRETE SLAB ON GRADE.MESH WITH `\ ® ��, \\ NAILED TO INSIDE OF FORMWORK TO HAUNCHED PERIMETER OVER 6"LAYER OF REINFORCED WITH W.W.MESH WITH RCA AGGREGATE SIZE 1"T012". \\ \ REMAIN IN PLACE. PROVIDE 2"MIN.LAP HAUNCHED PERIMETER OVER 6"LAYER OF \ C TO FOUNDATION INSULATION. RCA AGGREGATE SIZE 1"T012", WALL h T.O.FIRST FLOOR SLAB ELEV.0'0" - SECTIONS _ T.O.FIRST FLOOR SLAB 19 .—a°xx��x '� x�Bx x x T—xa —''x y.—.-_x ae--xxx , x—Yx ° x.�a-x —�5`-�x. x p a° xr—+x C 1 IrP • °° X. ° ° 1 a o ov o~ x o oa rr ELEV.0'-0" i i• ✓� 00 0 G -- o o •n ! 6 MIL.CLASS"A"VAPOR BARRIER UNDER r, j \y ' ( r o SLAB TYPICAL. / \�\ s, i / // / )RIGID INSULATION //\//\//\//\// , ., \ \ \ i 6 MIL.CLASS"A"VAPOR BARRIER UNDER G a INSIDE OF FORMWORK TO i SLAB,TYPICAL. + drawn by: --- 2"RIGID INSULATION(R-10)AT BUILDING • i i ° /\/\/ /\/ i\/\/\/\/l, /I I/ E 1 \//\//\/\//\ IN 4N PLACE. PROVIDE 2 MIN.LAP i / / I'll / / M PERIMETER,UNDER SLAB&ALONG \ \\ \\ \ \\/ NDATION INSULATION. Q4 \\//\/j\/j\/j\/j\/j\/ e ii i 2"RIGID INSULATION(R-10)AT BUILDING checked by: --- FOUNDATION WALL FACE TO 24"BELOW -r \ PERIMETER,UNDER SLAB&ALONG `D ADJACENT GRADE ° i' /\\/\\/\ � ///\\\/�\//\//\// e n; i FOUNDATION WALL FACE TO 24"BELOW scale: 3/4"= 1'-0" ---- � ADJACENT GRADE REINFORCED POURED CONCRETE STEM \ \ \ project number: .' 10002 Q WALL AND SPREAD FOOTING.REFER TO °' � • ° \//\\//\/ '\//j\///\/ ' i i REINFORCED POURED CONCRETE STEM scaled o STRUCTURAL DRAWINGS. - \/� \ \ li \/\/ WALL AND SPREAD FOOTING.REFER TO inch 2 WALL SECTION �_�_=a_T44 rl—'� WALL SECTION ==-=n=-j=� i i STRUCTURAL DRAWINGS. sheet numberU � B.O.FOOTING ° , • ° � • . " `r ELEV. 3'6" A6.02 \\ \\ \\ \\ \\ \\ \\ \ \ \ ----------- --------------- B.O.FOOTING ! \ B U I L D i N G A = UNDISTURBED NATURAL SOILS OR \\j\/ \ \ \ \/\ ��\ \ \ \ \ \ \ \ \//\\//\\ ELEV.4-6" ENGINEERED FILL. / / \/\\ \\ \\/�� /\\/\\/\\/\\�\\ /\\/\\/\\� UNDISTURBED NATURAL SOILS OR ENGINEERED FILL. 9 T I F M . O A6.03 5"SQUARE x 3/"POST CAP 2"x 2"TOP RAIL T.O.RAILING Y ELEV.+13'-2 4"x 4"CORNER POST BEATTY HARVEY COCO 1"x1"PICKET A R C H I T E C TS , L L P NEW YORK I MARYLAND 1300 Walt Whitman Road, New York, 11747 p: (631)300-1010 CV N owner/developer L - POWDER COATED ALUMINUM RAILING Conifer Realty SYSTEM PER SPECIFICATION. 1000 University Avenue Suite 500 Rochester, NY 14607 1x6 TREX BOARD DECKING OVER 2x8 585.324-0500 DECK JOISTS, 0 4" M ih � MAX civil engineer 43L MA 405 South Country Road Brookhaven, NY 11719 631.286.8668 POWDER COATED ALUMINUM RAILING 1'g" 10'-11%" 1'g" m.e.p. &f.p. B 14� SYSTEM PER SPECIFICATION. VINYLSLIDING GLASS DOOR M/E Engineering, P.E. 2"x 2"BOTTOM RAIL s B CONTINUOUS ALUMINUM FLASHING 5/�� 150 North Chestnut Street -�- Rochester, NY 14604 5"SQUARE x%"POST BASE SELF-ADHERED FLEXIBLE MEMBRANE 585.288.5590 1x6 TREX BOARD DECKING OVER 2x8 DECK 2x8 LEDGER BOARD FASTENED TO 2x8 structural engineer JOISTS. BLOCKING REFER TO STRUCTURAL TDM Consulting 1gladSeT.O.DECKINSECTIDN 5/S2.01 5thouuntyRouit ob Y ELEV.+9'-8)/8" Saint James, NY 11780 3 DECK FLOOR PLAN 631.686.5234 %"x 7%"PVC FACIA BOARD ' A&03)` SCALE: 1/2"= 1'-0" 2 x 8 BAND JOIST PRESSURE TREATED STRUCTURAL BEAM. key REFER TO STRUCTURAL SECTION 5/S2.01 TRUE CLAD BEAM WITH 1x PVC TRIM BOARD 5 FIFFFFL NORTH A6.03 VERSAWRAP ACCENT WRAP WITH BASE CAP ° 6"x 6"CLASSIC VERSAWRAP COLUMN ° O COVER o ° - - ----------------------------------------- 6 x 6 WOOD POST O VERSAWRAP NOSE COVE MOULDING ° ° a ° ° ° ° ° ° ° 4 ° ° ° project 6 DECK & RAILING DETAIL ° ° a ° ° � VINEYARD VIEW A6.03 SCALE: 1 1/2" = 1'-O" COVER CLASSIC VERSAWRAP COLUMN ° 4 -�- 6 x 6 WOOD POST a ° ° a ° County Road 48 5 ° ° ° Greenport, NY 11944 ° ° seal _ a _ 6 ° ��RED ARC A6.03 15. CORE' . Cy�� T.O.RAILING 1 L T.O.RAILING 10'-11%" ELEV.+13'-2Y8" ELEV.+13'-2%" 1_g 14'-5Y4" k ISI POWDER COATED ALUMINUM RAILING POWDER COATED ALUMINUM RAILING qTF �•4`" SYSTEM PER SPECIFICATION. SYSTEM PER SPECIFICATION. OF NE`N M � M J 2x8 LEDGER BOARD FASTENED TO 2x8 � E BLOCKING REFER TO STRUCTURAL issue d date description� ' F SECTION 5/S2.01 I ' T.O.DECKING t T.O.DECKING K2 GROUND FLOOR PLAN 1 03/15/19 Issued for Construction ELEV.+g'-8%" ELEV.+9'-8%" A6.03 SCALE: 112" - 1'-0" 1x6 TREX BOARD DECKING OVER 2x8 1x6 TREX BOARD DECKING OVER 2x8 DECK JOISTS. DECK JOISTS. 3/"x 7)/4"PVC FACIA BOARD 3/"x 7Y"PVC FACIA BOARD m 2 x 8 BAND JOIST PRESSURE TREATED STRUCTURAL 5 - - - - - - - - - - — - - A6.03 PRESSURE TREATED STRUCTURAL � BEAM.REFER TO STRUCTURAL BEAM.REFER TO STRUCTURAL l SECTION 5/S2.01 CLAD BEAM WITH 1x SECTION 51S2.01 CLAD BEAM WITH 1x \ PVC TRIM BOARD __— I L - - - - - - - - - - - - - - - — — — — — — — — — — — — — — — -j PVC TRIM BOARD VERSAWRAP ACCENT WRAP WITH o \ a d a VERSAWRAP ACCENT WRAP WITH BASE CAP \ a a . a a 6 BASE CAP - \ 41 VERSAWRAP NOSE COVE MOULDING o F a d — — — — — — — — — — — — — — — — — — — — — — — — — — — — — — — — — — — — — -1 VERSAWRAP NOSE COVE MOULDING � 6"x 6"CLASSIC VERSAWRAP COLUMN 6"x 6"CLASSIC VERSAWRAP COLUMN COVER - \ COVER i 6 x 6 WOOD POST — " F — title a DECK PLANS, / POURED CONCRETE PIER AND-------\\ <02 ELEVATION , VERSAWRAP ACCENT WRAP WITH VERSAWRAP ACCENT WRAP WITH FOOTING REFER TO STRUCTURAL — — — — — — — — — — BASE CAP&BED MOULDING ° BASE CAP&BED MOULDING SECTION 4/S2.00 Ld _ _ SECTION DETAILS T.O.FIRST FLOOR SLAB T.O.FIRST FLOOR SLAB ELEV.0'-0" ELEV.0'-0" GI }� IN_ �- POURED CONCRETE PIER AND 4""� """ �`_ POURED CONCRETE PIER AND draw --- FOOTING REFER TO STRUCTURAL ii ' i FOOTING REFER TO STRUCTURAL I I I I + n by: FI _ h. r . „ii SECTION 4/S2.00 _u_�% �/� SECTION 4/S2.00 I I I I M .ii n• \/�� \ I I I — — — — —� — — — — -� checked by: 10'-113/4" in I I I I r T---1-----1---T-------------------------------------------------T---�----- �--T scale: AS NOTED 14-5/., project number: 10002 B.O.FOOTING - .- : - B.O.FOOTING I i I I -1--------------�------------------------- _ scaled inch i /`/ �� \ ----------------------- ------------ 1- ELEV.-3'-6' /��/��% ��/��!��'��/� �� //��i/>�ii/�\i��/y i��i�� ELEV._3'_6„ /��/i%%�/i �/%//i. �� ;�� sheet number 0 U BUILDING A �5 . DECK SECTION 4 DECK ELEVATION 1 FOUNDATION PLAN VSCALE: 112"= 1'-0" A6.03 SCALE: 112"= 1'-0" A6.03 SCALE: 1/2"= 1'-0" 7 T "—o(- 1 2 1 3 1 4 1 5 1 6 /° 71 8 1 9 rn DOOR TYPE:1. MINIMUM 10"HIGH SMOOTH SURFACE AT OR 36"TO 42"LEVER OR � BOTTOM,EITHER ATTACHED PANEL OR BOTTOM u , M �.� o RAIL. U SHAPED HANDLE. IRE STROBE HARDWARE: . .. 1. OPENABLE FROM INSIDE WITHOUT USE OF KEY OR "MIN - SPECIAL KNOWLEDGE OR EFFORT. LMJI 3- Cn 60 2.OPENABLE BY SINGLE EFFORT LEVER-TYPE DEVICE THERMOSTAT WITH OPERABLE CONTROLS o z j o (NOT REQUIRING GRASPING). z_ 3.MOUNTED 36"TO 42". 10"MIN. IRE PULL W o 12MAX 4.MAXIMUM 5 LBS.EFFORT TO OPERATE DOOR. BOTTOM RAILTATION ONVIENENCE D OR HARDWARE YIGHT WITCH OR PROVIDE B E A TT Y HARVEY Coco OUTLET SEE o 4M N SECTION 404.2.8&SECTION 404.2.9 KICK PLATE A R C H I T E C T ELECTRICAL °O _ "MIN NEW YORK I MARYLAND 10" DRAWINGS FORoIF PLANLOCATIOR5 10" 56"MIN SECTION 604.10:AMBULATORY 1300 Walt Whitman Road, New York, 11747 A _ o ` WALL MOUNTED W.C.) ACCESSIBLE COMPARTMENT FIGURE-A 4 DOOR REQUIREMENTS A p:(631)300-1010 0 o CENTER OF IN A7.00 SCALE: 112"= 1'-0" owner/developer Conifer Realty M � ao CONVENIENCE M �., FLOOR-MOUNTED W.C.) 1000 UniversityAvenue Suite 500 OUTLET ALTERNATE DOOR 1 1/2"MIN. Rochester,NY 14607 4"MAX71 LOCATION 1 1 2 585.324-0500 131/2". TYPICAL MISCELLANIOUS MOUNTING HEIGHTS ETURN ENDS TO ACE OF WALL x WALL,TYP civil engineer z 6 " IN l- 1-1/4"-2"O.D.NOM.PIPE PLAN LKMA 18 MOUNTING DETAILS _ o" 7 IN z - = Q RAIL WELD CONNECTIONS + 437&405 LOOK RECEPTACLE N AND GRIND SMOOTH + South Country Road U. O Brookhaven, NY 11719 60 Ai'.00 SCALE: 3/8"= 1'-0" O c� RACKETS WTH SPACER SPACE - 631.286.8668 z EQUAL AT 4'-0"O.C.MAX. - Q ELONGATED WALL-HUNG STALL TYPE _ - o o m.e.p. &f.p. MIN 1' "M X10 FIGURE 605.2 3 ROVIDE o B 52"MIN SECTION 605 URINAIS GROUNDING/BLOCKING @ 0 ELBOW TO M/E Engineering, P.E. SECTION GYPSUM&STUD PARTITIONS. WALL @ EACH B 150 North Chestnut Street 42"MIN. 6"MIN END AND CLOSE Rochester,NY 14604 WALL-MOUNTED W.C.) SECTION 505.7 HANDRAIL CROSS SECTION END 585.288.5590 Ir 9" IN FLOOR-MOUNTED W.C.) SECTION 604.9 WHEELCHAIR ACCESSIBLE COMPARTMENT 1 URINAL DIMENSIONS FIGURE-B SECTION 404.2.5:TWO DOORS IN SERIES FIGURE-C 3 HAN DRAIL DETAIL structural engineer WHEELCHAIR ACCESSIBLE COMPARTMENTS VoSCALE: 114"= 1'-0" A7.00 SCALE: 1 1/2" = 1'-0" TDM Consulting Engineering 550 North County Road,Suite E SECTION 403.5 CLEAR WIDTH 1 1/4"O.D.NOM.BRUSHED ALUM. Saint James, NY 11780 OR STEEL HANDRAIL W/RADIUSED 631.686.5234 LETTERS AND NUMBERS: RETURNS TO WALL EACH END 12 1. 'NIDTH TO HEIGHT RATIO BETWEEN 3:5 AND 1 : 1. (T) DOORS I N SERIES 3 12 2MI 13 TOILET STALLS 2.3.CONTRAST CHARACTERSTROKE WIDTH TO TBETWEEN 1 :5 AND SYMBOLS WITH D 1 : 10. 11 - � �� A7.00 A7.00 SCALE: 1/4" - 1 -0 BACKGROUND. A7.00 SCALE: 114 - 1 -0 key N 4,TANS SERIF CHARACTERS. PLAN cV ONE TREAD MIN. SIGNS/PICTOGRAMS: 1. PICTOGRAMS/PICTORIAL SYMBOL SIGNS SHALL BE NOTES: ACCOMPANIED BY THE EQUIVALENT VERBAL FOR TREAD AND RISER DIMENSIONS SEE C DESCRIPTION PLACED DIRECTLY BELOW THE F BOTH A CLOSER& PLANS AND SECTIONS. PICTOGRAM. THE BORDER DIMENSION SHALL BE 6" z LATCH ARE O PROVIDED. MINIMUM HEIGHT. - N LL 2. CHARACTERS AND BACKGROUNDS SHALL BE OF MI L 60MIN NON-GLARE CONTRASTING COLORS. 2 HANDRAIL ELEVATION OO RAISED 3. SIGNS/PICTOGRAMS SHALL BE INSTALLED ON THE ° SECTION 403.5 CLEAR WIDTH SECTION 403.5.2 PASSING SPACE WALL ADJACENT TO DOOR LEADING TO THE ROOM OR �-oSCALE: 112" = 1'-0" N& 18 SPACE THEY DESCRIBE AND AT 60"AFF TO SIGN FRONT APPROACH,PULL SIDE FRONT APPROACH,PUSH SIDE CENTERLINE AND WHERE A PERSON MAY APPROACH TRUE ° SECTION 404.2.5:TWO DOORS IN SERIES '17 WHEELCHAIR PASSING AND PASSAGE WIDTH WTHIN 3"OF SIGNAGE WITHOUT ENCOUNTERING O 0 PROTRUDING OBJECTS OR STANDING WITHIN THE DOOR project A" SCALE: 1/4"= 1'-0" 36"GRA BAR SWING AREA. z 4 z • 4. VERTICAL CLEARANCE AT SUSPENDED SIGNS WITH 36 � VINEYARD VIEW �I 16" WOMEN MINIMUM HEADROOM OF 80"REQUIRE MINIMUM 3" - v x REST ROJMS CHARACTER HEIGHT MEASURED BY USING UPPERCASE Q 42"GRAB BAR W. CHARACTERS AND NUMBERS SHALL BE SIZED D ACCORDING TO VIEWING DISTANCE FROM WHICH 28 CLEAR FLOOR SPACE 24 READ. LOWER CASE CHARACTERS PERMITTED. - County Road 48 4MAX. 8"GRAB BAR 8"GRAB BAR HINGE APPROACH,PULL SIDE HINGE APPROACH,PULL SIDE FIGURE 308.2.1 Greenport, NYS 944 MIN SIGN LOCATIONS: FORWARD REACH 111 17- till III 8"GRAB BAI2 O 5.ALL ACCESSIBLE ENTRANCES IDENTIFIED WITH = 4MIN seal 12MAX 24"GRAB BAR SECTION 604.3.1:WATER CLOSET CLEARANCE M'NIMUM OF ONE STANDARD SIGN. z w 20"MAX. >29'-25" (�,�,\0�E GFRq,9 4MIN 24MAX PUBLIC TOILET: CLEAR FLOOR SPACE AT WATER CLOSETS �Y( �L� 10,ADDITIONAL DIRECTIONAL SIGNS ALONG �o o N �� CONTROL ARI: _ UU = Q O ry MEN ACCESSIBLE PATH OF TRAVEL ARE REQUIRED. Q v z z = ",r' sal p -� A36MIN 11.BUILDINGS REMODELED TO PROVIDE ACCESSIBLE o 2'- "MIN > n M - ca Cl) SEAT cc r, 1 SANITARY FACILITIES FOR PUBLIC USE SHALL HAVE _ o Q Q ` 0 * C' IWORMATION POSTED IN THE LOBBY AS PART OF THE o " "' SEAT I BLILDING DIRECTORY. - O - ly 021 Q� - _ T J / FOOT BACK CONTROL WALL O 36"GRAB AR LAV SIIMBOI OF ACCESSIBILITY: z_ SECTION 607.4.2 BATHTUBS WITHOUT PERMANENT SEATS O � 1.STANDARD USED TO IDENTIFY ACCESSIBLE FACILITIES. o FIGURE 308.2.2 z z - 2.SYMBOLS OF ACCESSIBILITY SHALL CONTRAST WITH 16". E OVABLE ®� ThEIR BACKGROUND,WITH EITHER LIGHT SYSMBOL ON 4. LATCH APPROACH, 11 SIDE LATCH APPROACH,PUSH SIDE FORWARD REACH OVER AN OBSTRUCTION 77777 E 42"GRAB BAR E3®®® BARK BACKGROUND OR A DARK SYMBOL ON A LIGHT 16 GRAB BARS AT TUMHOWER ®®®®® E issued date description 3.WHEN ENFORCING AGENCY DETERMINES,IF A7.�OSCALE: 1/4"- 1'-0" CLEAR FLOOR SPACE CLEAR FLOOR SPACE A'PROPRIATE,SPECIAL DESIGNS AND COLORS MAY BE 1 03/15/19 Issued for Construction - , PARALLEL 2 06/13/19 TOS Bldg Dept Comments Q 2 A PROVED. �\ SECTION 1004.11.3.1.2:WATER cc APPROACH SECTION 1004.11.3.1.2:CLEARANCE FIGURE 703.7 BF.aIILE. 6 DOOR APPROACH REQUIREMENTS ARANCE WITH LAVATORY(OVERLAP EXCEPTION) 1.USE CONTRASTED GRADE 2 BRAILLE.DOTS TO BE 0.1" Co DWELLING UNITS TOILETS: CLEAR FLOOR SPACE WWWATE CL SE SYMBOLS OF ACCESSIBILITY O.C.IN EACH CELL. A7.00 SCALE: 114" = 1'-0" RACK WAIL; 2.0.2"SPACE BETWEEN CELLS. 3.DOTS RAISED MINIMUM 0.025"ABOVE BACKGROUND. W W FIGURE 308.3.1 ° � �. (70 - N rl2 WATER CLOSET CLEARANCES 9 SIGNS AND PICTOGRAMS UNOBSTRUCTED SIDE REACH Z >10°-24" 30 M 1 M <= A7.00 SCALE: 114" = 1'-0" A7.00 SCALE: 114"= 1'-0" CLEAR FLOG 5PAC CLEAR FLOOR SPACE NOTE: F F LENGTH OF TUB TUB LENGTH OMPRESSED CARPET 114"MAX. IN.FLOOR LEVEL 1, IF OBSTRUCTION IS LESS THAN 10", = BELOW THRESHOLD THRESHOLD MAX REACH HEIGHT SHOULD BE 48" SECTION 607.2:CLEARANCE FOR BATHTUBS „-O, 12MAX 112MAX o J � POST. X N title FIGURE 308.3.2 ACCESSIBILITY 15 CLEARANCE FOR BATHTUBS FIGURE 302.2 CARPET ON FLOOR SURFACES OBSTRUCTED SIDE REACH POST. DETAILS & NOTES A7.00 SCALE: 114"= 1'-0" SECTION 307.3 MI Q 2MI 36MIN 2MI Q X> 12 2 27 ° Qa Y T-SHAPED 2 xa POST. X>12 ICC Al 17. 1 -2009 18"GRAB BAR 18"GRAB BAR ,� X Q FIGURE 302.2 BEVELED CHANGE IN LEVELS G CLEAR 6"GRAB BAR CL 42"GRAB BAR C drawn by: -- z z z Q < FLOOR MIN 54MIN NOTE: SECTION 307.3 n a SPA E 24MIN 42MIN THE SLOPING PORTIONS OF HANDRAILS SERVING STAIRS AND RAMPS " z checked by: --- QMIN - / SHALL NOT BE REQUIRED TO COMPLY WITH 307.3. scale: AS NOTED <10 10 •, a x M a / / FIGURE 307.2 LIMITS OF PROTRUDING OBJECTS 6 TOE CLEARANCE FIGURE 302.2 VERTICAL CHANGE IN LEVELS NOTE: MIN _ _ project number: 10002 KNEE CLEARANCE$ NOTES: ELEMENTS LOCATED ON CIRCULATION PATHS,INCLUDING OPERABLE ELEMENTS,MUST COMPLY WITH CIRCULAR scaled inch LAV DEPTH REQUIREMENTS FOR PROTRUDING OBJECTS. CASEMENT WINDOWS,WHEN OPEN,CANNOT ENCROACH MORE NOTE:DASHED LINE INDICATES MINIMUM LENGTH OF FIGURE #32 1. 1/2"MAXIMUM TOTAL HEIGHT WITH 114"MAXIMUM VERTICALCHANGE AT EDGE. THAN 4 INCHES INTO CIRCULATION PATHS ABOVE 27 INCHES CLEAR SPACE ERQUIRED ON EACH ARM OF THE T-SHAPED sheet number l 0 FIGURE #31 BACK WALL SIDE WALL 7"-9" 2. 1 :2 SLOPED BEVEL REQUIRED IF LEVEL CHANGE IS OVER 1/4'VERITCAL LEVEL CHANGE. EXCEPTION:HANDRAILS SHALL BE PERMITTED TO PROTRUDE 4 1/2"MAX SPACE IN ORDER TO COMPLETE THE TURN CLEAR FLOOR SPACE AT LAVATORY CLEARANCES LAVATORIES SECTION 604.5 GRAB BARS SECTION 604.5 GRAB BARS 3. CHANGE IN LEVEL OF 1/4 INCH MAXIMUM IN HEIGHT SHALL EE PERMITTED TO BE VERTICAL. SECTION 304.3.1 CIRCULAR SPACE SECTION 304.3.2 T-SHAPED SPACE BUILDING f-1 SECTION 604.7 DISPENSERS FIGURE 304.3(a)Circular FIGURE 304.3(b)T-shaped it 9 4 LAVATORY CLEAR SPACE 11 WATER CLOSET GRAB BARS 8 _ F HRESHOLD REQUIREMENTS 5 LIMITS OF PROTRUDING OBJECTS 1 TURNING SPACES p�7.00 SCALE: 1/4"= 1'-0" A7.00 SCALE: 114" = 1'-0" A7.00 SCALE: 6" = 1'-0" A7.00 SCALE: 114" = 1'-0" A7.00 SCALE: 114"= 1'-0" C° H H A7000 1 21 31 4 bi 6 /1 81 9 rn + „ o N M AIR SEALING NOTES FOR 0 MULTIFAMILY WOOD CONSTRUCTION 3rD)-"_jPi OPEN INSULATED RIGID INSULATION ( TAPED SINGLE HEADER 1. EXTERIOR WALL-TOP:REDUCE LEAKAGE BETWEEN UNCONDITIONED ATTIC AND WALL CAVITIES. CLIP SUPPORT FOR GWB OR SEALED AT CORNERS. TAPED OR SEALED JOINTS a. STOP AIR MOVEMENT THOUGH CRACK BETWEEN DRYWALL AND TOP PLATES. APPLY DRYWALL ADHESIVE TO FRAMING BEFORE INSTALLING DRYWALL. Y �: DOUBLE TDP PLATE OPEN INSULATED b. STOP AIR MOVEMENT BETWEEN THE SHEATHING AND THE TOP PLATES.APPLY SEALANT DOUBLE HEADER DOUBLE HEADER WITH RIGID INSULATION TO INSIDE FACE BETWEEN SHEATHING AND FRAMING ALTERNATE HORIZONTAL J" THICK RIGID INSULATION ANCHOR THROUGH RIGID BEATTY HARVEY COCO BLOCKING FOR GYPSUM 1" THICK RIGID INSULATION (TIMBER STRAND) HEADER A R C H I T E C T S , L L P BOARD SUPPORT OVER THICK PLYWOOD CAVITY LEFT OPEN TO BE INSULATION TO DOUBLE HEADER. 2. EXTERIOR WALL MIDDLE:REDUCE LEAKAGE BETWEEN FLOOR AND WALL CAVITIES. OR OSB SHEATHING INSULATEC FROM INTERIOR ALTERNATE: PROVIDE BLOCKING a. APPLY SEALANT BETWEEN SILL PLATE AND SHEATHING. NEW YORK MARYLAND BEHIND ANCHOR b. APPLY SEALANT BETWEEN DRYWALL AND SILL PLATE. 1300 Walt Whitman Road, New York, 11747 A 1_ c. APPLY SEALANT BETWEEN SILL PLATE AND SUBFLOOR. A p: (631)300-1010 d. APPLY SEALANT AT ALL WALL PENETRATIONS. owner/developer TWO STUD CORNER e. APPLY SEALANT BETWEEN TOP PLATE AND SHEATHING. ALTERNATE 1X6 CLIP SUPPORT FOR ! f. APPLY SEALANT BETWEEN TOP PLATE AND DRYWALL Conifer Realty SUPPORT FOR GYPSUM BOARD 1000 University Avenue Suite 500 3. EXTERIOR WALL-BOTTOM:REDUCE LEAKAGE BETWEEN WALL CAVITIES AND APARTMENTS. Rochester, NY 14607 GYPSUM BOARD. SINGLE HEADER STUD NOTCHED TO . a. APPLY SEALANT BETWEEN SILL PLATE AND SHEATHING. 585.324-0500 ALLOWS FOR SET TOWARDS INSULATION OUTSIDE OF WALL SUPPORT SINGLE HEADER b. APPLY SEALANT BETWEEN DRYWALL AND SILL PLATE. INSTALLATION FLUSH W EXTERIOR PLYWOOD PLATE c. APPLY FOAM GASKET UNDER SILL PLATE / I ' d. APPLY SEALANT BETWEEN SILL PLAT AND SLAB civil engineer PAST IWTERIOR SURFACE OF STUD HEADER HANGER SIZED BY LKMA PARTITION WALL ALTERNATE 1 X 4 CALCULATED LOADS 4. EXTERIOR WALL-WINDOW JAMB,HEAD&SILL:REDUCE LEAKAGE BETWEEN WALL CAVITIES AND 437 &405 SUPPORT FOR GYPSUM OUTDOORS. South Country Road BOARD SINGLE STUD SINGLE STUD a. APPLY SEALANT BETWEEN FRAMING AND SHEATHING. Brookhaven, NY 11719 NOTE: b. APPLY SEALANT BETWEEN WINDOW AND FRAMING. 631.286.8668 c. APPLY SEALANT BETWEEN DRYWALL AND WINDOW. USE DETAIL IN NON-LOADBEARING d. APPLY SEALANT BETWEEN FRAMING MEMBERS. m.e.p. &f.p. TAPED JOINTS WALLS. SEE PROJECT MANUAL FOR FURTHER INFORMATION 5. DEMISING WALLIINTERIOR PARTITION AT EXTERIOR/CORRIDOR WALL:REDUCE LEAKAGE BETWEEN M/E Engineering, P.E. EXTERIOR/CORRIDOR WALL AND DEMISING WALUINTERIOR PARTITION. 3 150 North Chestnut Street a. APPLY SEALANT AT ALL PENETRATIONS THOUGH WALL FRAMING. Rochester, NY 14604 b. APPLY SEALANT BETWEEN DRYWALL AND FRAMING. 585.288.5590 6. CORRIDOR/DEMISING WALL/INTERIOR PARTITION-TOP/BOTTOM:REDUCE LEAKAGE BETWEEN structural engineer UNCONDITIONED ATTIC/FLOOR STRUCTURE AND DEMISING WALUINTERIOR PARTITION. r_i_" WALL FRAMING DETAILr_4_"'�CORNER FRAMING/BRACING DETAIL 7 WINDOW HEADER DETAIL 10INSULATED HEADERS a. APPLY SEALANTAT ALL BETWEE DRYWALL AND FRAMING. TDM Consulting g Engineering b. APPLY SEALANT BETWEEN DRYWALL AND FRAMING. 550 North County Road,Suite E 17 0 EEBA FIG. 11.4 EEBA FIG. 11.3/11.11 EEBA FIG. 11.5SCALE: _ EEBA FIG. 11.5SCALE: _ , an James, NY .5234 1 -1-0 1 -1 0 631.686.5234 7. DOUBLE SHAFT WALL AT EXTERIOR/CORRIDOR WALL TOP:REDUCE LEAKAGE BETWEEN UNCONDITIONED ATTIC/FLOOR STRUCTURE AND DEMISING WALUINTERIOR PARTITION/SHAFT WALL. OVERSIZE ROOF TRUSS a. APPLY SEALANT OR AT ALL PENETRATIONS THOUGH WALL FRAMING. PROVIDES INCREASED b. APPLY SEALANT BETWEEN DRYWALL AND FRAMING. DEPTH OF ROOF c. APPLY SEALANT OR EXPANDING FOAM BETWEEN ALL GAPS BETWEEN WALL FRAMING. key INSULATION AT PERIMETER / -CONTINUOUS VAPOR TRUE BARRIER 8. DEMISING WALL/INTERIOR PARTITION AT EXTERIOR/CORRIDOR WALL:REDUCE LEAKAGE BETWEEN NORTH SHEATHING TAPE RIGID INSULATION INSULATION BAFFLE EXTERIOR/CORRIDOR WALL AND DEMISING WALUINTERIOR PARTITION. CTL�PREVENTS WIND BLOWING ADHESIVE MEMBRANE STRIP ( INSTALLED IN A THROUGH INSULATION AND SEALANT, ADHESIVE OR TOP EDGE TAPED TO SHEATHING CONTINUOUS MANNER CONTINUOUS BEAD OF SUBFLOOR a. INSTALL DRYWALL BETWEEN INTERSECTING WALL FRAMING.b. INSTALL SHEATHING BETWEEN INTERSECTING WALL FRAMING AT SHEAR WALLS PAST ROOF FRAMING ADHESIVE MAINTAINS 2" CLEARANCE GASKET WITH SHEATHING TAPE) D O UNDER ROOF SHEATHINGLEDGER NAILED OVER TOP CONTINUOUS ENGINEERED WOOD 9. CORRIDOR WALUEXTERIOR DOOR:REDUCE LEAKAGE BETWEEN APARTMENT AND CORRIDOR FLASHING SEALANT OR ADHESIVE WALL/OUTDOORS. RIGID INSULATION SEALANT ADHESIVE OF RIGID INSULATION RIM/BAND JOIST CLOSURE RIGID INSULATION % CONTINUOUS VAPOR OR GASKET SEALANT AT CORNER OF SEALANT a. APPLY SEALANT BETWEEN DOOR FRAME AND FRAMING. CONTINUOUS PLATE TIES BARRIER ADHESIVE BOTTOM PLATE & FLOOR TRUSS b. APPLY GASKETS1WEATHER STRIPPING AT DOOR SWEEP. 0RIM JOIST TO CEILING SUBFLOOR OR GASKET SETBACK ON ° RAFTERS INSULATION BAFFLE ELECTRI IRE TOP PLATE RIGID INSULATIONFRIM JOIST BAND JOIST SET a. APPLY SEALANT AT ALL EDGES BETWEEN MILLWORK TRIM AND DRYWALL. " PROVIDES 2" MIN UNDER BOTTOM PLATE THICKNESS OF FILLER 10. MILLWORK TRIM:REDUCE LEAKAGE BETWEEN WALL CAVITIES AND APARTMENT BACK ON TOP PLATE. ROOF RAFTERS TERMINATE CLEARANCE UNDER ROOF SEALANT ADHESIVE OR ENGINEERED THICKNESS OF RIGID 11. PLUMBING PENETRATIONS:REDUCE LEAKAGE BETWEEN WALL CAVITIES AND APARTMENT. ° IN RIM JOIST TO INCREASE SHEATHING GASKET WOOD INSULATION FILLER. a. APPLY SEALANT AT ALL PLUMBING PENETRATIONS THROUGH DRYWALL/SUBFLOOR. DEPTH OF ROOF RIM/BAND b. SEAL ALL PENETRATIONS BEFORE INSTALLING CABINETRY,ESCUTCHEONS AND FIXTURES. project INSULATION AT PERIMETER / SEALANT, ADHESIVE OR LEDGER NAILED OVER TOP OIST CLOSURE RIGID INSULATION / GASKET OF RIGID INSULATION SEAL ELECTRICAL SEALANT VINEYARD VIEW PENETRATIONS 12. ELECTRICAL BOXES:REDUCE LEAKAGE BETWEEN STRUCTURAL CAVITIES AND APARTMENT. INSULATION BA=FLE PROVIDES SEALANT ADHESIVEOR GASKET a. APPLY SEALANT TO SCREW HOLES AND UNUSED KNOCK-OUTS. 2" MIN CLEARANCE UNDER CONTINUOUS VAPOR SEALANT b. APPLY SEALANT BETWEEN ELECTRICAL BOX AND DRYWALL. ROOF SHEATHING BARRIER RIGID INSULATION SEAMS c. APPLY SEALANT TO WIRE PENETRATIONS. 3 SEALANT THIS APPROACH MAY ELIMINATE THE NEED FOR ADDITIONAL d. OR COVER PLATES AND GASKETS. TAPED/SEALED PRIOR TO -CONTINUOUS VAPOR County Road 48 RIGID INSULATION NOTCHED INSTALLATION OF ROOF FRAMING BARRIER RIGID INSULATION BATT INSULATION TO INTERIOR 13. DUCTWORK:REDUCE LEAKAGE BETWEEN CAVITIES AND APARTMENT. Greenport, NY 11944 AROUND ROOF TRUSSES p TO ACT AS WIND SHIELD �- SEALANT, ADHESIVE OR a. APPLY SEALANT/EXPANDING FOAM BETWEEN DUCT AND DRYWALL. GASKET b. APPLY SEALANT/EXPANDING FOAM BETWEEN DIFFUSERS/REGISTERS AND DRYWALL seal FOR ROOF INSULATION ELECTRICAL WIRES PASSING TO EXTERIOR SHOULD BE ADDITIONAL BATT INSULATION CAN BE ADDED TO INTERIOR �F!I IED ARC SEALED WITH FOAM SEALANT OR CAULKING 14. UTILITIESIACCESS PANELS:REDUCE LEAKAGE BETWEEN STRUCTURAL CAVITIES AND APARTMENT. 't RIGID INSULATION �5 2E(3h/ROOF FRAMING a. APPLY SEALANT/WEATHERSTRIPPING BETWEEN PERIMETER OF PANEL AND DRYWALL. �„� 0ROOF INSULATION THERMAL RESISTANCE ( DEPTH) AT b. APPLY SEALANTIWEATHERSTRIPPING ON PANEL DOOR. Q00 n� TRUSS HEEL (ROOF PERIMETER) SHOULD BE EQUAL OR T* I, ��l GREATER THAN THERMAL RESISTANCE OF EXTERIOR WALL 15. RECESSED COMPONENTS:REDUCE LEAKAGE BETWEEN WALL CAVITIES AND APARTMENT. a. APPLY SEALANT BETWEEN RECESSED CABINET AND DRYWALL. s b. APPLY SEALANT BETWEEN CRACKS AND SEAMS. (tap)�ra 2 ROOF FRAMING DETAILS 5 SHED ROOF DETAILri_N�FLOOR TRUSS RIM CLOSURE 11 SET-BACK RIM JOIST 16. PACKAGED HEATING/COOLINGEQUIPMENT(PTACs):REDUCELEAKAGEBETWEENAPARTMENTAND FOFNE`N WALL CAVITIES/OUTDOORS. EEBA FIG. 11.47 EEBA FIG. 11.28 EEBA FIG. 11.21 EEBA FIG. 11.22 a. APPLY SEALANT BETWEEN SLEEVE AND AND FRAMING. SCALE:1"=1'-0" SCALE:1"=1'-0" b. APPLY SEALANT BETWEEN SLEEVE AND DRYWALL. _, C issued date description + 17. RECESSED LIGHTING:REDUCE LEAKAGE BETWEEN ATTIC/FLOOR CAVITIES AND APARTMENTS RIGID INSULATION a. APPLY SEALANT BETWEEN RECESSED LIGHT HOUSING AND DRYWALL. 1 03/15/19 Issued for Construction INSTALLED IN A b. USE INSULATED CONTACT AIR-TIGHT CANS. SHEATHING TAPE CONTINUOUS MANNER PAST DECK LEDGER ADHESIVE MEMBRANE STRIP (TOP FRAMING 18. DOOR LATCH HOLE:REDUCE LEAKAGE BETWEEN WALL CAVITIES AND APARTMENTS EDGE TAPED TO SHEATHING WITH CAVITY INSULATION a. APPLY SEALANVEXPANDING FOAM AT DOOR STRIKE. 1.6" 1.6 SHEATHING TAPE) FLASHING BEAD OF ADHESIVE BEAD OF ADHESIVE -RIGID INSULATION SEAMS SLOTTED ANCHOR AT CONTINUOUS BEAD OF DRYWALL FOIL FACED OR EXTRUDED ADHESIVE MEMBRANE TAPED/SELAED PRIOR TO NON-BEARING WALLS INSTALLATION OF ADHESIVE REQUIRED HERE POLYSTYRENE RIGID STRIP OVER STEP INSULATIONFLASHING ( TOP EDGE DRAINAGE CAP o DECK/LEDGER FRAMING 0 KICKOUT ENDPIECE TAPED TO SHEATHING W/ o SHEATHING TAPE) HANGER -� F STEP FLASHING, TYP. CONTINUOUS VAPOR +F O USE SHIPLAPPED SHEATHING LEDGER ATTACH WITH BARRIER IF AVAILABLE,OTHERWISE ANCHOR BOLTS TO CLIPS MAY ALSO BE USED USE MASTIC OR ADHESIVE BLOCKING/FLOOR SEALANT STRUCTUR SHEATHING TAPE CONTINUOUS BEAD OF ADHESIVE MEMBRANE STRIP DRYWALL ADHESIVE ROOFING PAPER TURNEDtitle FLASHING REQUIRED HERE UP AT WALL TYPICAL ADHESIVE MEMBRANE CAP DRYWALL CLIPS TRUSS UPLIFT PATCH FRAMING & A I R DO NOT INSTALL CEILING DRYWALL ADHESIVE OR CEILING DRYWALL SCREWS/NAILS CLOSER THAN 18" TO INTERIOR PARTITION IN ORDER TO SEALING DETAILS FLOAT DRYWALL AT CORNERS CONTROL DRYWALL CRACKING FROM TRUSS UPLIFT. FLOATING CORNERS OF CEILING DRYWALL ALLOW TRUSS MOVEMENT SEAMS & CORNERS TAPED WITHOUT DRYWALL CRACKING NOTE THAT A CONTINUOUS BEAD OF TO PROVIDE DRAINAGE DRYWALL ADHESIVE IS REQUIRED ALONG BOTH SIDES OF TOP PLATES PLANE CONTINUITY FOR WALL. DRYWALL TO PROVIDE AIR BARRIER CONTINUITY. C MEMBRANE FOLDED AROUND JOIST OVER drawn by: --- HANGER checked by: -- 3 DIRYWALL CLIPS & SLOTTED ANCHOR 6 CEILING GWB/TRUSS UPLIFT DETAILr9 ' STEP FLASHING DETAILr12NDECK LEDGER FLASHING DETAIL scale: AS NOTED 0 project number: 10002 EEBA FIG. 16.5 SCALE:1"=1'-0" EEBA FIG. 16.4 EEBA FIG. 2.23 SCALE:1"=1'-0" EEBA FIG. 2.25 SCALE:1"=1'-0" scaled inch U Q O sheet number U O U BUILDING A z co 0 A701+ + + + + + - H ° 1 L 4 7 � g N 'cY CD SEAL DRYWALL TO FIRST SEAL AROUND ROUGH STUD IN THE WALL (SEE CEILING DRYWALL OPENINGS OF WINDOWS-----,,, FIGURE 16.7) CONTINUOUS SEALANT, AND DOORS EXTERIOR WALL ai i DRYWALL ADHESIVE ON /;;j %�,%j;/j% / % r ADHESIVE OR GASKET � / CONTINUOUS SEALANT, INTERIOR WALL AROUND OPENINGS AT SEAL ALONG TOP PLATES BOTH SIDES OF FIRST ADHESIVE OR GASKET AT EXTERIOR ON EXTERIOR WALL INTERIOR STUD TOP PLATE EXTERIOR CLIPS INSTALLED BY SINGLE HEADER FRAMER OR DRYWALLER PREFERRED. LOCATE TO AIR SEALS CAULKING, END STUD OF ADJOINING EXTERIOR OF WALL TO ADHESIVE OR GASKET) WALL PERMIT INSULATING FROM BEATTY HARVEY COCO INTERIOR TO MINIMIZE DRYWALL CLIPS A R C H I T E C T S , L L P GYPSUM BOARD CRACKING NEW YORK MARYLAND DUE TO WOOD SHRINKAGE EXTERIOR WALL 1300 Walt Whitman Road, New York, 11747 INSTALL THIS PANEL FIRST INTERIOR PARTITION HELD BACK FROM AGAINST CLIP SUPPORT LOAD BEARING WALL EXTERIOR WALL 1" TO ALLOW -� owner/developer p (631)300-1010 INSTALLATION OF EXTERIOR WALL DRYWALL PAST INTERIOR PARTITION Conifer Realty INSTALL THIS PANEL 1000 University Avenue Suite 500 AGAINST OTHER SIDE ----- Rochester, NY 14607 585.324-0500 SHEATHING CONTINUOUS SEALANT, DRYWALL CONTINUOUS civil engineer ADHESIVE OR GASKET AT PAST INTERSECTING CLIP ALTERNATE: BOTTOM PLATE EXTERIOR SEAL ALONG TOP INTERIOR PARTITION LKMA DRYWALL IN 140FWOOD PALL ST STUD IN INTERIOR WALL BOTTOMS OF WINDOWS & DOOR SUPPORTS PLATES ON EXTERIOR SE G INSIDE OF BOTTOM OF 437 &405 South Country Road ( OPENINGS SHOULD BE THROUGH Brookhaven, NY 11719 PARTITIONS SEAL AT TOP SEE FIGURE 16.7) OR HOLD BACK 631.286.8668 PLATE WHERE ADJACENT FIRST STUD TO PASS DRYWALL WALL FLASHED p Q DRYWALL ADHESIVE AT TO AN UNCONDITIONED BEHIND STUD (SEE FIGURE 16.8) CEILING INSULATION m.e.p. &f.p. SPACE SEE FIGURE 16.8 BOTTOM & TOP OF STUD DRYWALL AD ESIVE AT EXTERIOR RIGID INSULATION IS SEALED TO EXTERIOR OF WALL FRAMING AT ( ) BOTTOM PLATE & TOP TAPED JOINT M/E Engineering, P.E. B� TOP PLATES, BOTTOM PLATES AND AROUND OPENINGS. PLATE AIR SEAL (CAULKING, B 150 North Chestnut Street 0 HEADER IS NEEDED ABOVE WINDOW OPENING IF WALL IS LOAD BEARING USE CAUTION WHEN INSTALLING DRYWALL AT GASKETS OR ADHESIVE OR GASKET) Rochester, NY 14604 USE OF CLIP SU T FOR GYPSUM BOARD RES LTS IN SINGLE HEADER RATHER THAN DOUBLE HEADER PREFERRED, SIZED OVER POLYETHYLENE SO THAT GASKETS ARE NOT MOVED 585.288.5590 FLOATING CDRNERS & SIGNIFICANTLY LESS DRYWALL APPROPRIATELY FOR LOAD. OUT OF POSITION OR POLYETHYLENE IS NOT CUT OR TORN. CRACKING GASKET CAN BE USED IN PLACE OF SEALANTS OR ADHESIVES. structural engineer TDM Consulting Engineering 13 INSULATED HEADERS 16 EXTERIOR AIR SEALING DETAIL �191NTERIOR AIR SEALING DETAILr2-2NAIR SEALING DETAIL 25 AIR SEALING DETAIL 550NorfSaintJ James, 0 Saint James, NY 1 1780 EEBA FIG. 16.3 EEBA FIG. 11.7 EEBA FIG. 16.6 EEBA FIG. 16.7 EEBA FIG. 16.8 631.686.5234 CEILING DRYWALL TAPED TO WALL/DRYWALL TO SEAL THE WINDOW FRAME TO 6" MIN VERTICAL LAPS OPENING, APPLY CONTINUOUS SEAL TO key WALL SHEATHING THE BACKSIDE OF THE WINDOW FLANGE 6, NEAR THE OUTER EDGE OR APPLY TRUE �— CONTINUOUS SEAL TO PERIMETER OF NORTH SILL FLASHING OPENING AT A POINT TO ASSURE CONTACT W/BACKSIDE OF MOUNTING DRYWALL CAULKED,GLUED OR FLANGE. GASKETED TO TOP PLATE DRAINAGE PLANE BOTTOM PLATE CAULKED OR GASKETED AA r' INS TION IS COMPRESSED TO SUBFLOOR 4" MIN HORIZONTAL LAPS 0 CREATI VOIDS WHEN INSET DRYWALL CAULKED OR GASKETED TO BOTTOM PLATE 16° EXTEND FLASHING HORIZONTALLY 16 HEAD FLASHING WITH ° STAPLING IS USED INCHES TO PROJECT BEYOND DRIP EDGE INSTALLED INSTALL DRAINAGE PLANE VERTICAL JAMBS FLASHING APPLIED OVER NAILING y -- OVER HEAD FLASHING & SUBFLOOR GLUED, CAULKED OR GASKETED LATER FLANGE ° OVER TOP OF NAIL-ON HEAD P TO RIM JOIST/RIM ENCLOSURE -DRAINA E N 3RD FLANGE OF WINDOW FRAME roject COU DRYWALL CAULKED,GLUED OR GASKETED TO TOP PLATE SILL FLASHING FOLDED OVER BOTTOM VINEYARD VIEW �-KRAFT F FOIL FACING RIM JOIST/RIM CLOSURE CAULKED OR OF ROUGH OPENING & UP JAMB, VOID GASKETED TO SUBFLOOR MENIMU N.TURN OFASTENVER MTOP EDGE B AND LOF BOTTOM PLATE CAULKED OR GASKETED TO TOP PLATE 12" MINIMUM WINDOW FLASHING BUT DO NOT D FASTEN THE LOWER 1-1/2" SO THE DRAINAG + County Road 48 DRYWALL CAULKED OR GASKETED TO BOTTOM PLATE DRAINAGE DRAINAGE PLAN MAY BE SLIPPED UP SHIM & ADJU WINDOW TO ACHIEVE COU Greenport, NY 11944 PLAN FIRST & UNDER THE FLASHINGSLIP DRAINAGE PLANE 1ST COURS SQUARE, PLUMB & LEVEL CONDITIONS. USE ---,,_SUBFLOOR GLUED, CAULKED OR GASKETED TO COURSE UNDER JAMB seal INSTALL SILL FLASHING CORROSION RESISTANT FASTENERS WITHIN 10 FLASHING BOTTOM OF RIM JOIST/RIM ENCLOSURE INSTALL JAMB FLASHING INCHES , BUT NO CLOSER THAN 3 INCHES IN WINDOW SILL RED ARC RIM JOIST/RIM ENCLOSURE CAULKED OR INSTALL WINDOW DIRECTION FROM EVERY CORNER SECURE ACE STAPLING IS RECOMMENDED - --GASKETED TO SILL PLATE INSTALL HEAD FLASHING ( IF NECESSARY) ME WINDOWS ARE MANUFACTURED WITH AN WINDOW AROUND FRAME OPENING WITH �� , 'p t� WHERE FACED BATT INSULATION IS O INSTALLED SILL PLATE INSTALLED INSTALL DRAINAGE PLANE SHINGLE FASHION FROM BOTTOM TO INTERNAL HEAD FLASHING ( SELF FLASHED) EQUIVALENT OF 6d FASTENERS AT 16 0.C. DRAINAG N 1RST OVER SILL GASKET UNDERSIDE OF OPENING HOWEVER THESE SELF FLASHED WINDOWS CAN MINIMUM. SEAL PENETRATIONS INTO COU WINDOWS/DOORS WITHOUT FLANGES SEALED TO JAMB AND INSTALL REMAINDER OF DRAINAGE PLANE SHINGLE FASHION EXPERIENCE LEAKAGE AT UPPER CORNERS DUE WATERPROOFING (TYPICAL) SILL FLASHING AROUND OPENING WITH SEALANT OVER NOTE: FROM UNDERSIDE OF OPENING TO WALL OVER SIDE WINDOW TO LACK OF FLASHING EXTENSION BEYOND SHADED COMPONENTS DESIGNATE AIR FLOW RETARDER AFTER INSTALLATION, SEAL ALL BACKER ROD SYSTEM FLANGE WINDOW OPENINGS. THESE CORNERS TYPICALLY CORNERS OF MECHANICALLY JOINED �' WINDOWS/DOORS WITH FLANGES T`'PICALLY INSTALLED IN BED NEED ADDITIONAL SEALING. FRAMES TO SEAL FRAME SEAM JOINTS ��T �a7 2y4 AIRTIGHT DRYWALL APPROACH OF SEALANT BETWEEN FLANGES AND JAMB & SILL FLASHING � SOF NE`N rl'4 FACE STAPLING VS. INSET STAPLING 17 INT. AIR BARRIER USING DRYWALL/FRAM 20 SILL FLASHING DETAILr2-3--�WINDOW INSTALLATION r2-6'-�DRAINAGE PLAN APPLICATION EEBA FIG. 15.1 EEBA FIG. 2.4 EEBA FIG. 2.4 E issued date description EEBA FIG. 3.3 EEBA FIG. 2.4 + 1 03/15/19 Issued for Construction FLUID-APPLIED WATERPROOFING SEALANT, ADHESIVE OR OVER CEMENT BOARD, COATING GASKET INTERIOR WALL ENTIRE SURFACE BLOCKING POSITIONED SO EXTENDING TO THAT TUB FLANGE JUST EXTERIOR WALL DRYWALL CAULKED, GLUED OR SEALED TO TOP PLATE CATCHES BOTTOM EDGE TILE APPLIED WITH — EXTERIOR WALL EXTERIOR SHEATHING CAULKED, GLUED OR SEALED THINSET OVER FLUIDTHIN PROFILE STRUCTURAL CORNER BAD EDGE SUPPORT TO TOP PLATE APPLIED WATERPROOFING FOR THIN P OFILE STRUCTURAL STUDS CLADDING SHEATHING EXTENDS UP WALL TO TOP PLATE SHEATHING TAPED OR SEALED JOINTS IN EXTERIOR SHEATHING BAD OF ADHESIVE SEALS TILE CONTINUOUS BEAD OF EXTERIOR SHEATHING CAULKED, GLUED OR BACKING TO THIN PROFILE SEALED TO BOTTOM PLATE STRUCTURAL SHEATHING S A ANT OR ADHESIVE SEALANT ADHESIVE OR GASKET SILICON SEALANT THIN PIROFILE STRUCTURAL (LEAVE WEEP OPENING SHEATHING AS DRAFTSTOP BEHIND SOLID BLOCKING AS DRAFTSTOP F TO DRAIN VOID SPACE) TUB CONTINUOUS UP WALL (SEAMS/JOINTS SEALED WITH F ADHESIVE OR SEALANT. BLOCKING EXTERIOR SHEATHING CAULKED, GLUED OR RIGID INSULATION EXTENDS FULL LENGTH OF SEALED TO TOP PLATE THIN PROFILE STRUCTURA HEATHING AS BULKHEAD AND ENDS AS DRAFTS 0 BEHIND TUB CONTINUOUS BEAD OF THIN PROFILE APPROPRIATE TAPED OR SEALED JOINTS IN EXTERIOR SHEATHING SEALANT OR ADHESIVE STRUCTURAL GYPSUM BOARD JOINT TAPED OR SEALED JOINTS IN EXTERIOR SHEATHING C NTINUOUS BEAD OF �- FLAT BLOCKING SHEATHING AS SOFFIT & SOFFIT GYPSUM TAPED/SEALED PRIOR TO SOFFIT title __�F S LANT OR ADHESIVE DRAFTSTOP BOARD INSTALLED AFTER CONSTRUCTION EXTERIOR SHEATHING CAULKED, GLUED OR BEHIND TUB TYPICAL SEALED TO BOTTOM PLATE EA ANT, ADHESIVE OR CONTINUOUS UP PRIMARY GYPSUM BOARD GASKET WALL INSTALLATION FRAMING ADHESIVE SEALANT, ADHESIVE OR & A I R EXTERIOR SHEATHING CAULKED, GLUED OR SEALANT GASKET SEALED TO SILL PLATE INTERIOR SOFFIT CONSTRUCTED AFTER GYPSUM SEALING DETAILS SEALANT, ADHESIVE OR BOARD INSTALLED GASKET THIN PROFILE SOFFIT FRAMED AFTER GYPSUM BOARD INSTALLATION TUB FRAMING SECTION STRUCTURAL SUBFLOOR CONTINUOUS BEAD J Z BOTTOM PLATE IN ORDER TO PROVIDE AIR FLOW RETARDER SILL PLATE INSTALLED OVER SILL SEALER FLAT BLOCKING ALLOWS CAVITY INSULATION TO BE SHEATHING OF SEALANT OR OF EXTERIOR CONTINUITY INSTALLED BEHIND TUB DRAFTSTOP ADHESIVE AT WALL NOTE: CEMENT BOARD TILE BACKING IS RECOMMENDED IN CONTINUOUSBEAD BOTTOM PLATE & SHADED COMPONENTS DESIGNATE AIR FLOW RETARDER PLACE OF GREEN BOARD OF SEALANT OR SIDES OF STUDS + drawn by: --- SYSTEM CEM,ENT BOARD IS NOT WATERPROOF. IT MUST BE ADHESIVE CORNER BEAD EDGE checked by: COATED WITH A FLUID APPLIED WATERPROOFING SUPPCRT FOR THIN SEALANT, ADHESIVE PROFILE STRUCTURAL scale: SEALING & OR GASKET SHEATHING24 TUB FRAMING ELEVATION27 INTERIOR SOFFIT DETAILS 15 EXT. AIR BARRIER @ EXT. SHEATHING 18 TUB FRAMING SECTION 21 TUB FRAMING PLAN project number: 10002 Q EEBA FIG. 3.5 EEBA FIG. 11.30 EEBA FIG. 11.32 EEBA FIG. 11.37/11.38 o EEBA FIG. 11.31 sheet number scaled inch U O U BUILDING A Z a a C 1T Zl 31 41 + + 7T +8 49H • 02 o I 1 N V' ROOF FLASHING BRICK VINYL, ALUMINUM, WOOD & ° STUCCO CLADDINGS-ALL ARE SOLID BLOCKING AS DRAFTSTOP INHERENTLY PRONE TO RAINWATER LEAKAGE & SHOULD BE CONSIDERED POROUS QINSULATION PILLOW 9CUT BATT WINDOWS & DOORS INSULATION SLIGHTLY 0'✓ERSIZED B EATTY HARVEY COC O SHOULD BE CONSIDERED & PLACE IN PLASTIC BAG VENT STACK A R C H I T E C T S , L L P POROUS TO RAIN CREATING A PILLOW NEW YORK I MARYLAND HOUSEWRAP INSTALLED CEILING PLYWOOD ACCESS INSULATION DAM WITH zi 1300 Walt Whitman Road, New York, 11747 A SHINGLE FASHION TO CREATE GYPSUM DOOR FACED WITH CELLULOSE INSULATION ONLY �A p: (631)300-1010 RAINWATER DRAINAGE PLANE BOARD "� GWB ( TO INTERIO owner/developer FLASHING INSTALLED AT FACE) CONCRETE SLAB Conifer Realty PENETRATIONS 1000 University Avenue Suite 500 DRAINAGE PLANE WRAPPED POLYETHYLENE VAPOR AROUND PENETRATIONS & FOAM SEALANT AROUND Rochester, NY 07 OPENINGS ALL PIPE PENETRATIONS BARRIER 585.324-05-0500 GASKET WEATHERSTRIP GRANULAR DRAINAGE THROUGH RIM CLOSURE RIM CLOSURE CASING TRIM INSTALLED OVER ATTACHED TO HATCH [PAD (COURSE civil engineer / GRAVEL, NO FINES) GYPSUM BOARD OVERLAP o PERFORATED DRAIN 43L MA OPENING " TO PROVIDE LIP FOR / PANEL TO SIT 405 PIPE ADDED TO "T" South Country Road SEALAN�AT�� IN ORDER TO Brookhaven, NY 11719 /FLASHING AT BASE OF EXTERIOR WALL ALL SLAB COUPLE SUBSLAB 631.286.8668 WALL TO DIRECT PENETRATIONS PRESSURE FIELD TO RAINWATER TO EXTERIOR INTERIOR WALL VENT STACK m.e.p. &f.p. INTERSECTING WITH SOIL GAS VENTILATION SYSTEM EXTERIOR WALL WE Engineering, P.E. GRANULAR DRAINAGE PAD DEPRESSURIZED B THIS APPROACH MAY ELIMINATE THE NEED FOR ADDITIONALBY ACTIVE FAN LOCATED IN ATTIC OR BY I-B 150 North Chestnut Street BATT INSULATION TO INTERIOR INTERIOR SOFFIT FOOTPRINT AGAINST EXTERIOR WALL f Rochester, NY 14604 ALTERNATELY, INTERIOR SOFFIT CAN BE CONSTRUCTED PASSIVE STACK ACTION OF WARM VENT 585.288.5590 AFTER GYPSUM BOARD INSTALLATION STACK LOCATED INSIDE HEATED SPACE. AVOID OFFSETS OR ELBOWS IN VENT STACK TO MAXIMIZE AIR FLOW structural engineer TDM Consulting Engineering 28 DRAINAGE PLANEr-31-" RIM PENETRATION DETAIL 34 ATTIC ACCESS DETAIL 550 North County Road,Suite E 37 INTERIOR SOFFIT DETAIL 4o RADON VENT DETAIL Saint James, NY 11780 SCALE:1"=1'-0" EEBA FIG. 13.1 EEBA FIG. 11.44 EEBA FIG. 11.40 EEBA FIG. 7.6631.686.5 34 SCALE:1"=1'-0" FLUE PIPE SOLID BLOCKING AS DRAFTSTOP JAMB FLASHING AT BOTH SIDES PLUMBING VENT OR (SEAMS/JOINTS SEALED WITH key OF OPENING, EXTEND BEYOND SEALANT APPLIED ELECTRICAL WIRES ADHESIVE OR SEALANT) { TRUE SILL FLASHING & ABOVE WHERE O ALL JOINTS CAULK/SEAL/FOAM AROUND ALL PIPES OR NORTH HEAD FLASHING WILL INTERSECT. MASTIC OUTSIDE FRAME BLOCKING r ELECTRICAL WIRES PENETRATING INTO ATTIC LAP JAMB FLASHING OVER TOP SPACES OR OTHER INSULATED CEILINGS OF SILL FLASHING LEAVING CUT HOLES SUFFICIENTLY BOTTOM EDGE UNATTACHED. 1 " MINIM LARGER THAN PIPE TO WALL SHEATHING ALLOW INSTALLATION OF 0 ° _ SEALANT _ 1 " MINIM M SEALANT APPLIED TO TOP 1 OF FRAME O VENT PIPE MAY BE SEALANT, ADHESIVE OR SEALANT, ADHESIVE OR GASKET SEALANT, ADHESIVE OR VACUUM RELIEF VALVE IN DRAFTSTOP W/ GASKET (EPDM CEILING GYPSUM BOARD ELIMINATED WITH A GASKET SERVICE OPENING SEALED TO _ `\- GASKET SOME JURISDICTIONS C-AIR HANDLER AIR SEALING EXTERIOR WALL BOOT) OR EXPANDING FOAM MASTIC UTILITY CHASE project FLUE PIPE VINEYARD VIEW � OSB OR PLYWOOD HIGH TEMPERATURE TWO HALVES OF FIRESTOP KEEP PLUMBING PIPES D 16" MINIMUM B-RIGID DUCT SEALING SEALANT NAILED IN PLACE OUT OF EXTERIOR WALLS D MASTIC o ' County Road 48 4-1 e INTERIOR PLUMBING WALL Greenport, NY 11944 12" MINIMUM . `- CAULK/SEAL/FOAM ALL PIPES PENETRATING seal FOLD JAMB FLASHING INTO VENTED CRAWL SPACES OR INTO GARAGES AROUND SIDE OF ROUGH SEALANRED ARS' DRAINA LAN 1RST OPENING AND OVER LOCATING PLUMBING PIPES ��S�P�ORE G co%� CO UPTURNED SILL FLASHING WHERE CONNECTIONS ARE MADE TO TOILETS, PEDESTAL SINKS & EXPOSED PIPING, CHROME PLATED OR OTHER SURFACE FINISHED THIS APPROACH MAY ELIMINATE THE NEED FOR ADDITIONAL CEILING GYPSUM BOARD A-FLEX-TAKE OFF FROM RIGID AIR SEALING MATERIALS SHOULD BE CONSIDERED FOR AESTHETIC REASONS SEALANT ADHESIVE OR I BATT INSULATION TO INTERIOR SEALANTS SHOULD BE FLEXIBLE, NON-HARDENING GASKET DOUBLE WALL FOR UTILITIE 2 i 4'ty0P� �4�bF NE`N 29 JAMB FLASHING DETAILr-32` DUCT SEALING DETAIL 35 FLUE DETAILr3i-�PLILIMBIING PIPE DETAIL 41 CHASE DRAFTSTOPPING DETAIL E EEBA FIG. 2.4 EEBA FIG. 12.12-.14 EEBA FIG. 11.36 SCALE:1" EEBA FIG. 13.2 E issued date description + EEBA FIG. 11.41 1 03/15/19 Issued for Construction CAULK/SEAL/FOAM ALL ELECTRICAL WIRES PENETRATING INTO ATTIC SPACES OR OTHER AIR BARRIER SEALED TO INSULATED CEILINGS BUILT-IN SEAL AT WIRE -LANCE FOR SEALING TO FLANGE ON AIRTIGHT ENTRANCE DRYWALL AIR BARRIER OUTER BOX GASKET BUILT INTO BOX SOLID BLOCKING AS \�l RATED SEALANT AS PERo CAULK/SEAL/FOAM ALL DRAFTSTOP DRYWALL ELECTRICAL WIRES PENETRATING ELECTRICAL CODE (SEAMS/JOINTS SEALED REQUIREMENTS SPECIAL AIR SEALING BOX STANDARD ELECTRICAL BOX INSIDE TOP & BOTTOM PLATE OF WITH ADHESIVE OR NAILING FLANGE EXTERIOR WALL SEALANT) 0 CONDUIT SEALED INSIDE & SPECIAL AIRTIGHT BOX RUN WIRING ALONG SIDE OF �- 0 WHERE IT PENETRATES CONTAINING STANDARD BOXES STUD AT EXTERIOR WALL -'F 0 0 SUPPORT SHEATHING POLYETHYLENE AIR BARRIER CAULK/SEAL/FOAM ALL SEALANT ADHESIVE OR---/'o SEALANT, ADHESIVE OR ELECTRICAL WIRES PENETRATING GASKET GASKET0 0 RATED SEALANT AS PER CAULK AT ALL WIRE INTO EXTERIOR WALL ELECTRICAL CODE PENETRATIONS SEALANT OR ADHESIVES SEALANT OR ADHESIVE p 0 REQUIREMENTS title RUN WIRING ALONG BOTTOM 0 SEAL FACE TO DRYWALL W/ JOINT CONVENTIONAL METAL OR PLATE AT EXTERIOR WALL TYPICAL DROPPED CEILING DUCTWORK COMPOUNC OR WITH CAULKED FOAM PLASTIC SUPPORT SHEATHING FRAMING COVERPLA-E GASKET SPECIAL AIR SEALING o STANDARD PLASTIC o INSERT EXTERIOR WALL INTERIOR WALL FRAMING & A I R ELECTRICAL BOX �- � o CAULK/SEAL/FOAM ALL SEALING DETAILS SPECIAL AIR BARRIER TO ELECTRICAL WIRES FLANGE ON INSERT PENETRATING INTO VENTED CRAWL SPACES WIRE SEALING ELECTRICAL WIRES C WIRES SHOULD BE LOCATED ALONG PLATES OR AGAINST STUDS RATHER THAN o RUN LOW VOLTAGE WIRES IN PLASTIC CONDUIT TO ALLOW FOR FUTURE UPGRADE OR SERVICE drawn by: --- THROUGH THE CENTER OF INSULATED CAVITIES TO MINIMIZE INSULATION CAULK AT ALL OPENINGS SOME CODES REQUIRE WIRES TO BE HELD UP FROM BOTTOM COMPRESSION WHERE BATT INSULATION IS USED (FIGURE 15.2) PLATES 6" TO 8" TO PROTECT WIRES FROM FUTURE DRILLING OF checked by: --- HOLES THROUGH PLATES scale: AS NOTED 30 DROPPED CEILING DETAILr3-3-'N ELECTRICAL PANEL DETAIL 36 ELECTRICAL BOX DETAIL 39 ALT. ELECTRICAL BOX DETAIL} 42 ELECTRICAL WIRE SEALING project number: 10002 EEBA FIG. . EEBA FIG. 14.1 EEBA FIG. 14.2 Q 1139 EEBA FIG. 14.3 scaled inch o sheet number U O U BUILDING A z a 9 -zi + - N BACK OF BATT SPLIT PROPERLY AROUND WI A ) 404 , CAVITY INSULATION JOINT BETWEEN BOOT & SUBFLOOR SEALED W/ MASTIC OR FIBERGLASS MECH & MASTIC OR CAULK BEATTY HARVEY COCO FLOOR BOOT AIR SEALING ARCHITECTS , LLP MASTIC NEW YORK I MARYLAND ljv�' STIC 1300 Walt Whitman Road, New York, 11747 p: (631)300-1010 GAP FROM COMPRESSED owner/developer CAVITY INSULATION Conifer Realty 1000 University Avenue Suite 500 WIRE INSTALLED TOO HIGH Rochester, NY 14607 OR WRAPPED IN FRONT 585.324-0500 IN BETWEEN BOOT & SUBFLOOR AFTER INSULATION CEILING BOOT AIR SEALING SEALED W/ MASTIC OR FIBERGLASS CAVITY INSULATION civil engineer MECH & MASTIC OR CAULK NOTCH CUTIN BOTTOM OF LKMA STUD (SEE NOTE BELOW) 437 &405 South Country Road MASTIC Brookhaven, NY 11719 631.286.8668 m.e.p. &f.p. WE Engineering, P.E. —J B 150 North Chestnut Street RIGID TO FLEX AIR SEALING ALTERNATE WIRING WITH BATT INSULATION DETAIL �— Rochester, NY 14604 585.288.5590 NOTE: SOME CODES REQUIRE WIRES TO BE HELD UP FROM BOTTOM PLATE 6" TO 8" TO PROTECT WIRES FROM FUTURE DRILLING OF HOLES THROUGH PLATE structural engineer TDM Consulting Engineering 550 North County Road,Suite E K-4-3-' DUCT SEALING DETAIL 46 WIRING IN BATT INSULATION Saint James, NY 11780 631.686.5234 EEBA FIG. 12.15-17 EEBA FIG. 15.2 key TRUE NORTH CL PLUMBING VENT RUBBER GASKET 11 STAPLES CUT HOLE IN GASKET JUST SMALLER THAN PIPE ° ULK OR SEALANT — O �i O project SEALANT BETWEEN GASKET VINEYARD VIEW \ & PLATE WALL TOP PLATE +1D County Road 48 Greenport, NY 11944 PREFABRICATED ROOF VENT PIPE FLASHING CAN BE ADAPTED TO USE AS seal AIR—SEALING GASKETS ��RED ApC OREG. p /fin O � Q OF NE`s K44" ROOF VENT PIPE FLASHING EEBA FIG. 13.3issued date description —� 1 03/15/19 Issued for Construction GRILLE LOCATED HIGH IN WALL ON BEDROOM SIDE TO AVOID BLOCKAGE BY FURNITURE F 4 CAVITY IS SEALED TIGHT. DRYWALL GLUED TO STUDS & PLATES ON BOTH SIDES 1101 title TYPICAL GRILLE LOCATED LOW IN FRAMING & A I R WALL ON HALLWAY SIDE SEALING DETAILS �— drawn by: -- checked by: --- CL scale: AS NOTED J 45 TRANSFER GRILL DIAGRAM protect number: 10002 scaled inch Q EEBA FIG. 12.26 sheet number 0 0 O z BUILDING A @ 4H A7904m o _ :1 5E) DOOR SCHEDULE DOOR DOOR FRAME FIRE HARDWARE / / \ / / \ TYPE ROOM NAME WIDTH HEIGHT THICKNESS MATERIAL MATERIAL HEAD JAMB THRESHOLD RATING SET REMARKS . a F131 Lam"I ta UENTRY T-0" 6-8" 1%" FIBERGLASS FIBERGLASS H3 J3 T3 NONE 511 *CLASSIC-CRAFT AMERICAN STYLE COLLECTION O 4 CCA1127-DDBF4 BY THERMA TRU OR EQUAL INTERIOR ENTRY T-0" 6'-8" 1%" HC MOLDING WD H1 A T9 NONE 301 B E A T T Y HARVEY COC O *SERIES SGD5570 IMPACT VINYL SLIDING GLASS DOOR A R C H I T E C T S , L L P DECK 6'0" 6'-8" 13/" VINYL VINYL H4 J4 T4 NONE 901 BY PGT INDUSTRIES OR EQUAL NEW YORK I MARYLAND � *SERIES FD5555 IMPACT VINYL FRENCH DOOR PATIO 6'0" 6'8" 13/" VINYL VINYL H9 J9 T11 NONE 901 BY PGT INDUSTRIES OR EQUAL*ANSI 2009 COMPLIANT SILL 1300 Walt Whitman Road, New York, 11747 A 0 p: (631)300-1010 `� ` © UTILITIES T-0" 6'-8" 1 3q" INSUL.H.M. H.M. H3A J3A T3 NONE 734 owner/developer UTILITIES (2)3'-0" 6'-8" 1%" INSUL.H.M. H.M. H3A J3A T3 NONE 774 Conifer Realty \ OE BEDROOM T-0" 6'-8" 1%" HC MOLDING WD H1 A T6/T9 NONE 401 1000 University Avenue Suite 500 \ \ / OF BATHROOM 3'0" 6'.8" 1%" HC MOLDING WD H1 J1 T2 NONE 401 Rochester, NY 14607 585.324-0500 \ G1 BULK STORAGE 3'-0" 6'-8" 13/" HC MOLDING WD H1 J1 T9 NONE 301 L"__J L�4 LL4 HO MECH.CLOSET 2'-6" 6'-8" 1%" HC MOLDING WD H1 A T9 NONE 701 civil engineer LKMA J1 COAT CLOSET 3'0" 6'-8" 13/" HC MOLDING WD H1 A T9 NONE 301 437 &405 2'-6" �, 54" 2'-0_ 4'-0" J2 COAT CLOSET (2)2'-6" 6'-8" 1%" HC MOLDING WD H1 A T9 NONE 261 South Country Road Brookhaven, NY 11719 J3 COAT CLOSET 2'-6" 6'-8" 1%" HC MOLDING WD H1 A T9 NONE 301 631.286.8668 K1 CLOTHES CLOSET 34" 6'-8" 1%" HC MOLDING WD H1 A T9 NONE 301 m.e.p. &f.p. A2 OE �F G1 J1 K1 H� J3 J2 © O K2 CLOTHES CLOSET (2)2'-0" 6'-8" 1%" HC MOLDING WD H1 A T9 NONE 261 WE Engineering, P.E. © LINEN CLOSET 2'-0" 6'-8" 1%" HC MOLDING WD H1 J1 T9 NONE 301 150 North Chestnut Street Rochester, NY 14604 585.288.5590 DOOR NOTES. r2_'\� INTERIOR DOOR TYPES structural engineerTDM Consulting Engineering CONTRACTOR TO PROVIDE ALL LABOR,MATERIALS, EQUIPMENT AND SERVICES REQUIRED TO PERFORM WORK 550 North County Road,Suite E A8.00 SCALE: 112"= V-0" INCLUDING BUT NOT LIMITED TO THE FOLLOWING: Saint James, NY 11780 REFER TO THE FOLLOWING SPECIFICATIONS FOR ADDITIONAL INFORMATION: 631.686.5234 3'-7" � 6'-7" 6'-T � 3'-7" 6'_7" -IMPACT VINYL SLIDING DOOR -IMPACT VINYL SWING DOOR \ -HOLLOW METAL DOORS AND FRAMES -FINISH HARDWARE FLUSH WOOD DOORS key TRUE HARDWARE NORTH 1. ALL DOOR HARDWARE SHALL BE PROVIDED AND INSTALLED BY CONTRACTOR U.O.N. C l_ / \ / / \ 2.CONTRACTOR SHALL COORDINATE ALL KEYING WITH OWNER. BUILDING TO BE SUPPLIED + \\ // // \\ WITH A MASTER KEY SYSTEM. 3.ALL HARDWARE TO BE INSTALLED PER ANSI&ADA STANDARDS. C� DOORS(HOLLOW CORE WOOD&HOLLOW METAL) o / N / \ 1.ALL DOORS SHALL BE PROVIDED AND INSTALLED BY CONTRACTOR U.O.N. co CD D co 2.THE CONTRACTOR SHALL PROVIDE PROTECTION FOR ANY AND ALL DOORS INSTALLED PRIOR TO SUBSTANTIAL COMPLETION.PROTECT FROM ANY DAMAGE BY TRADESMEN OR OTHER WORK BEING o Oo DONE THROUGHOUT THE BUILDING. 3.ALL NON-RATED STANDARD WOOD DOORS TO BE HOLLOW CORE(H.C.W.) 4.ALL WOOD DOORS SHALL BE PRE-FINISHED. FINISH TO BE SELECTED BY THE ARCHITECT. ALL WOOD DOORS(FLUSH AS WELL AS PANEL DOORS)ARE TO HAVE MATCHING SPECIES AND FINISH. 5.ALL H.M.DOORS ARE TO BE FACTORY PRIMED AND FIELD PAINTED. COLOR TO BE SELECTED BY ARCHITECT. project 6.ALL EXTERIOR GLAZED DOORS WITHIN 30'OF GRADE SHALL MEET THE REQUIREMENTS / \ / OF THE LARGE MISSILE TEST OF ASTM E 1996. VINEYARD VIEW T-0" 22' %'�, 6'4" A, �Y2 6'-0" ��'�, �/2'� T-0" %'I Lni 6'-0" �Y FRAMES(WOOD&H.M.) D 1 '� 'r- II ALL DOOR FRAMES SHALL BE PROVIDED AND INSTALLED BY CONTRACTOR U.O.N. 2.THE CONTRACTOR SHALL PROVIDE PROTECTION FOR ANY AND ALL DOOR FRAMES INSTALLED PRIOR TO County Road 48 SUBSTANTIAL COMPLETION. PROTECT FROM ANY DAMAGE BY TRADESMEN OR OTHER WORK BEING DONE Greenport, NY 11944 THROUGHOUT THE BUILDING.DAMAGE FRAMES WILL BE REPAIRED OR REPLACED BY THE CONTRACTOR AT (/kDi 61 g2 © O THE CONTRACTOR EXPENSE. seal 3.ALL WOOD FRAMES SHALL BE FACTORY PRIMED.ALL FRAMES TO BE FIELD FINISH PAINTED. 4.ALL H.M.FRAMES ARE TO BE FACTORY PRIMED AND FIELD PAINTED. COLOR TO BE SELECTED BY OWNER. �(lED AFDC, 5.ANY H.M.FRAMES THAT ARE ANCHORED WITH A PUNCH&DIMPLE SHALL BE FILLED PRIMED AND PAINTED �g SCR GFLUSH TO FRAME SURFACE. 'Sj) 1 EXTERIOR DOOR TYPES 6.ALL INTERIOR APARTMENT DOOR FRAMES TO RECEIVE WOOD TRIM ON BOTH SIDES PRIMED AND PAINTED A8.00 SCALE: 1/2"= 1'-0" s�9 0Q X22 yOQ " S OF INI E issued date description 1 03/15/19 Issued for Construction + title DOOR SCHEDULE & TYPES G drawn by: --- checked by: --- scale: AS NOTED N project number: 10002 scaled inch Q 0 sheet number U O U z BUILDING A m I 1 I LI + + + gl 9 H A8 * 00 a' + 1 f N M O ft,s } ?� �sa"�?»�� 'gym+�«�'� y�•yh. BEATTY HARVEY COLO A R C H I T E C T S , L L P NEW YORK I MARYLAND 1300 Wait Whitman Road, New York, 11747 p: (631)300-1010 owner/developer Conifer Realty 1000 University Avenue Suite 500 Rochester, NY 14607 585.324-0500 .032"20GA.ALUMINUM CONTINUOUS BREAK METAL DRIP civil engineer EDGE WITH KYNAR 500 FINISH,MINIMUM 4"UP SIDING. LKMA 437 &405 South Country Road Brookhaven, NY 11719 5/4 x 3y"HARDIE TRIM BOARD 631.286.8668 HOLLOW METAL DOOR m.e.p. &f.p. HEADER WITH RIGID INSULATIO PER SCHEDULE DROPSEAL WE Engineering, F.E. PEMKO 360 B 150 North Chestnut Street VINYL IMPACT FRENCH DOOR HEADER Rochester, NY 14604 ALUM.SADDLE 585.288.5590 THRESHOLD-PEMKO 1665 HEAD H-7 ' VINYL PLANK OR VCT 2X4 WOOD STUD PARTITION C NCRETE l _ AT UNIT ORS RVICEg structural engineer AREAS OR STAIRS TDM Consulting Engineering 550 North County Road, Suite Saint James, NY 11780 HEADER WITH RIGID INSULATION 631.686.5234 PER SCHEDULE _ THRESHOLD T-10 CONCRETE TO VRFNCT HOLLOW METAL DOOR key 0 DROP SEAL PEMKO 360 TRUE ALUM.SADDLE NORTH C .032"20GA ALUMINUM CONTINUOUS THRESHOLD-PEMKO 1665 BREAK METAL DRIP -C EDGE WITH KYNAR 500 FINISH,MINIMUM 4"UP SIDING. a< O ❑ 514 x 3,�"HARDIE TRIM BOARD VINYL PLANK OR VCT l VINYL IMPACT FRENCH DOOR HEADER JAMB J-7 THRESHOLD T-9 ° 0 2X6 WOOD STUD PARTITION VRFNCT TO VRFNCT INSULATED LOW-E GLASS PER SPEC, VINYL IMPACT SCHLUTER EDGE ALUM.DOOR project FRENCH DOOR PROTECTION- TYPE SCHIENE 6"DEEP ANSI SLOPED VINYL PLANK AT AE1251/2"OR THRESHOLD NOT TO VINEYARD VIEW LIVING ROOMS APPROVED EQUAL EXCEED 1/2"(PEMKO 256 CONTINUOUS ALUMINUM OR APPROVED EQUAL) CONCEALED FLASHING, TINISHS PER MACHINE SCREW D TYPICAL. FASTENER AND (PATIO) SCHEDULE THREADED ANCHOR D INSERT GROUT ALUM. GROUTALUM. County Road 48 THRESHOLD SOLID /I THRESHOLD SOLID Greenport, NY 11944 INSULATION AT .,{�,•,:,�;- •��;, ),•i�, k .,; INSULATION AT THERMAL BREAK;SEE ;;;s:: `;3:;. ;:r;;..• `;'.+ v-THERMAL BREAK;SEE seal WALL SECTIONS WALL SECTIONS p�E D A �o E THRESHOLD T-11 THRESHOLD T-8 EXTERIOR-PATIO EXTERIOR-STOREFRONT V.I.F. - SEE V.I.F. FLOOR - SEE PLAN T Q, 21422 PLANS O 2x4 WOOD FRAMING 2x4 WOOD FRAMING- SOF NE`N� CONTINUOUS SOUND I .032"20GA.ALUMINUM CONTINUOUS ATTENUATION INSULATION BREAK METAL DRIP 032"20GA.ALUMINUM CONTINUOUS IF REQUIRED SEE BREAK METAL DRIP issued date descri tion PARTITION TYPE SEE PARTITION TYPE EDGE WITH KYNAR 500 2x4 WOOD FRAMING- i E p ORD 5/8"GYPSUM FINISH,MINIMUM 4"UP SIDING. EDGE WITH KYNAR 500 CONTINUOUS SOUND -r (1)LAYER 518"TYPE'X' I BOARD(BOTH SIDES) FINISH,MINIMUM 4"UP SIDING. 2x6WOOD FRAMING ATTENUATION INSULATION IF GYPSUM BOARD SEE STRUCTURAL R-20 BATT INSULATION REQUIRED SEE PARTITION 1 03/15/19 Issued for Construction (BOTH SIDES) DRAWINGS FOR II CONTINUOUS ALUMINUM CONCEALED TYPE PE SEE STRUCTURAL DOOR HEADER COUNTER FLASHING,TYPICAL. (1)LAYER 518"GYPSUM DRAWINGS FOR DOOR PRESSED HOLLOWS 5/4 x 3Yz"HARDE TRIM BOARD (1)LAYER 518"GYPSUM BOARD(60TH SIDES) HEADER z METALDRYWALL FRAME 5/4 x 3Y"HARDIE TRIM BOARD 5/4 x 3Yz"HARDIE TRIM BOARD BOARD(BOTH SIDES) SHIM AS NECESSARY N SCHEDULED N 032"20GA.ALUMINUM CONTINUOUS CONTINUOUS HEAD N DRAWINGS FOR DOOR HEADER SEE UCTURAL SEE STRUCTURAL DRAWINGS FOR DOOR BREAK METAL DRIP _ _ STIFFENER- u�oo HEADER ALUMINUM DOOR [ .� EDGE WITH KYNAR 500 °J 2" 2' / WOOD DOOR FRAME- HEADERWITH P,IGID INSULATION PRIMED AND PAINTED FRAME INTEGRAL WITH c, FINISH,MINIMUM 4"UP SIDING. HEADER WITH RIGID INSULATION PRESSED HOLLOW METAL STOREFRONT SYSTEM PER SCHEDULE PER SCHEDULE DRYWALL FRAME AS HEAD H-5 HEADER WITH RIGID INSULATION SCHEDULED CONTINUOUS HEAD— 2X4 WOOD STUD PARTITION PER SCHEDULE CONTINUOUS HEAD <v _ STIFFENER '2 �r STIFFENER ALUMINUM STOREFRONT HEAD H-3 r° 2 11 4 2 SYSTEM AT TRANSOM (1 VINYL SLIDING DOOR WITH INSULATED A HEAD H-6 610ARD(BOTH SIDES)M 2 LOW-E GLASS.REFER TO ELEVATIONS. 2HEAD H D P PARTITION 2 D PARTITION ALUMINUM STOREFRONT (2)2X4 HEAD H-4 HEAD H-2 HEAD H-1 SYSTEM AT WALL PRESSED 2X6 WOOD PARTITION ALUMINUM DOOR-\ _ - HOLLOW METAL 2 6 W D TUD PARTITION 2X4 WOOD STUD PARTITION PFRAME I b L wTJTH w Z w DRYWALL FRAME ORENFUM SYS EM > I N AS SCHEDULED WOOD DOOR AOOR STOP RANI �- (4)JAMB -- - — PRIMED AND PAINME ANCHORS PER PER A 1 LAYER 518"G M 2 N RA R-20 BATT INSULATION GYPSUM BOARD Z JAMB ANCHORS PERF ME R-20 BATT INSULATION ( ) (BOTH SIDES) F I ARD BOTH SIDE � ( ) i w p_ CONTINUOUS SOUND >N INSULATION IF REQUIRED R-20 BATT INSULATION 514 x 3y"HARDIE TRIM BOARD N SEE PARTITION TYPE w-2)2X6 SE� 2 .032"20GA.ALUMINUM CONTINUOUS RRELOW M TALL 5/4 x 3y"HARDIE TRIM BOARD .032"20GA.A-UMINUM CONTINUOUS ¢ RYWALL RAIv1E (1)LAYER 518"TYPE JAMB J-5 BREAK METAL DRIP > BREAK METPL DRIP EDGE WITH KYNAR 500 AS SCHEDULED X GYPSUM BOARD EDGE WITH NYNAR 500 IE7 (60TH SIDES) g 2X4 WOOD STUD PARTITION FINISH,MININUM 4'UP SIDING, M RS P 4 A , FINISH,MINIMUM 4"UP SIDING. ER SHIM AS ALUMINUM&GLASS JAMB J-3A JAMB J-3 c� AM�II4 JAMB 2X4W006F OIN title NECESSARY DOOR 2X6 WOOD STUD PARTITION 5/4 x 3%"HARDIE TRIM BOARD R-20 BATT INSULAT N CH R�PER ATTENUATION INSULATION IF ALUMINUM STOREFRONT DOOR JAMB AND DOOR JAMB J-6 JAMB ATSIDELITE 1 15/1J B WIDTH V R S 6, STOP BEYOND .032"20GA.ALUMINUM CONTINUOUS JAMB J-4 REQUIRED SEE PARTITION TYPE ALUMINUM STOREFRONT DOOR;SEE DOOR EDGE WITH KYNAR 500 BREAK METAL DRIP JA WIDTH V RES DOOR JAMB AND SYSTEM JAMB AT WALL ARI 2X6 WOOD STUD 1 15/16" V 1 15/16" JAMB J-1 129/6 I' 9/64',/, - OP BEYOND SCHEDULE FINISH,MINIMUM 4"UP SIDING. JAMB J-2DETAILS VARIES---,'/' DOOR;SEE DOOR CERAMIC OR V -�V�� " 2X6 WOOD STUD PARTITION 2X4 WOOD STUD PARTITION SCHEDULE ORCELAIN TILE;SEE 6"DEEP ANSI INSULATED 6"DEEP ANSI INSULATED CERAMIC OR HOLLOW METAL DOOR a"PLYWOOD SUBFLOOR SLOPED THRESHOLD SLOPED THRESHOLD ORCELAIN TILE;SEE FINISH SCHEDULE HM OR FIBERGLASS DOOR �HM OR FIBERGLASS DOOR POWER COATED ALUMINUM NOT TO EXCEED 112" NOT TO EXCEED 1!2" �INISH SCHEDULE DROP SEAL (PEMKO 271 OR (PEMKO 271 OR MARBLE SADDLE IN RAILING SYSTEM TOILET RM. CONT.RUBBER CARPET PEMKO 360 ¢ N APPROVED EQUAL) MACHINE SCREW APPROVED EQUAL) MACHINE SCREW DOOR TRANSITION STRIP !� MARBLE SADDLE IN = SETTING BED CONTINUOUS ALUMINUM FASTENERAND FASTENER AND DOOR U D SETTING BED ALUM.SADDLE U O CONCEALED FLASHING0 ALIGN SADDLE WITH ,TYPICAL. CONCRETE FINISH THREADED ANCHOR CONCRETE FINISH THREADED ANCHOR Lil Y FACE OF DOOR WITH DRAME THRESHOLD-PEMKO Q FACE OF DOOR FRAME 2x8 LEDGER BOARD / + drawn by: --- a� 1:) ALIGN SADDLE INSERT � INSERT MARBLE SADDLE Z iL Z FASTENED TO RIM JOIST. AS PER SCHEDUL AS PER SCHEDUL CERAMIC OR VINYL SHEET MATERIAL OR VCT PORCELAIN VINYL SHEET MATERIAL CERAMIC OR C RPET VINYL PLANK OR VCT = -' :«t,J :yi' S•a LVT OVER 1/8"THK FOAM \,_ ,,,,:. �.. 3:;.,�.. •.,,f ORCELAIN TILE;SEE AT UNIT OR SERVICE ,�;..'.�,,.•:::;•. ; +":.'•'w^ ` • 18"RIM JOIST FLOOR TILE OR VCT ROUT ALUM. ROUTALUM. ~� OR PORCELAIN UNIT CARPET .;+".. ; irL'':::.:)' ''' �HRESHOLDSOLID �HRESHOLDSOLID _ checked by: --- 01 V F L N FINISH SCHEDULE a AREAS OR STAIRS ;;<' , ,., AND CORK UNDERLAYMENT; y' CL CONCRETE SLAB-SEE �4-� •• � SEE FINISH SCHEDULE ''•: ` '.;�; ' '' '`�;' '• = = . ° a, ' F. i:,.. : -.. �:..'•:x',::',,.. .. scale: AS NOTED _.. PLA L 18"ENGINEERED ^`'� '�� INSULATION AT `.''•''i`: '3• : ,: INSULATION AT DRAWINGS CONCRETE SLAB-SEE E> y , 4 �HERMAL BREAK;SEEHERMAL BREAK;SEE 0 MARBLE SADDLE-TILE/TILE STRUCTURAL WALL SECTIONS WALL SECTIONS number: 10002 z THRESHOLD T-7 THRESHOLD T-6 THRESHOLD T-5 DRAWINGS WOOD FLOOR TRUSS THRESHOLD T-4 THRESHOLD T-3 THRESHOLD T-3 THRESHOLD T-2 project scaled inch THRESHOLD T-1 U TILE/TILE CARPET TO VRFNCT MARBLE SADDLE-TILE/LVT Q BALCONY EXTERIOR EXTERIOR MARBLE SADDLE VINYL O sheet number U O U BUILDING A z 1 DOOR DETAILS �-oSCALE: 1 1/2" = 1'-0" co 2+- + + +6 �- HA8e00A iJ 9 o rn + 7 2X6 WOOD STUDS WITH PAINTED POPLAR WOOD 2X6 WOOD STUDS WITH PAINTED POPLAR WOOD o R-21 BATT INSULATION SILL: COLOR AS R-21 BATT INSULATION SILL: COLOR AS '- CONTINUOUS VAPOR SELECTED BY OWNER. CONTINUOUS VAPOR SELECTED BY OWNER. WINDOW SCHEDULE BARRIER AND%"GYP.BD. BARRIER AND 4"GYP.BD. NOMINAL WINDOW ACTUAL WINDOW ROUGH OPENING CLEAR OPENING VISIBLE GLASS TOTAL SIZE SIZE SIZE SIZE CLEAR PER OPENING VISIBLE WINDOW OPENING R �r \ / TYPE MANUFACTURER MODEL UNIT TYPE WIDTH HEIGHT WIDTH HEIGHT WIDTH HEIGHT WIDTH HEIGHT SQ.FT. WIDTH HEIGHT GLASS FT REMARKS OA SILVERLINE V1 SERIES COASTAL WATCH SINGLE-HUNG 2'-8" x 5'-0" 313/8" x 591/4" 317/8" x 59 314" 271/16" x 2211/16" 4.27 271/16" x 2613/16" 10.08 BEATTY HARVEY COCO B SILVERLINE V1 SERIES COASTAL WATCH SINGLE-HUNG 3'-0" x 6'-0" 35 3/8" x 711/4" 35 7/8" x 713/4" 311116" x 271/2" 5.93 311/16" x 3213116" 14.16 EMERGENCY ESCAPE&RESCUE WINDOW A R C H I T E C T S L L P 0 NEW YORK I MARYLAND DOUBLEA 1 �® - - - - ® © x 5'-0" 313/8" x 591/4" 68314" x 59314" 271/16" x 2211/16" 8.54 271116" x 2613/16" 20.16 REFER TO DETAIL 6/A8.01. 1300 Walt Whitman York, 11747 SILVERLINE V1 SERIES COASTAL WATCH 2'-8" =�', SINGLE-HUNG A t p: (63R 3 0'1010 k ------------- ----- - -----------=- - _ - �, „ ,� � ,� „ owner/developer ® ------------ -- - ------------ Q OD SILVERLINE V1 SERIES COASTAL WATCH SINGLE-HUNG 2-0 x 3-0" 23318' x 351/4 23718 x 35314 191/16' x 1115/16 1.58 191/16" x 1413/16 3.92 COMPATIBLE SEALANT Conifer Realty COMPATIBLE SEALANT CONTINUOUS AIR&WATER E SILVERLINE V3 SERIES COASTAL WATCH CASEMENT 3'-0" x 4'-5" 3515116" x 5213/16" 36 7/16" x 53 5/16" 23 3/4" x 47 9116" 7.84 291116" x 4515/16" 9.27 •EMERGENCY E$CARE_&.RESC1aE�W1 1000 University Avenue Suite 500 RESISTIVE BARRIER COMPATIBLE SEALANT Rochester, NY 14607 %"X 2%"FIBER CEMENT TRIM SELF-ADHERED ICE&WATER VINYL WINDOW VINYL WINDOW 585.324-0500 BATTENS OVER;i6'PANELS MEMBRANE AT ALL TRANSITIONS, %"EXTERIOR GRADE SELF-ADHERED ICE&WATER F SILVERLINE V3 SERIES COASTAL WATCH DOUBLE 3'-0" x 4'-5" 3515/16" x 5213/16" 78 318" x 53 5116" 23 3/4" x 47 9116" 15.68 291/16" x 4515/16" 18.54 -EVE-RGENCY ESCAPE&RESCUE WINDOW COMPATIBLE SEALANT PLYWOOD SHEATHING MEMBRANE ATALL TRANSITIONS, COMPATIBLE SEALANT O CASEMENT REFER TO DETAIL 6/A8.01. CONTINUOUS AIR&WATER 514 X 3%"HARDIE TRIM BOARD --- RESISTIVE BARRIER %"EXTERIOR GRADE FIBER CEMENT LAP SIDING 514 X 3%"HARDIE TRIM BOARD © SILVERLINE V1 SERIES COASTAL WATCH DOUBLE 3'-0" x 6'-0" 35 3/8" x 71 1/4" 35 718" x 71 3/4" 31 1/16" x 27112" 11.86 31 1116" x 3213116" EMER ENCY ESCAPE&RESCUE WIND civil engineer PLYWOOD SHEATHING SINGLE HUNG LKMA NOTES: 437 &405 1. BASIS OF DESIGN IS SILVERLIIJE COASTAL WATCH. ALTERNATE MANUFACTURERS:MI,PLY GEM&PGT South Country Road Brookhaven, NY 11719 631.286.8668 8 BOARD & BATTEN - WINDOW JAMB DETAIL 7 LAP SIDING - WINDOW JAMB DETAIL m.e.p. &f.p. A8.01 SCALE: 3"= 1'-0" A8.01 SCALE: 3"= 1'-0" M E Engineering, P.E. , 150 North Chestnut Street -j= 9 Rochester, NY 14604 585.288.5590 2X6 WOOD STUDS PAINTED POPLAR WOOD structural engineer SILL: COLOR AS ® TDM Consulting Engineering CONTINUOUS VAPOR -- ¢ ¢ ¢ 550 North County Road,Suite E BARRIER AND%"GYP.BD. SELECTED BY OWNER. M 3'-2Y8" M 3'64" 6'-3Y4" Saint James, NY 1 1780 631.686.5234 I I _ key ® l NORTH C r VINYL WINDOW \ \ COMPATIBLE SEALANT v \ ^z SELF-ADHERED ICE&WATER COMPATIBLE SEALANT 19 O MEMBRANE AT ALL TRANSITIONS, %"EXTERIOR GRADE 7&8/A8.01 &8/A&01 7&8/A8.01 6 I A8.01 7&81A8.01 5/4 X 5%"HARDIE TRIM BOARD PLYWOOD SHEATHING OO 7&81A8.01 7&8/A8.01 D 4 T 6 WINDOW JAMB DETAIL /2 2 7/e /z /z 2'-7/ 5/z 2'-7Y8 /z 1 . 3 .. 1 „ 3 .. � �01SCALE: 3" = 1'-0" ' ' '- 3 " ' ' 0 a O Q T project N ® A �' 2 "�" �' .15 ® C VINEYARD VIEW I� o I I N O I c D D __________________________________ e0 o -------------- ¢ t> g t>. County Road 48 - _ r CONTINUOUS DOUBLE M o Greenport, NY 11944 2X6 TOP PLATE. 2'-6%" Q 3'-6�%e' ¢ T-0$" CONTINUOUS DOUBLE M M seal 2X6 TOP PLATE, BRED ARCy AIR SEAL ALL PERIMETERS AIR SEAL ALL PERIMETERS \ \ w�\�� ORE WITH FLEXIBLE ACOUSTICAL CONTINUOUS AIR&WATER WITH FLEXIBLE ACOUSTICAL SEALANT,TYPICAL,WITH RESISTIVE BARRIER SEALANT,TYPICAL,WITH 00 JOINT TAPE. JOINT TAPE. CONTINUOUS AIR&WATER %"EXTERIOR GRADE RESISTIVE BARRIER * , PLYWOOD SHEATHING %"EXTERIOR GRADE :7 c CONTINUOUS VAPOR 3a"X 2Y"FIBER CEMENT TRIM PLYWOOD SHEATHING 7&8/P8.01 `" 7&81A8.01 _ �� CONTINUOUS VAPOR \ _ BATTENS OVER 5t6'PANELS ® �_ �. 0 2 BARRIER AND Y8"GYP.BID. BARRIER AND%"GYP.BD. FIBER CEMENT LAP SIDING �� 7 F OF NE`N y SELF-ADHERED ICE&WATER SELF-ADHERED ICE&WATER 7&8/A8.01 SIM. 7&8 A8.01 SIM. 7&8 IA8.01 SIM, 7&8 A8.01 SIM. MEMBRANE AT ALL TRANSITIONS, MEMBRANE AT ALL TRANSITIONS, E 1'-114" %' ® issued date description E HEADER WITH RIGID HEADER WITH RIGID INSULATION PER SCHEDULE .032"20ga.ALUM.DRIP EDGE INSULATION PER SCHEDULE .032"20ga.ALUM.DRIP EDGE o WITH KYNAR 500 FINISH / WITH KYNAR 500 FINISH ¢ _ Li 1 03/15/19 Issued for Construction N i O /2 1s V5 7-111y,5" 5/z 2'-11 /6 5/4 X 32"HARDIE TRIM BOARD ! 514 X 32 HARDIE TRIM BOARD ' ' `� 2'11�%" �' % ' " 'S " ' 0 co N ® E !!E ® F SELF-ADHERED ICE&WATER �' SELF-ADHERED ICE&WATER MEMBRANE AT ALL TRANSITIONS, _ MEMBRANE AT ALL TRANSITIONS, EXTEND UP WALL 4"MIN, EXTEND UP WALL 4"MIN. 00 COMPATIBLE SEALANT o00 COMPATIBLE SEALANT VINYL WINDOW o VINYL WINDOW c F 5 BOARD & BATTEN - WINDOW HEAD DETAIL r3_'_ LAP SIDING - WINDOW HEAD DETAIL M 6'-11%" F A8.01 SCALE: 3"= 1'-0" A8.01 SCALE: 3" = 1'-0" cll + VINYL WINDOW VINYL WINDOW PAINTED POPLAR WOOD PAINTED POPLAR WOOD SELF-ADHERED FLASHING.(TYP. SELF-ADHERED FLASHING.(TYP. title SILL: COLOR AS @ ALL WINDOW/DOOR SILLS). SILL: COLOR AS @ ALL WINDOW/DOOR SILLS). SELECTED BY OWNER. SELECTED BY OWNER. pl--�- COMPATIBLE SEALANT COMPATIBLE SEALANT WINDOW 032"20ga.ALUM.DRIP EDGE .032"20ga.ALUM.DRIP EDGE SCHEDULE --- WITH KYNAR 500 FINISH -WITH KYNAR 500 FINISH Lo � & DETAILS COMPATIBLE SEALANT COMPATIBLE SEALANT 514 X 32 HARDIE TRIM BOARD 514 X 34"HARDIE TRIM BOARD SELF-ADHERED ICE&WATER 7&8/A8.01 6 I A8.01 G 2X6 WOOD STUDS WITH SELF-ADHERED ICE&WATER 2X6 WOOD STUDS WITH MEMBRANE AT ALL TRANSITIONS, v V + R-21 BATT INSULATION------. MEMBRANE AT ALL TRANSITIONS, R-21 BATT INSULATION �- COMPATIBLE SEALANT 7&8IA8® + drawn by: --- COMPATIBLE SEALANT I FIBER CEMENT LAP SIDING CONTINUOUS VAPOR CONTINUOUS VAPOR 4:: checked by: Y8" %"EXTERIOR GRADE 5 CONTINUOUS AIR&WATER BARRIER AND/"GYP.BID. BARRIER AND/"GYP.BD. RESISTIVE BARRIER %' 2'11 4" 11 5�" 2'-11%" %' scale: AS NOTED PLYWOOD SHEATHING z 4"X 2%"FIBER CEMENT TRIM '2"EXTERIOR GRADE BATTENS OVER%6'PANELS PLYWOOD SHEATHING ¢ © project number: 10002 CONTINUOUS AIR&WATER N ® scaled inch Q RESISTIVE BARRIER 0 sheet number U O UBUILDING A r4 BOARD & BATTEN - WINDOW SILL DETAIL 2 LAP SIDING - WINDOW SILL DETAIL 1 RESIDENTIAL BUILDING WINDOW TYPES A8 01 SCALE: 3"= 1'-0" A8.01 SCALE: 3"= 1'-0" A8.01 SCALE: 1/2"= 1'-0" 0 CD F N CD _–_–, I I I 4'-5"LANDING ---- - - - - - I I I I r I I I L � 14 TREADS FINISHED I I I I I 1 i I I I I I I I I I I I I I I I I I I 1 '' \\ 3 /A9.00 3 /A9.00 i I I I I LU i I ' \ DN M = BEATTY HARVEY COCO z A R C H I T E C T S L L P I I 1 I I I I I I I I I I I I I I i I I I I \ I I I I 1 I I I I I I I I I LL i 11 i NEW YORK I MARYLAND I I\\ I 1'-0" i i 1300 Walt Whitman Road, New York, 11747 I ip: (631)300-1010 owner/developer Conifer Realty ,' - --- _-- 1000 University Avenue Suite 500 �g I 15'-9%" Rochester, NY 14607 \\\ 585.324-0500 ' 1%"x 1,y6'PAINTED POPLAR 2 STAIR B2 - SECOND FLOOR PLAN HAND RAIL MOUNTED TO \ o WALL,SEE SPECS civil engineer \` 1 Yz"x 1 1%e'PAINTED POPLAR / nC t i d'•HI�II .\\•—,j.\�./e,/\x\\—/•,/\\\II/�,•/\\.\II/,/�\•-\--��/,/\\o-//":�-\/\\�-.\r- /-- //o—o aJ�/��_Gx_��P\/��\�\Px��\-Q✓�--p.-\Y/5,u\._/\/�\\oN/\\\II'�\x\//�\\i H\A%x ND-R-\�AI�L\MOUNTED OUNTED�T O - S-CAL� 112IIIII,I'IIII 1m= 1Z�-0IiIIIIIIII " I,IIII __IIII__1IIIIIIIIII_ r z=--r-- _--_--_--1_'_--0_--"_----- ------------ 'I _ ✓ D - -- Uo� oo kha veno ,0N YLK1M17A SOALL BEYOND, 437 &401 5 \ EESPCS g [WI South Country Road 11'-3/" 631.286.8668 FINISHED FINISHED m.e.p. &f.p. M/E Engineering, P.E. 150 North Street Rochester, NY 14604 585.288.5590 3 A9.00 3 lA9.00 structural engineer UP TDM Consulting Engineering -----------____________________, 550 North County Road,Suite E Saint James, NY 11780FE 0 631.686.5234 am mom T__-__I___-_T----- r---- T__ _ key 00 Y"x 1%"PAINTED POPLAR TRUE HAND RAIL MOUNTED TO NORTH CONT.WOOD 2x12 SOLID STAIR B2 FIRST FLOOR PLAN WALL,SEE SPECS WOOD STRINGERS WITH A9.00 SCALE: 1/21 = 1 -0" SOLID WOOD TREAD AND RISERS(TYPICAL) do C:I HALF HEIGHT WALL WITH 13'-10" PAINTED WOOD CAP O -9,WV ======------====--------------------- R\,M W��\\ project\\\\�\ \ 3 STAIR B2 - SECTION VINEYARD VIEW JJ A9.00 SCALE: 1/2" = 1'-0" Cn DN 6 /A9.00 6 A9.00 County Road 48 I r- Z J L r- --r --- I1 Fq�� I 1I -J __IIIIIiIIIIII __Ifi1IIIII_____IIIIIIIIiIII- 1 y .I +Gr Gr e enp-o'rt;, �\,Nq��YJF�P11944 1944 seal T-64"LANDING 11-8" E FINISHED 14TREADS 1�"x 1%"PAINTED POPLAR HANDRAIL � AE(2a.SR c O h �p � O A MOUNTED TO WALL,SEE SPECS STAIR C1 SECOND FLOOR PLAN A9.00 SCALE: 112" = 1'-0" 614, x 4 HALF HEIGHT WALL WITH PAINTED WOOD CAP ED 77Y7'4Y45'-0" Issued date description -- 1 03/15/19 Issued for Co n struc tion HALF HEIGHT WALL WITH PAINTED WOOD CAP I to c') UP ® ----------------------------------------------- ------------- 6 ---------------------------------------------- -------------6 /A9.01�_06 /A9.00B0" xs 111 HAND RAIL MOUNTED TO 1 yy"PAINTED POPLAR OPPOSITE WALL BEYOND, _� - _________________________________ SEE SPECS r-------------- 8 ------ 11-4 , STAIR C1 - FIRST FLOOR PLAN A9.00 SCALE: 1/2" = 1 -0. PAINTED title POPLAR CAP TE T STAIR PLANS., CLEAR BLOCKING IN WASECTIONS Z 1 V'x 1>1s'PAINTED POPLAR 60 CID4 HAND RAIL,SEE SPECSI & ETAIL 7 w A9.00 o/ FASTEN TO WO °SOLID WOOD TREAD BLOCKING CONT.WOOD 2x12 SOLID AND RISER(TYPICAL) drawn by: --- aUi WO..OD STRINGERS WITH r-i�'--=-r"^—•�x r-�-°x x x,'� ''�P— ,�\7 ��9 N SOLID WOOD TREAD AND checked by: RISERS(TYPICAL) BRACKET,SEE SPECS-MIN.6" scale: A S NOTED z FROM END OF RAIL (MAX.5'0"O.C.) PLAN ESCUTCHEON WITH SETSCREW project number: 1000— 2 CONT,WOOD 2x12 scaled inch STRINGER(TYPICAL) SECTION sheet number NOMINAL SOLID WOOD 1, FACE OF WALL o M U BUILDING A Ra: 6 STAIR C1 - SECTION DETAIL - TREAD AND RISER 8 ESIDENTIAL RAILINGA0 A9.00 SCALE: 1/2" = 1'-0" „ _ „_ ,- „ 00 A9.00 SCALE: 1-112 - 1 -0 A9.00 SCALE: 3 - 1 0 o 2� yH • 77 BATHROOM ACCESSORY LEGEND PLUMBING FIXTURE LEGEND TAG DESCRIPTION TAG DESCRIPTION _ O1 TOILETPAPER DISPENSER � TOILET DD OSHOWER CURTAIN ROD 2❑ ACCESSIBLE TOILET + 4, 1 3O 30"FRAMED VANITY MIRROR (UNLESS NOTED AS 36"WIDE MIRROR) 3❑ WALL MOUNTED ACCESSIBLE TOILET 4O RECESSED MEDICINE CABINET4❑ COUNTERTOP WITH BUILT IN LAVATORY B E A TT Y H A R V E Y COC O 5 24"TOWEL BAR A R C H I T E CTS , L L P 50 WALL MOUNT ACCESSIBLE LAVATORY NEW YORK I MARYLAND T O 1Y"DIA.GRAB BAR © 25"STAINLESS STEEL KITCHEN SINK 1 300 Walt Whitman Road, New York, 11747 A p: (631)300-1010 lO FIXED ANGLE TILT MIRROR ElSINGLE HANDLE LAVATORY FAUCET owner/developer OPIPE GUARDS ® SINGLE HANDLEITUB FILL SHOWER HEAD Conifer Realty 1000 University Avenue Suite 500 10 SOAP DISPENSER 9❑ KITCHEN FAUCET Rochester, NY 14607 585.324-0500 11 PAPER TOWEL DISPENSER&WASTE RECEPTACLE 10 I SERVICE SINK FAUCET <12> COAT HOOKcivil engineer 11 ACCESSIBLE ROLL-IN SHOWER ENCLOSURE LKMA NOTES: 12 TUB&SHOWER ENCLOSURE 437 &405 1. REFER TO SPECIFICATION 102800 RESIDENTIAL ACCESSORIES BATHROOM. South Country Road 2. PROVIDE BLOCKING AT ALL ACCESSORY LOCATIONS. 13 ELONGATED TOILET SEAT Brookhaven, NY 11719 3. MIRROR SAFETY GLAZING PER SPECIFICATION.MIRRORS TO BE MOUNTED 631.286.8668 OR HUNG ON A SURFACE THAT PROVIDES A CONTINUOUS BACKING 14 ELONGATED TOILET SEAT WITH OPEN FRONT m.e.p. &f.p. SUPPORT. 15 CUSTODIAL SERVICE SINK M/E Engineering, P.E. REMOVABLE VANITY NOTES: PORCELAIN TILE NOTES: _I_B 150 North Chestnut Street AT ALL GROUND FLOOR APARTMENTS VANITY BASE CABINETS 1. CEMENT BOARD OR EQUIVALENT MOISTURE-RESISTANT BACKING MATERIAL 16 FLUSHOMETER I Rochester, NY 14604 SHALL BE REMOVABLE PER A117.1-2009 SECTION 1003.11.2.2. SHALL BE INSTALLED ON ALL WALLS BEHIND TUB&SHOWER ENCLOSURES 585.288.5590 EXCEPTION a,b&c. COMPOSED OF TILE OR PANEL ASSEMBLIES WITH SEALED JOINTS. 17 POSI-TEMP VALVE A. THE CABINETRY SHALL BE REMOVED WITHOUT REMOVAL PAPER-FACED BACKER BOARDS SHALL NOT BE USED. structural engineer NOTES: OR REPLACEMENT OF THE LAVATORY. 1. REFER TO SPECIFICATION 224000 PLUMBING FIXTURES. TDM Consulting Engineering B. THE FLOOR FINISH SHALL EXTEND UNDER THE CABINET. 2. ALLOW INSPECTION OF ALL PLUMBING FIXTURES, 550 North County Road,Suite E C. THE WALLS BEHIND AND SURROUNDING THE CABINET 3. PROVIDE APPROVED SUBMITTAL TO THE OWNER AND INFORM THEM Saint James, NY 11780 SHALL BE FINISHED. IMMEDIATELY AFTER INSTALLATION. 631.686.5234 [ALL : ROUND FZOF MENT BATHROOMS SHALL THE CRITYPE A A117.1-2009"BATHROOM. key N C, 5�-1 4 z" 1'-=--- /z" PLAN _ _ J I I I I I - I I I I I C? o I iN o O I I 6"x24"SOLID BLOCKING i N� FOR FUTURE INSTALLATIC N 2 4 OF GRAB BARS rRue o 3 4 7 i; ; project VINEYARD VIEW I 5 \\ 3 i 10A10.00 8 \ I 1 co i1 TWO(2)6"x30"SOLID I 5 9 --------- 4 5 L ,' BLOCKING FOR FUTURE I i i MIN. / 4 N E INSTALLATION OF GRAB BARS L---- 1 ------------------ D County Road 48 4'-0"MIN. 5 I , i 4 i o 2'-6" I 1 �, Greenport, NY 11944 MIN. 4 seal 1 = o _ �I o M 12 � I 0 10" 12 O CV C'V , \ Cn O N Q I \ t O 7" N \\J \ 1 N N \\ U 3 r � ►� I 12 \ X21422 ' 6"x48"SOLID BLOCKING FOR FUTURE 6"x48"SOLID BLOCKING FOR FUTURE 6"x30"SOLID BLOCKING FOR FUTURE .-OF OF �I��rd o`� INSTALLATION OF GRAB BARS INSTALLATION OF GRAB BARS INSTALLATION OF GRAB BARS 7'-1%" E issued date description 10 BATHROOM-D ELEVATION 10 9 BATHROOM-D ELEVATION 9 8 BATHROOM-D ELEVATION 8 7 BATHROOM-D ELEVATION + 7BATHROOM FLOOR PLAN 1 03/15/19 Issued for Construction A10.00 SCALE: 1/2"= 1'-0° A10.00 SCALE: 1/2" - 1'-0" �� - � �� Q 2 07/01/19 Project Bulletin #4 A10,00 SCALE: 112" = 1'-0" A10.00 SCALE: 112"= 1'-0" A10.00 SCALE. 112 = ' -0 DUPLEX APARTMENT TOILET 4 �_______________________________SII 12 , I _ 8 11 + N I 6"x24"SOLID BLOCKING FOR FUTURE INSTALLATIC N 2 I � / 4 OF GRAB BARS title r 3 8 4 BATHROOM „ j---2- --------------- I o i 5 VANITY BASE O BE 300 5 PLANS, REMOVABLE F ER NOTES I i 5 1 A10.00 3 E ON 10-SERIES DWGS. 1,-3„ I , �____ ____ TWO(2)6"x30"SOLID BLOCKING o I 1 i i ELEVATIONS 4 5 I / �� ' E FOR FUTURE INSTALLATION o MI . 2'-9" i 4 I `" � OF GRAB BARS & DETAILS ' 4'-0"MIN. 5 I , 1 i ' 4 i - , 2'-6" 1 MIN. 7 �---- _ I � / 5 drawn by: --- ,r�� checked b --- 12 r5_-- c`o I 1 M o 12 N O> I I J - ' J scale: o N N 8 ------------ --- AS NOTED 7" \ `\\ 12 project number: 10002 Q071�\ 1 scaled inch o \ 1.6/" 3'-0" 2'-6" Y I 2'-BY' sheet number U 6"x48"SOLID BLOCKING FOR FUTURE 6"x48"SOLID BLOCKING FOR FUTURE 6"x30"SOLID BLOCKING FOR FUTURE a� INSTALLATION of GRAB BARS INSTALLATION OF GRAB BARS INSTALLATION OF GRAB BARS 10'-1y" 5 BATHROOM-2B ELEVATION 5 4 BATHROOM-2B ELEVATION 4r3_"� gr2_N� BUILDING A BATHROOM-213 ELEVATION 3BATHROOM-2B ELEVATION 21 BATHROOM-2B FLOOR PLAN A10.00 SCALE: 1/2" = 1'-0" A10.00 SCALE: 1/2" = 1'-0" co A10.00 SCALE: 112"= 1'-0" A10.00 SCALE: 1/2"= 11-011 A10.00 SCALE: 1/2"= 11 o H , 6 7 8 a--�--� —J H 10000 BATHROOM ACCESSORY LEGEND PLUMBING FIXTURE LEGEND 5 . �- TAG DESCRIPTION TAG DESCRIPTION OTOILET PAPER DISPENSER1❑ TOILET ' O SHOWER CURTAIN ROD 2❑ ACCESSIBLE TOILET . .: ; . I O30"FRAMED VANITY MIRROR (UNLESS NOTED AS 36"WIDE MIRROR) 3❑ WALL MOUNTED ACCESSIBLE TOILET 4O RECESSED MEDICINE CABINET ® COUNTERTOP WITH BUILT IN LAVATORY B E A T T Y HARVEY COC O 5 24"TOWEL BAR 5❑ WALL MOUNT ACCESSIBLE LAVATORY ARCH I T E C T S , LLP NEW YORK I MARYLAND 60 1Y4"DIA.GRAB BAR © 25"STAINLESS STEEL KITCHEN SINK 1300 Walt Whitman Road, New York, 11747 I A p: (631)300-1010 lO FIXED ANGLE TILT MIRROR 7� SINGLE HANDLE LAVATORY FAUCET + owner/developer 8O PIPE GUARDS ® SINGLE HANDLEITUB FILL SHOWER HEAD Co 1000 Universityninee uite Realty <10> SOAP DISPENSER 9❑ KITCHEN FAUCET Rochester, NY 14607 585.324-0500 <11> PAPER TOWEL DISPENSER&WASTE RECEPTACLE 10 SERVICE SINK FAUCET <9>_ 2 COAT HOOK 11 civil engineer ACCESSIBLE ROLL-IN SHOWER ENCLOSURE LKMA NOTES: 12 TUB&SHOWER ENCLOSURE 437&405 1. REFER TO SPECIFICATION 102800 RESIDENTIAL ACCESSORIES BATHROOM. South Country Road 2. PROVIDE BLOCKING AT ALL ACCESSORY LOCATIONS. 13 ELONGATED TOILET SEAT Brookhaven, NY 11719 3. MIRROR SAFETY GLAZING PER SPECIFICATION.MIRRORS TO BE MOUNTED 631.286.8668 OR HUNG ON A SURFACE THAT PROVIDES A CONTINUOUS BACKING 14 ELONGATED TOILET SEAT WITH OPEN FRONT m.e.p. &f.p. SUPPORT. B15 I CUSTODIAL SERVICE SINK M/E Engineering, P.E. PORCELAIN TILE NOTES: B 15 North Chestnut Street 1. CEMENT BOARD OR EQUIVALENT MOISTURE-RESISTANT BACKING MATERIAL 16 FLUSHOMETER Rochester, NY 14604 SHALL BE INSTALLED ON ALL WALLS BEHIND TUB&SHOWER ENCLOSURES 585.288.5590 COMPOSED OF TILE OR PANEL ASSEMBLIES WITH SEALED JOINTS. 17 POSI-TEMP VALVE PAPER-FACED BACKER BOARDS SHALL NOT BE USED. NOTES: structural engineer 1. REFER TO SPECIFICATION 224000 PLUMBING FIXTURES. TDM Consulting Engineering 2. ALLOW INSPECTION OF ALL PLUMBING FIXTURES. 550 North County Road,Suite E 3. PROVIDE APPROVED SUBMITTAL TO THE OWNER AND INFORM THEM Saint James, NY 1 1780 IMMEDIATELY AFTER INSTALLATION. 631.686.5234 REMOVABLE VANITY NOTES: NOTE: AT ALL GROUND FLOOR APARTMENTS VANITY BASE CABINETS ALL GROUND FLOOR APARTMENT BATHROOMS SHALL key SHALL BE REMOVABLE PER A117.1-2009 SECTION 1003.11.2.2. MEET THE CRITERIA OF A"TYPE A Al 17.1-2009"BATHROOM. N� EXCEPTION a,b&c. A. THE CABINETRY SHALL BE REMOVED WITHOUT REMOVAL PLAN OR REPLACEMENT OF THE LAVATORY. o + B. THE FLOOR FINISH SHALL EXTEND UNDER THE CABINET. C. THE WALLS BEHIND AND SURROUNDING THE CABINET SHALL BE FINISHED. 0 no a N — TRUE o project VINEYARD VIEW G County Road 48 Greenport, NY 11944 seal D Apc`�, G,E R O � Q O a O /> 0214 - E 021422 -I E issued date description 1 03/15/19 Issued for Construction 2 07/01/19 Proiect Bulletin No.4 5'-3Y4. Y" 4'-6Y" �L--------------------------------JI 8 A 11 N F 6"x24"SOLID BLOCKING=0R INSTALLATION OF GRAB EARS ---------- ---� `- 4 ' title � I 2 I � I � I 5 ' 4 2 I o 5 ( 5 A10.01 3 \ BATH ROOM PLANS r OF - --+ -----------iJ 27"max. ' ELEVATIONS 16"max. F '?5 i L 8 & DETAILS 2 MIN. 2'-9" 6 4'-0"MIN. L 2,�„ � 5 6 1 MIN. 6 `N T P \ T 77=/77/ �\\ / ' —- 6 -- ------------, io checked by: --- __ CL I ----------- U 2 N " � M scale: AS NOTED ;^ N 0 \ „ I project number: 10002 0 \ 1 \\ 11 Q �� 2 11 `\ 11 scaled inch o \ I /' � sheet number 0 6"x54"SOLID BLOCKING FO 1'-6�^ T-0" 2'6" 2'-8/' 6'x48 SOLID BLOCKING FOR 6x30"SOLID BLOCKING FOR 6"x48"SOLID BLOCKING FOR INSTALLATION OF GRAB BAS ., C INSTALLATION OF CRAB BARS INSTALLATION OF GRAB BARS INSTALLATION OF GRAB BARS 10'-1/ BUILDING A 5 BATHROOM-2A ELEVATION 5 4 BATHROOM 2A ELEVATION 4 3 BATHROOM-2A ELEVATION 3r_2'N� BATHROOM-2A ELEVATION 2 1 BATHROOM-2A FLOOR PLAN A10.01 SCALE: 1/2" = 1'-0" A10.01 SCALE: 1/2" = 1'-0" _ A10.01 SCALE: 112"= 1'-0" A10.01 SCALE. 1/ " = 1'-0" A10.01 SCALE: 1/2" = 1'-0" + 89 H A ] 0001 N O LING FINISH SCHEDULE 1.ICEMENTTBOARD OR EQUIVALENT MOISTURE-RESISTANT BACKING MATERIAL SHALL BE INSTALLED ON ALL WALLS ® BEHIND TUB&SHOWER ENCLOSURES COMPOSED OF TILE OR PANEL ASSEMBLIES WITH CAULKED JOINTS. -: 09 30 00 -TILING PAPER-FACED BACKER BOARDS SHALL NOT BE USED. TAG APPLICATION MANUFACTURER DESCRIPTION FLOORING NOTES: "A 9 A . MATERIAL: GLAZED CERAMIC TILE 1. FLOORING CONTRACTOR SHALL FURNISH AND INSTALL ALL LEVELING,PATCHING AND SURFACE PREP REQUIRED ANSI BATHROOMS TO PROVIDE NEW FLOORING INSTALLATIONS COMPLETE. STYLE: HEATHLAND T-1 WITH ROLL IN DALIILE 2.CONTRACTOR TO MATCH ARCHITECTS SAMPLE FOR ALL FINISHES. 3. SEE SPECIFICATIONS FOR PERFORMANCE REQUIREMENTS AND TYPES OF PRODUCTS FOR ALL FINISHES. SHOWERS COLOR: RAFIA HL02 4. CONTRACTOR SHALL FINISH COMPLETE ALL AREAS UNDER DOORS,AT THRESHOLDS,AROUND ANY FLOOR B E A T T Y HARVEY COC O SIZES: 12712"FLOOR TILE APPURTENANCES BY OTHERS TO PROVIDE A SMOOTH TRANSITION AND ELIMINATE ALL TRIPPING HAZARDS. A R C H I T E C T S , L L P 09 6513 -RESILIENT BASE AND ACCESSORIES 5. CONTRACTOR SHALL PERFORM A BOND TEST IN ACCORDANCE WITH MANUFACTURER'S SPECIFICATIONS PRIOR NEW YORK I MARYLAND TO INSTALLATION OF NEW FLOORING. + TAG APPLICATION MANUFACTURER DESCRIPTION 6. FURNISH AND INSTALL STAINLESS STEEL TRANSITION STRIP AT ALL TRANSITIONS BETWEEN CARPET AND 1300 Walt Whitman Road, New York, 11747 A p: (631)300-1010 MATERIAL: 4"HIGH VINYL WALL BASE PORCELAIN TILE. owner/developer 7. ALL INTERIOR FLOOR FINISHES TO COMPLY WITH SECTION 804 OF THE NYS BUILDING CODE. ALL FLOOR FINISH ALL ROOMS,EXCEPT STYLE: TRADITIONAL TOELESS AND FLOOR COVERING MATERIALS TO BE OF CLASS II MATERIALS. Conifer Realty RB-1 SECOND FLOOR JOHNSONITE 8. FINISHES SHALL RUN UNDER ALL BUILT IN MILLWORK AND FIXTURES NOT INCLUDING SHOWER. 1000 University Avenue Suite 500 BEDROOMS COLOR: 08 ICICLE 9.CARPET AREAS TO RECEIVE CARPET BASE. Rochester, NY 14607 FINISH: MANUFACTURERS STANDARD 585.324-0500 09 6516 -RESILIENT SHEET FLOORING TAG APPLICATION MANUFACTURER DESCRIPTION civil engineer LKMA STANDARD MATERIAL: VINYL SHEET FLOORING 437 &405 BATHROOMS, STYLE: STATAMAX VESSA TRAVERTINE South Country Road VRF-1 MECH.CLOSETS,AND ARMSTRONG BULK STORAGE COLOR: MALTED EMBLEM X4795 Brookhaven, NY 11719 631.286.8668 ROOMS TYPE: NA 09 6519-RESILIENT TILE FLOORING m.e.p. &f.p. TA4PPLICATION MANUFACTURER DESCRIPTION M Engineering, P.E. B B 150 North Chestnut Street FIRST FLOOR MATERIAL: VINYL PLANK FLOORING Rochester, NY 14604 VPF-1 BEDROOMS, FLOORFOLIO STYLE: TIMBER 585.288.5590 KITCHENS,AND COLOR: 636-672 LIVING ROOMS TYPE: 8MIL WEAR LAYER structural engineer TDM Consulting Engineering 09 68 00 -CARPETING 550 North County Road,Suite E TAG APPLICATION MANUFACTURER DESCRIPTION Saint James, NY 11780 MATERIAL: NYLON(CARPET BASE) 631.686.5234 CB-1 SECOND FLOOR MOHAWK GROUP STYLE: LIVING QUARTERS BEDROOMS COLOR: SUMATRA BLEND 852 TYPE: BROADLOOM key 09 6816 -SHEET CARPETING TRUE TAG APPLICATION MANUFACTURER DESCRIPTION I Fl, NORTH MATERIAL: NYLON CPT-1 SECOND FLOOR MOHAWK GROUP STYLE: LIVING QUARTERS + BEDROOMS COLOR: SUMATRA BLEND 852 O TYPE: BROADLOOM MATERIAL: NYLON CPT-2 STAIRS J&J INVISION STYLE: BOULEVARD OO 0 COLOR: PENNY LANE 1520 TYPE: ENCORE BCF 09 9123 -INTERIOR PAINTING TAG APPLICATION MANUFACTURER DESCRIPTION _____ _____ ______ __ j _ ------------------------------------ project ------------------------------------ MATERIAL: 4.LINE OF ROD 12" 20 VINEYARD VIEW PT-1 WALLS SHERWIN-WILLIAMS COLOR: NATURAL CHOICE SW7011 SUPPORT 2A.LINE OF BRACK�, -- - 1A.LINE OF SHELF ET N ---------------------------------- FINISH: FLAT MAXIMUM SPAN FOR ROD& C/) - Z > SHELF, PROVIDE ADDITIONAL i a W D TYPE: LATEX SUPPORT BRACKETS o o MATERIAL: o MAXIMUM SPAN FOR ROD&1111 W -� 2.LINE OF BRACKET w Lu County Road 48 _ _ SUPPORT BRACKETS Greenport, NY 11944 DOORS,DOOR u- - SHELF. PROVIDE ADDITIONAL w PT-2 FRAMES AND STAIR SHERWIN-WILLIAMS COLOR: EXTRA WHITE 7006 „ w LL - ______-_-_-_-_----_ � 3.LINE OF =" = PROVIDE BLOCKING p FINISH: SEMI-GLOSS PROVIDE BLOCKING STRINGERS i AT ALL SHELF TYPE: LATEX AT ALL SHELF seal ______________________ SUPPORTS SUPPORTS MATERIAL: - - _-_-_- ------_------- _-- --- BATHROOMS, COLOR: NATURAL CHOICE SW7011 Y, N Xt COMPONENTS ----------------------------------------- CLOSET �5 �ORE4G /) FINISH: SEMI-GLOSS O PT-3 KITCHENS,AND TRIM SHERWIN-WILLIAMS 1.SHELF(BEDROOM&COAT) 75 � • MANUF:CLOSETMAID 2'•0"[24"] 2'-0"[24"] �1 TYPE: LATEX • MODEL:SUPERSLIDE SHELF * d - • (FIELD VERIFY a CLOSET PLAN DETAIL © LINEN CLOSET PLAN DETAIL MATERIAL: (FIELD VERIFY FULL CLOSET WIDTH) � ' COLOR: NATURAL CHOICE SW7011 • VINYL COATED WIRE VENTILATED SHELVING T � 'r422 y0� CLP-1 CEILINGS SHERWIN-WILLIAMS • COLOR:WHITE FINISH: FLAT TYPE: LATEX 1A.SHELF(LINEN) FOF NE`N • MANUF:CLOSETMAID 09 97 23 -CONCRETE AND MASONRY COATINGS • MODEL:CLOSE MESH SHELF• 20"DEEP x WIDTH 1 TAG APPLICATION MANUFACTURER DESCRIPTION • (FIELD VERIFY FULL CLOSET WIDTH) issued date description WI 1 • VINYL COATED RE VENTILATED SHELVING + MATERIAL: CONCRETE SEALER COLOR:WHITE 1 03/15/19 Issued for Construction CS-1 TELCO AND WATER PPG PAINTS COLOR: PREMA CRETE PLEX SEAL CLEAR SEALER SERVICE ROOMS FINISH: MATTE :.BRACKET I I MANUF:CLOSETMAID TYPE: • 12"DEEP • (FIELD VERIFY FULL CLOSET WDTH) FINISH TAG KEY • VINYL COATED WIRE VENTILATED SHELVING i v i 1.SHELF • COLOR:WHITE ji j • NOTE:PROVIDE BRACKET SUPPORTS AS 1 CEILING 12 V-8"[20"] 1A.SHELF REQUIRED TO MAINTAIN A 36"MAXIMUM ;i WALL UN-SUPPORTED LENGTH FOR SHELF SPAN AND AT EACH END OF SHELF j i 2.BRACKET BASE 2A.BRACKET i 1.SHELF • MANUF:CLOSETMAID j FLOOR • 20.5"DEEP ! 12 i 2A.BRACKET 1A.SHELF q • (FIELD VERIFY FULL CLOSET WDTH) 4.ROD • VINYL COATED WIRE VENTILATED SHELVING STORAGE ACCESSORIES I " j SUPPORT • COLOR:WHITE j 2.BRACKET FULLY ACCESSIBLE BEDROOM&COAT CLOSET WITH WIRE MESH SHELVING,SUPPORT BRACKETS AND • NOTE:PROVIDE BRACKET SUPPORTS AS I F Al ROD;i,SEE DETAIL 11A11.00 REQUIRED TO MAINTAIN A 36"MAXIMUM I i r= 1A.SHELF q F =1 UN-SUPPORTED LENGTH FOR SHELF SPAN AND j 3.CLOSET ROD Q AT EACH END OF SHELF i J i j 2A.BRACKET TYPICAL BEDROOM&COAT CLOSET WITH WIRE MESH SHELVING,SUPPORT BRACKETS AND RODS,SEE 1 4.ROD = a DETAIL 1/A11.00 �i SUPPORT j' 3.CLOSET ROD cn • MANUF:CLOSETMAID ;i 3.CLOSET ROD F- i o 1A.SHELF o 0 • MODEL:SUPERSLIDE x 3FT;4FT;6FT;8FT TYPICAL BEDROOM&COAT CLOSET WITH WIRE MESH SHELVING,SUPPORT BRACKETS AND RODS,SEE (FIELD VERIFY LENGTH) j 0 ; M 2A.BRACKET "' title 61 I; to DETAIL 1/A11.00 • 314"DIA.TUBULAR STEEL i? j • EPDXY COATED STEEL L-_____-__-__________________--_- MILLWORK AND TRIM • COLOR:WHITEco O %"POPLAR WINDOW STOOL W/3/4"/ U "x 3,Z"POPLAR APRON. 4.ROD SUPPORT '; 2A.BRACKET it FINISH SCHEDULE PAINTED FINISH COLOR:DOVER WHITE • MANUF:CLOSETMAID 04 o • MODEL:SUPERSLIDE J-BRACKET CLOSET ROD WINDOW TREATMENTS SUPPORT N & CLOSET DETAILS ------ (FIELD VERIFY LENGTH) HORIZONTAL LOUVER BLINDS @ WINDOW AS SPECIFIED IN PROJECT MANUAL,SECTION 122113. • RESIN • COLOR:WHITE • NOTE:PROVIDE ROD SUPPORTS AS REQUIRED TO @ MAINTAIN A 36"MAXIMUM UN-SUPPORTED LENGTH ❑ ACCESSIBLE APT. CLOSET SECTION DETAIL L - Al AZ TYPICAL APT. CLOSET SECTION DETAIL B1 APT. LINEN CLOSET SECTION DETAIL 2 VERTICAL LOUVER BLINDS PATIO DOOR AS SPECIFIED IN PROJECT MANUAL,SECTION 122116. FOR ROD SPAN AND AT EACH END OF SHELF AND drawn by: HANG ROD : GENERAL FINISH NOTES: checked by --- 1.ALL INTERIOR WALL AND CEILING FINISHES TO COMPLY WITH SECTION 803 OF THE NYS BUILDING CODE. ALL scale: AS NOTED INTERIOR WALL AND CEILING FINISHES SHALL BE CLASS C RATING. 2.ADD SUMATRA ALTERND"NATE EDROOM CARPET SHAW"GO FOR IT"#702 IN PLACE OF MOHAWK GROUP LIVING QUARTERS 1 APARTMENT CLOSET DETAILS project number: 10002 3.ADD ALTERNATE CEILING PAINT"BRIGHT WHITE"SW7011 IN PLACE OF"NATURAL TAN"SW7567. Q 4.ADD ALTERNATE RESILIENT SHEET FLOORING"MUSTY MAJESTIC"X810 IN PLACE OF"MALTED EMBLEM"X4795. �OOSCALE: 314" = 1 -O" scaled inch 0 sheet number 0 TYPICAL APARTMENT NOTES: 0 U 1.ALL EXPOSED ELECTRICAL PANEL COVERS SHALL BE PAINTED TO MATCH THE ADJACENT WALL SURFACE. BUILDING A 2.ALL ELECTRICAL WALL SWITCHES AND OUTLETS SHALL BE DECORA STYLE FURNISHED IN WHITE WITH WHITE a POLYESTER TRIMS. = 3.ALL HVAC DIFFUSERS AND RETURNS SHALL BE WHITE. 16 Q) +1 +2 O + _] A ] 1 000 L 5� 41 + (�I /I + 9 H z N -}- +- lip o FINISH LEGEND TAG DESCRIPTION T-1 GLAZED CERAMIC TILE-HEATHLAND . RB-1 4"HIGH VINYL WALL BASE-08 ICICLE VRF-1 VINYL RESILIENT SHEET FLOORING-HUSKY STREET G2380 VPF-1 VINYL PLANK FLOORING-TIMBER 636-672(8 MIL) CB-1 NYLON CARPET BASE-SUMATRA BLEND 852 CPT-1 NYLON CARPET-SUMATRA BLEND 852 B E A T T Y HARVEY COC O ARC H I T E C T S , LLP CPT-2 NYLON CARPET-PENNY LANE 1520 NEW YORK I MARYLAND PT-1 PAINT-NATURAL CHOICESW7011 (FLAT) 1300 Walt Whitman Road, New York, 11747 A A p: (631)300-1010 PT-2 PAINT-EXTRA WHITE 7006 owner/developer PT-3 PAINT-NATURAL CHOICE SW7011 (SEMI-GLOSS) Conifer Realty CLP-1 PAINT-NATURAL CHOICE SW7011 1000 University Avenue Suite 500 Rochester, NY 14607 CS-1 CONCRETE SEALER-PERMA-CRETE PLEX-SEAL CLEAR SEALER 585.324-0500 civil engineer LKMA 437 &405 South Country Road Brookhaven, NY 11719 631.286.8668 m.e.p. &f.p. M/E Engineering, P.E. R 150 North Chestnut Street = Rochester, NY 14604 585.288.5590 structural engineer TDM Consulting Engineering 550 North County Road, Suite E Saint James, NY 11780 631.686.5234 TELCO&WATER COAT CLOSET SERVICE ROOM BEDROOM BATHROOM CLP-1 CLP-1 CLP-1 CLP-1 PT-1 PT-3 PTA PT-3 RB-1 RB-1 RB-1 RB-1 key VPF-1 CS-1 VPF-1 VFF-1 TRUE NORTH CI BEDROOM BEDROOM � + CLP-1 CLP-1 PT-1 PT-1 0 RB-1 RB-1 - VPF-1 VPF-1 O BULK STORAGE BULK STORAGE CLP-1 I CLP-1 PT-1 - PT-1 RB-1 RB 1 ° VRF-1 VRF 1 project MECHANICAL - MECHANICAL I r ROOM d s ROOM VINEYARD VIEW CLP-1 j I CLP-1 PT-3 PT-3 RB-1 JvUi II - sxxa�ax-asxxxx,u�x xxxrxaxr x,saaxas_xara,xxx,xar+�rxxae�iI~I ,xxaxxx�xxx aaaxaax�axxII�d:xaax�x,xxxreO,xaxxax�xr asxxxxx xxx.xo-e Oxo-xaassxxx,x�xa+x�xxaxMxx,xarxz,xxxxxaxar-xxx.xxxaxdaxxrar°axa,rxMe-tx,axxaxxaxxxao-xx+x,ax°rax*nnxxsxrtaaxxxxxr�xII .axxaxex• xxxdxaaxa,xxxx+'Ixaxaaxxa�,•x'xxxxar�xxna�axxx�xxrrr—�xaxaxrrxaa�xau,daaaxarrx-1xs�xarr+saxxirxo�xx—m1��aaxaa-rx,+a�axcx-1,xasxrrxxa�,s•-x—xxx+xa+s�xxA-s—�-aru,iixax,x•xx-r,—�xaxxr�xarxxaxJ�_�Ixxas�aaear�xx xaaxarzsxa:+�,ax xxax+,x,.„xsK.+Ke.�xaaxaxxxxaxx xxx,x-x-xxaxe,xx,r�xxaxrx ax' '�wwwwwwwwww...FLL'�wwwwwwwwww.w—_-_-.�owwwwwww`awwwwJ--_PI'wwwwwww --wwwwwwwwxwww-----wwwwwww�wwwwi—-wwww'www�www�L--w°wwwwwwww.D�L—wwwwwww-ww.wti` wwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwww wwwwd - jI °r • GI_ rDI I- _—_- 'I l Ir CRB-1 VRF-1 VRF-11 _I G Cseisoa T a: � k l1 unty 0Road 9w�48 Greenport, NY 11944 1944 BATHROOM BATHROOM CLP-1 -3 o PT-3PT RB-1 RB-1 ORE VRF-1VRF1 wwwwwwwwwwww x..... wwwwwwwwwww npax axxxaxxwwwwwwwww wwwwwwwww.w xxxxsxxax +.xrxa.+xxKITCHEN KITCHEN . CLP-1 PT-3 PT-3 RB-1 RB-1 CLP ............... VPF-1 VPF-1 0F Nq e_ COAT CLOSET COAT CLOSET sued date description CLP-1 CLP-1- - PT-1 i F1 , Co n �sutr_u c iRB-1 O ORB-1 VPF-1 VPF-1 LIVING ROOMLIVING ROOM CLP-1 CLP-1 PT-1 PT-1 RB-1 RB-1 VPF-1 VPF-1 UNIT NUMBER UNIT NUMBER UNIT NUMBER 403&503401 &501 402&502 UNIT TYPE UNIT TYPE UNIT TYPE B1 C1 B1 F _ _ title FIRST FLOOR d . FINISH PLAN CLP-1 CLP-1 CLP-1 CLP-1 CLP-1 CLP-1 CLP-1 drawn by:PT-1 PT-1 PT-1 PT-1 P--3 PT-1 PT-1 RB-1 RB-1 RB-1 RB-1 checked by:VPF-1 CPT-2 CPT-2 VPF-1 VFF-1 CPT-2 VPF-1 STAIRLANDING ENTRYSTAIRS STAIRS LIVING ROOM KITCHEN ENTRYSTAIRS STAIRLANDING scale: AS NOTED nT E--D project number: 1000- - 2 scaled inch IF I I kz 0 sheet number UOU BUILDING A- I +xxxasxxxx 1 FIRST FLOOR FINISH PLAN A11.01 SCALE: 3/16" = 1'-0" 0 FINISH LEGEND TAG DESCRIPTION ." T-1 GLAZED CERAMIC TILE-HEATHLAND RB-1 4"HIGH VINYL WALL BASE-08 ICICLE VRF-1 VINYL RESILIENT SHEET FLOORING-HUSKY STREET G2380 VPF-1 VINYL PLANK FLOORING-TIMBER 636-672(8 MIL) CB-1 NYLON CARPET BASE-SUMATRA BLEND 852 CPT-1 NYLON CARPET-SUMATRA BLEND 852 B E A T T Y HARVEY COC O ARC H I T E C T S , LLP CPT-2 NYLON CARPET-PENNY LANE 1520 NEW YORK I MARYLAND PT-1 PAINT-NATURAL CHOICE SW7011 (FLAT) 1300 Walt Whitman Road, New York, 11747 PT-2 PAINT-EXTRA WHITE 7006 � p: (631)300-1010 owner/developer PT-3 PAINT-NATURAL CHOICE SW7011 (SEMI-GLOSS) Conifer Realty CLP-1 PAINT-NATURAL CHOICE SW7011 1000 University Avenue Suite 500 Rochester, NY 14607 CS-1 CONCRETE SEALER-PERMA-CRETE PLEX-SEAL CLEAR SEALER 585.324-0500 civil engineer LKMA 437 &405 South Country Road Brookhaven, NY 11719 631.286.8668 m.e.p. &f.p. M/E Engineering, P.E. �— 413 150 North Chestnut Street Rochester, NY 14604 585.288.5590 structural engineer TDM Consulting Engineering 550 North County Road,Suite E Saint James, NY 11780 631.686.5234 MECHANICAL HALLWAY BEDROOM BATHROOM ROOM CLP-1 CLP-1 CLP-1 CLP-1 PT-1 PT-1 PT-3 PT-3 RB-1 CB-1 RB-1 RB-1 key VPF-1 CPT-1 VRF-1 VRF-1 TRUE NORTH + BEDROOM BEDROOM CLP-1 CLP-1 PT-1 PT-1 CB-1 CB-1 CPT-1CPT 1 ii i/'/i'r/'/r'r/'r \\ ' — BULK STORAGE BULKSTORAGE OO CLP-1 \``\ \\`\\``1``\ \`'\\`\\``\\``\\``\\``\\``\ \` , CLP-1 'r r it it i i'it // i r r r '/i /'/i'i i'i'/i' `\\\\\\ \ `\\\\\\; \\`\ \\ \\\ \ \ ` \ \ \\ ti``\ \``\ \`\\` \` PT-1 fr//r r r/r rrr/r//i rri'ri/i r/i'ri 'i'/i'i//i'/i/i'/r' /'ir r//rr! /i,'rr i /r /, rr , //r/ /r'rr / rr , , r //'//'r '!f r'rr \ \ \\ \\ \\ \� \\ \\ \\ \\ \\ \\ \\ \\ \\ \\ \\ \\ \ \\ \\ \ \ \ \\ \\ PT-1 RB-1 RB-1 VRF-1 f'r' '/r'/,'' ''r;'r, ;'' ',''r;';' rr; ';'/ 'r ', ' 'rr ';'r'''r'''i'"''f'! '' r''r !'''i'r:' '/''i'' '/i''i''i' '''r'/r''r''i''; ri''/ ` \` \````\ / r. / / / / r / / / / / ' � / project MECHANICAL " /, V i/ MECHANICAL ROOM ir/r/r r r /"I I/ "I I /r/fi irr it r fir/i,r/ir/�i rri /r i/ri fi rir i J' r!'i i rri//r/ iri,ri:!.% /rri i,i/i'r r '/i' r rr'ri'/i''/i/r'r r'' ``\\\\ ` \`` ` \``\\`` `` ``\\` \``�\\\\``: `�\\\\\``\\` `` 'N' ROOM ``\\``\\``\ \``\`` ``\ ROOM CLP-1 ! ;I/ I/,'%'', '' '',''/;r/r''/r''%r'''%'%' / ; ''r,'/;''%'%'r%''% ;'%''%,'%% r / ; r;r,'/; 'r;% ,'r,'/,'r/r'' ;'r;r,''r%'/%' 'r%'r; `\\\\\\\;\;\\\;\\ ,\\\\\,,,\,\,\,\ , ,. ",` '`\\' \\`\\`\\\,\\` \\ \ \\,\`\\` VINEYARD VIEW PT 3 i r 'r i / I " " '�r''",, '/i r / 'f''ri ''ri'i'/i''/i' '' .''i'i'ri'ri i'ri'ri i'ri'/i'ri'ri'' '' ''ri''/i''f'' '/i'/i'/i'/i'i r i r. \\\\\\\\\\\\\\\\`\`\\\\\\\\\\\\` \\\\\\ \ . "I\\\\\\\\\\\\\\ \ CLP-1 RB 1 f/ / '' r'!' i r/i'/i 'r/i /irii' / ri r''�i /''/i''/i''/i'r' rrr' ''i''/ 1 'r'1i' ''ri ''' ''/i'/i''ri''ri'rr'ri''ri''r i'''''/i'i''ri i''i'''! ``\\\\\` \\\\\` \\\\\\\\\\\\\\ \\\\\\\`\\\ \`\\\\\\\\ \\ \\\\"\\\\\\\ \\ \\\\\ PT-3 � VRF-1 ' ,/ i/ if ''ri i i''i'rri ri ' /rr/''/r rri r/rrir \ \\\\` `` \\\\`\ \\\\` \`\\` \`` ARB 1 /i rri r r i'/i r i / 'i r/r r r'ri' / /, r, r, / rir/r i rri'ri'ri /rri'ri r'i r/i i i rri r i rfi r/i'r i'rri rri ''/i'i//i�/r r; rrr r \,\\\\\\\`\\ \\\`\\ \ \,\`,\` \ , \`` ` \``\\`` `` \``\\`` \` `\\`` ` RF 1 D ; '; ; ;' %;'';%; %; ; ; ; ; %;%; ;'r %;%;'r'; ;'r %; ; ;%;/r%;%; ` `` ``� \`` 1\` \`` \ : County Road 48 " ' " " " ' " ' " " " " " " '' " \ \ \ \ \ \ BATHROOM ' ' 'f f//rf/rr/////rr l /r r r ,r// rrr / r / r f/ %/i/rr / r / r r / r / i r `\\\\\ \\\\\\\\ ,\\\ \\\\\\ \\\\\\\\\\\\\\ \ \ \ \ \``\`` BATHROOM Greenport, NY 11944 \ \ \ \ CLP-1 \\ CLP-1 seal PT-3 / / / / / / xxxxx xxxxxxx awe ax y s x w r xx xxxxxxxxxx. _.Jx xxxx xr �xw�x**.ansa "`'x'x \ \ \ \ \` \\ PT-3 RB-1 '/ -- xxxx xxxxxxxx Kxxx xxxxxxx xx *"""`�`* \ , ,\` \\� xxxxx xxxxxx a a a a a a.a a a a a a a [, xxxxxxx xxxxxx xxxx xxxxxxx x xxx RB 1 `5'( p�E VRF-1 xxxx xxxxxxxxxxxKxxK.xx: xxx xxxxxxxxxx xxxxx xxxxxxxxxxxxx a ..x xaxaaaax xxxx xax aaas xa as xxxxxxxxxxxxxxxxxxxxxxxx x xxxx xxxxxxxxxxxx � VRF-1 (? O x x#x x x x x x x x x x x x x x x x x x x x x x x xxxxx K k x x x x xxxxxx a a a a a a a a a a a a W a a .......... a a v x x x x x x x x x x x x x x x x x x x x x x x x x X x x x x x x x x x x x x xxxxxx a a a a a a a a a a a a a a a a a a a a a a h a a xxxxxorxx xxxx aaaaxaaaa Haaa �Q- X10 -A xxxxxxxxxxxxxx xxxxx xx xx xxx xxxxx xxxxx xxxx xxxxxxxx xxxxxx �.aaaaaaaaaaaaa aaaaaaaaa as aaaaaaaaa aaaa xxxa xxx xx xxxxx xxxxxxx Kxx \ xxxxxxxxxxx xxxxxx aaaaaaaaaaaaaaaaaaaa aaaa xxxxxxx xxxxx xxxxxxxxx xxxxxx as aaaaaaaaaa0 �,��,� aaaaaaaa aaaaa aaaaa+ra xxxxxxxxx xxxxxxxxxx xxx , %;- : :x xxxx xxxxxxx xxxxxxx , ; aaaaaaaaaa �' � KITCHEN KITCHEN xxxxxxxxxxx ,xxxxxxxxx xx xxx xxxxxxxxxxxxxxxxxxx x x xxxxx --� rxxxxx xxxxxx �x,��*��„�� ,�. � x�w�,s��c� +,��,�c n,�,�,w<r�x .+x,xxx x xYxx�xxxxxxxxxxxxOxxxx,: xx<xxxxxxxxxxxxxxxxxxxxxxxxxxxxx x xxxxxxxxxxxsxxxx�xxxxaxxj-.xxxxxxxrxxxxxxxxxxxxxxxxxxxrxxxx .�i//'�—i/I,/'//,L1`/Irr',Lr r,./1'''/'III xx-xxxxxxxxxxxxxxxx xxxxxxxxxxxxxxxxxx � �,�— aaa as*aaa'�aa'�aa' a'xaaaaa�aadaabsaaaaaaa.a„ax*aaa�,aa�axa'_aaa axaaaa;sns' CLP-1CLP1 a �xxssxx -xxx xxxxxxxxxxxxx PT-3 PT-3 / rRB-1 V q F p�21 G ,Q xxxxxxxxxxxVPF1 -11 0 FNO , xxxxxxxxx xxxxxxxxx I 00 I '/ r,r ! xxxxxxx O O COAT CLOSET / r r ' i xxxxxxxx xxxxxxxxx xxxxxxxxxxxxxxxxxxx E COAT CLOSET issued date description 'J 1 'Ili xxxxxxxxxxxxxx+xxxx CLP-1 x xxxxxxxxxxxxxxxxxxx CLP xxxxxxxxxxxxxxxxxxx ! '/ (, I xxxxxxxxxxxxxxxxxxx RB-1 ' ; j " - - PT-1 1 03/15/19 Issued for Construction rr , / xxxxxxxxxxxxxxxxxxx RB-1 VPF-1 - xxxxxxxxxxxxxxxxxxxxx VPF-1 � t L—/ 1 I xxxxxxxxxxxxxxxxxxxxx xxxxxxxxxx xxxxxxxxx __ _ r/`r/ /' xxxxxxxxxxx Fxxxxxxxxx \ \\ \\ \\ \\ I /, /, /, /, / ,/rr/��rr r/��II xxxxxxxxxxx�x,rxxxxxxx LIVING ROO - I xxxxxxxxxxx-xxxxxxxxx \ \\ \ \\ \\ - LIVING ROOM CLP-1 / r r CLP-1'rr i rrr r/ rr ri rri / \\ \ \ \\ PT-1 PT-1 RB-1 r:-/ 1 r1 % rf/%r / rrr i/ lr irr r r, r \`1` \`\\` \ RB-1 VPF1 /, / // /r r ' r /rr / / / /, r / / / / r / / rr/, // \\ \\ \\ \\ VPF-1 UNIT NUMBER / / / / ; ,/r / r % UNIT NUMBER / r /� ' /� rr,/r / \\ \\ \ .' UNIT NUMBER 404&504 f i / r ''ri'rri/ri rri'rri rr 'i'' 402&502 r'rri rrr f''/i'''r/r'' \ \1 'N 405&505 UNIT TYPE r / / /i UNIT TYPE it/ri r/r fi/ri r r /i \ \l \ - E_I r rr rr // / i / \ \\ \ \\ \ UNIT TYPE /r // r /r rr rr rr rr B2 I B2 i� r '/ / / r / r / / / / / / C1 / / / r / / \ ,' \ / r, /, xxxx // r, ,�\\ \ 1\ L I E x rrr rrrrr/rrr/r///rxxxxx/ /r /rxxxxx //rxxxxx,/xxxx / / r / / / / r / / / / r / / / r r r r / I xxxxx xx / /r / /r / / / rrr / / / / / / / /r r/ rr /r rx /r1, / / /, /r / : r,"//,/, - i I — i I i title I SECOND FLOOR 7_ I I I I I I fl I I I I FINISH PLAN + CLP-1 CLP-1 CLP-1 CLP-1 CLP-1 CLP-1 PT-1 PT-1 PT-1 PT-1 PT-1 PT-1 + drawn by: --- RB-1 CB-1 RB-1 - RB-1 VRF-1 CPT-2 CPT-1 VRF-1 CPT-2 VRF-1 checked by: --- f BULK STORAGE ENTRY STAIRS BEDROOM BULK STORAGE ENTRY STAIRS BULK STORAGE scale: AS NOTED J vi ami project number: 10002 scaled inch Q 0 u sheet number 0 U Z BUILDING A 1 SECOND FLOOR FINISH PLAN a A11.02 SCALE: 3/16" = 1'-0" �- 'I- 8I- r----� - KITCHEN COUNTER TOP &SHELVING SUMMARY KITCHEN APPLIANCE LEGEND PLUMBING FIXTURE LEGEND COUNTER TOP SHELVING TAG DESCRIPTION TAG DESCRIPTION (LINEAL FT.MIN.) (LINEAL FT.MIN.) Ulu) KITCHEN 1 ELECTRIC RANGE 1 TOILET ' UNIT TYPE BEDS REQUIRED PROVIDED REQUIRED PROVIDED ❑ I 401 B 2 B.R. 6.0' 101.0 35.0' 46.5' 2 ACCESSIBLE ELECTRIC RANGE 2 ACCESSIBLE TOILET 402 C 3 B.R. 7.0' 14.2' 40.0' 54.3' 30 DISHWASHER 3❑ WALL MOUNTED ACCESSIBLE TOILET 403 D-ANSI 2 B.R. 6.0' 101.0 35.0' 46.5' ® ACCESSIBLE DISHWASHER ® COUNTERTOP WITH BUILT IN LAVATORY B E A T T Y HARVEY COC O ARCHITECTS , L L P 501 B .2 B.R. 6.0' 10.0' 35.0' 46.5' 50 REFRIGERATOR 5❑ WALL MOUNT ACCESSIBLE LAVATORY NEW YORK MARYLAND 502 C 3B.R. 7.0' 14.2 40.0' 54.3' © ACCESSIBLE REFRIGERATOR © 25"STAINLESS STEEL KITCHEN SINK 1300 Walt Whitman Road, New York, 11747 A p: (631)300-1010 503 B 2 B.R. 6.0' 10.0' 35.0' 46.5' O RANGE HOOD 7❑ SINGLE HANDLE LAVATORY FAUCET �- owner/developer ® SINGLE HANDLE/TUB FILL SHOWER HEAD Conifer Realty 1000 University Avenue Suite 500 NOTES: 9❑ KITCHEN FAUCET Rochester, NY 14607 1. PROVIDE FILLERS&SCRIBES AS REQUIRED FOR COMPLETE CABINET 585.324-0500 INSTALLATION. 10 SERVICE SINK FAUCET 2. FINISH EXPOSED CABINET END TO MATCH CABINET FRONTS. civil engineer 3. PROVIDE POWER TO ALL APPLIANCES. 11 ACCESSIBLE ROLL-IN SHOWER ENCLOSURE 4. PROVIDE"D"PULLS AT ALL CABINETRY IN ANSI UNITS. LKMA 5. ALL WALL AND BASE CABINETS TO HAVE FULL DEPTH SHELVES. 12 TUB&SHOWER ENCLOSURE 437 &405 6. ALLOW INSPECTION OF ALL APPLIANCES.PROVIDE APPROVED SUBMITTAL TO South Country Road Brookhaven, NY 11719 THE OWNER AND INFORM THEM IMMEDIATELY AFTER INSTALLATION.ENSURE 13 ELONGATED TOILET SEAT 631.286.8668 ENERGY STAR LABEL REMAINS ATTACHED TO PRODUCTS AND APPLIANCES. 7. PROVIDE BASE CORNER CABINET WITH 1 FIXED SHELF. 14 ELONGATED TOILET SEAT WITH OPEN FRONT m.e.p. & f.p. 8. PROVIDE MICROWAVE AS ADD-ALTERNATE. 9. REFER TO SPECIFICATION 113106 RESIDENTIAL APPLIANCES. 15 CUSTODIAL SERVICE SINK M/E Engineering, P.E. 150 North Chestnut Street 16 FLUSHOMETER Rochester, NY 14604 585.288.5590 17 POSI-TEMP VALVE NOTES: structural engineer 1. REFER TO SPECIFICATION 224000 PLUMBING FIXTURES. TDM Consulting Engineering 2. ALLOW INSPECTION OF ALL PLUMBING FIXTURES. 550 North County Road,Suite E 3. PROVIDE APPROVED SUBMITTAL TO THE OWNER AND INFORM THEM Saint James, NY 11780 IMMEDIATELY AFTER INSTALLATION. 631.686.5234 -------.1 I key N PLAN II II II II II II ° C, II II II -I{-C II----------------�I------i I II II I iN II II I II II I II II O II II � i 8'-6„ - „ I _ 2'-6" 2'6" 2'-6" 1'9" 1'-9" 1'0" 5 2'-6" k====2r-�I„====_ 4'-7" I 1 ioo 0 II ----- ---------- O I I I I 1 I I I I I I I 1 I N 0 0 0 1 1 ' I /I 1 1 ------I------ 1 61 1 TRUE p ' Al2.00 7 project 9 -- 1 L-- --------(- -;----� ------- VINEYARD VIEW 1 HIP L r DI- ----- LJ -IIF I=J County Road 48 I PE 1 1 I I I II , 1 � 3 0 6 0 ---ri----------Ji1 00 Greenport, NY 11944 I I 6 I I k----- ______ seal '�R�u Aq�,� -- --- / �E---------1-- I n- n I I � -L' �;r I L--___ .1 A O �5ljl.r \ � � \ i' / 111 11 II 11 C? _ o _ _ --_---- o II� rll 9 II II m .' M --------------- --- OF NF 2'0" 9" 2'9" 2'-0" a" 2'-0" 1'-8" 2'6" 1'S" 2'0" 1'9" 9" 2'0" Ir E 7'-634° 9'10" 4'-6" 7 734" r issued date description Q + 8 KITCHEN-C ELEVATION 8 7 KITCHEN-C ELEVATION 7 6 KITCHEN-C ELEVATION 6 5 KITCHEN-C FLOOR PLAN 4 1 03/15/19 Issued for Construction n 2 07/01/19 Prosect Bulletin No.4 Al2.00 SCALE: 112" = 1'-0" Al 2.00 SCALE: 112" = 1'-0" Al2.00 SCALE: 1/2" = 1'-0" Al2.00 SCALE: 1/2" = 11-011 "TYPE"B" KITCHEN PER ICC A117.1-2009 II �' II II L----------------II I 9'-0" 7-0" T-6" I " I 2'-0" 2'9" 3'0" " 1'-0" 1' 1'-0" 1._01. 2'•0" 2'-6" 2'0" CN i- --- 0 0 -------------- -0.1I -IF 0 0 I 1 I 1 0 o ----- 1 ------ J i \ i � � I I I I 1 1 I I title L----- --- I 1 \ I 1 1 KITCHEN � \ / N Fv - 5 / --- PLANS, "� �------------------------ ELEVATIONS 3 q o q 9 6 --------- i 4 Al2.00 3 t, ao bo zo co zo I 1 1 ®® --------------- & DETAILS ' I I r- --- / , �� ,/ O I + drawn by: --- 0 / ' 3 ------------------------ checked by --- ' j o 0 \ scale: AS NOTED \ • project number: 10002 I I scaled inch " 2'0„ 2,_9„ 1'6„ 9.. 2'-0" 7-0" 2'-0" 1'-0" 2'-6" 2'-0" �--- -------� o sheet nurnber U 0 9'-03 4" T-15" BUILDING A 4 KITCHEN-B ELEVATION 4 3 KITCHEN-B ELEVATION 3 TN� KITCHEN-B ELEVATION 2 1 KITCHEN-B FLOOR PLAN 0 6 Al2.00 SCALE: 112" = 1'-0" Al2.00 SCALE: 1/2" = 1'-0" Al2.00 SCALE: 1/2" = 1'-0" R s-� Al2.00 SCALE: 112" = 1'-0" Q) FFii�II-- . ;YP "B' I "i�.`r�NP �IC A117.1-2009 + + + + + + + gI� • 0 V KITCHEN COUNTER TOP & SHELVING SUMMARY KITCHEN APPLIANCE LEGEND PLUMBING FIXTURE LEGEND COUNTER TOP SHELVING TAG DESCRIPTION TAG DESCRIPTION (LINEAL FT.MIN.) (LINEAL FT.MIN.) KITCHEN 1O ELECTRIC RANGE 10 TOILET UNIT TYPE BEDS REQUIRED PROVIDED REQUIRED PROVIDED 401 B 2 B.R. 6.0 � �' 10' 35' 46.5' 2O ACCESSIBLE ELECTRIC RANGE 2❑ ACCESSIBLE TOILET , 402 C 3 B.R. 7.0' 14.2' 40' 54.3' 3O DISHWASHER 3❑ WALL MOUNTED ACCESSIBLE TOILET j 403 D-ANSI 2 B.R. 6.0' 10' 35' 46.5' ® ACCESSIBLE DISHWASHER ® COUNTERTOP WITH BUILT IN LAVATORY B E A TT Y HARVEY COC O A R C H I T E C T S , L L P 501 B 2 B.R. 6.0' 10' 35' 46.5' 5O REFRIGERATOR 5❑ WALL MOUNT ACCESSIBLE LAVATORY NEW YORK I MARYLAND 502 C 3B.R. 7.0' 14.2' 40' 54.3' © ACCESSIBLE REFRIGERATOR © 25"STAINLESS STEEL KITCHEN SINK 1300 Walt Whitman Road, New York, 11747 �A p: (631)300-1010 503 B 2 B.R. 6.0' 10' 35' 46.5' 7O RANGE HOOD El SINGLE HANDLE LAVATORY FAUCET +' owner/developer ® SINGLE HANDLEITUB FILL SHOWER HEAD Conifer Realty 1000 University Avenue Suite 500 NOTES: 9❑ KITCHEN FAUCET Rochester, NY 14607 1. PROVIDE FILLERS&SCRIBES AS REQUIRED FOR COMPLETE CABINET 585.324-0500 INSTALLATION. 10 SERVICE SINK FAUCET 2. FINISH EXPOSED CABINET END TO MATCH CABINET FRONTS. civil engineer 3. PROVIDE POWER TO ALL APPLIANCES. 11 ACCESSIBLE ROLL-IN SHOWER ENCLOSURE 4. PROVIDE"D"PULLS AT ALL CABINETRY IN ANSI UNITS. LKMA 5. ALL WALL AND BASE CABINETS TO HAVE FULL DEPTH SHELVES. 12 TUB&SHOWER ENCLOSURE 437 &405 6. ALLOW INSPECTION OF ALL APPLIANCES.PROVIDE APPROVED SUBMITTAL TO South Country Road THE OWNER AND INFORM THEM IMMEDIATELY AFTER INSTALLATION.ENSURE 13 ELONGATED TOILET SEAT Brookhaven, NY 11719 ENERGY STAR LABEL REMAINS ATTACHED TO PRODUCTS AND APPLIANCES. 7. PROVIDE BASE CORNER CABINET WITH 1 FIXED SHELF. 14 ELONGATED TOILET SEAT WITH OPEN FRONT m.e.p. &f.p. 8. PROVIDE MICROWAVE AS ADD-ALTERNATE. 9. REFER TO SPECIFICATION 113106 RESIDENTIAL APPLIANCES. 15 CUSTODIAL SERVICE SINK M/E Engineering, P.E. +B 150 North Chestnut Street 16 FLUSHOMETER Rochester, NY 14604 585.288.5590 17 POSI-TEMP VALVE structural engineer NOTES: 1. REFER TO SPECIFICATION 224000 PLUMBING FIXTURES. TDM Consulting Engineering 2. ALLOW INSPECTION OF ALL PLUMBING FIXTURES. 550 North County Road,Suite E 3. PROVIDE APPROVED SUBMITTAL TO THE OWNER AND INFORM THEM Saint James, NY 11780 IMMEDIATELY AFTER INSTALLATION. 631.686.5234 key N PLAN 0 p N� TRUE p project VINEYARD VIEW D County Road 48 Greenport, NY 11944 seal �E� A� GER J �O CSO .� sT 214 jE OF E LSE issued date description —I 1 03/15/19 Issued for Construction 2 07/01/19 Project Bulletin No. 4 30"WIDE ACCESSIBLE WORK SURFACE 9'-8 2" 7'-11y" 9'-8y2" 2'1" 1'-6y4" 2'-6„ 1'-6%" 2,_1, 2'-10%" 2'0" 2'_0" " 1'0" 1'0" 2" 2'0" 2'-9" 2'-0" 1'0" 1'6" 2'-6" 1'9" 1'-9" 2" 1'0" OO I I II I I II CV ---------------- --------- ------ C? , — ----- ---- — �� 1 II ;0J . 1, --1 II I I ❑ I II I 00 I I I ------------ --------- ®O® ---------LLI title U,. r KITCHEN c � cli PLANS =y =_ 'F_ = 30"WIDE ACCESSIBLE _ �_ =y C - __; _ ---- -- C ----- __ __---� _ \ —�---- --y— I I o WORK SURFACE o \\ '// \\ 0 // ��\ 0 '//// 'i 2 --------`I 6 9 � ELEVATIONS CO co 30"WIDE ACCESSIBLE " 4 Al .01 3------------ " --------___- & DETAILS WORK SURFACE ; r II �� II I ;I I checked by: --- / 4 I --------- I scale: AS NOTED / \ project number: 10002 I P i �i scaled inch II I 0 2'-0" 1'-0" " 2'-0" 2'-0" �z' 1'-0" 2'-9" 2'-0" a" 2'0" 6" 2'6" a" 2'-6" a" 2'-1" 4 ---- J sheet number 0 ri L---------------J 0 8,1/, 8'-Oy" 9,_8Y2 y' o G U � 4 KITCHEN-D-ANSI ELEVATION 4r_3_'_� KITCHEN- HivSl ELEVATION 3 2 KITCHEN-D-ANSI ELEVATION 2 1 KITCHEN-D-ANSI FLOOR PLAN BUILDING A A1 2.01 SCALE: 112" = 11-0" Al2.01 SCALE: 112" = 1'-0" Al2.01 SCALE: 112" = 1'-0" Al2.01 SCALE: 112" = 1'-0" "TYPE"A" BATHROOM PER ICC A117.1-2009 Q4 �� -- �+- + +3 +4 + 8 �- - +- �+ 0 151, 1 Ll BEATTY HARVEY COCO A R C H I T E C T S , L L P NEW YORK I MARYLAND 1300 Walt Whitman Road, New York, 11747 q p: (631)300-1010 � owner/developer Conifer Realty 1000 University Avenue Suite 500 Rochester, NY 14607 585.324-0500 civil engineer LKMA 437 &405 South Country Road Brookhaven, NY 11719 631.286.8668 m.e.p. &f.p. I I M E Engineering, P.E. B 150 North Chestnut Street Rochester, NY 14604 585.288.5590 structural engineer TDM Consulting Engineering 550 North County Road,Suite E Saint James, NY 11780 631.686.5234 key TRUE NORTH C O ❑ 0 0 l I project I _ d a I VINEYARD VIEW �I II I ® I i; - - 1 I ® 11\1\o �- FI-F - + County Road 48 Greenport, NY 11944 x xxxxxxxx xxxx III I.xxxK, -'-- x+x,xa.., ...,x.. sY- xxxxxxxrxxxx xxex xx �,r,c,cww,c,x x�r�,c rix Ixxxxxxxx xxxxx I III ' � � I✓xxxexx xx xr,y,,c �,c seal xx xxxxxxx xxxxx Ixxxx�x, xx x�r�arw,uwsx+ra ® ^� xxxxxxxxxxxxxxx xxxxxx xxxxxxxxxxxxxx Jaa:",n, xx f ED i xxxxxxxaxxaxxxxxrarxxxax sKx xx ro�sa,x,cx�,a+s,s,xwK �J��QaEG C�iT xxxxxx xxx xx xxxxxxxxx I 111 xxxxx xxxxxxexx xxxce,s,c x� x�x,x x�,xswx� __ __ - " xxxxxxxxx xxxxx I I � xx xxxxxxxxx�xx xx xx ,x 4,xxa,u��,+x,xaxi� ------_-_- �A xxxxxx xx xxxxxx xxx xxx III I xxxxxxxxxxxrxxxx+,� �x•.x ,cx,c n,ax�,c,. V ��, C xxxx xxxxx xxxxxxxxxxxx,y xx xxxxxxxxx xxx xxx xxxxx xxxKxxxxxx +.....x,..,xx,x...x, xxxxxxxxxxxxxxxxxxxxxxxxxxxx i II "w /1 xxxxxxxxxxx 1 ............xx x xxxx xxxxxxxxxxxxxxxxx xxxx xxxx xx 1" III x xxxxxxx xxxxx 'I k xxxx xxxxxxxrxx xxxxx nz,s,cxx,x,x x�,xsx x. xxx xxx xxxxxxxxxxxxxxxxxxxxx pp��rxxx xxxxxxxx xxx xxxxxxxx xxxxx xxxxxxxxxxxx II xx xxxxxx xxxvxx xxxx ks,y„�a..ra y,��xy, V�'xxxx xxxx xxxxxxxxx xxx xx xxxa� __1 `�'—,`�� I �k '"*xxxxxx xxxrxxxxxx �,.,.,.,.��,aw�xw II xxxxxxxxxxxexx xxxx xxx xxxxxxxxxxxxxxxx xx x xxxxxxxxxxxxx rxxxxxaxx xxxx ,�,�,�+�,wx��x,+,°,�,� xx xxxxxxx xxxxxxxxxxxxx xxxxxxx xxx xxx '�I I _ ,�,�,s�..�.,,c y,..,x x�x � I .� xx xxxxx _____ xxxxx xxxxxxxxxxxxx I _ � , n,�5 x„�e�.�W��x,� 1 xx xxxxx � -xxxxxx - xxxxxxxxxx xxx � I I �x,xax��x�a�a�xx _ ' I xxxxx xxxx xxx I j xx xxxxx I xxxxxx xxxxxxxxxx xxx i I I �,ar54W1�x�ay.ra,xxw _ __ xxxxxxxxx xxxx I I roa,sra�,s,x�+x,x m,c,� xxxxxxxxxx xxx --- J .. +�rax� +� w :wa r— , r---- � ---- xxxxxxxxxxxxx , a xxx x w O �` x xxxxxxxxxxxx xxxxxx II OO I i __ O I II I _—__� _- ____ `- _ _ s/r f�//l issued date description O I L ' I I 1 03/15/19 Issued for Construction fl /I I J J1 ML _ II - -------- ------- ML a . title LL d ° ° ° ° ° . . d . d . . ° . D ° ° • . • ° ° G • • ° °° . • • ° ° • ° • °d . • • • ° D . °` • ° • F d• and • ° • + • • ° f d• and • ° ° Do °•� � ° ° ° ° .d a • d4 •d • ° FIRST FLOOR ° ° • • ° . • I . • ° • p d° • • . d + ° • ° ° . . . •� • °�• ° ° FURNITURE PLAN • •° • d • ° Oe• M� �� °•. • n°O • • ° ° UNIT NUMBER: 401 &501 UNIT NUMBER: 402&502 UNIT NUMBER: 403&503 TI U drawn by: --- UNIT TYPE: B1 UNIT TYPE: C1 UNIT TYPE: B1 checked by: --- BEDROOMS: 2 BEDROOMS: 3 BEDROOMS: 2 CL GROSS AREA: 986 S.F. GROSS AREA: 1357 S.F. GROSS AREA: 986 S.F. scale: 3/16"= 1'-0" NET AREA(HCR): 926 S.F. NET AREA(HCR): 1267 S.F. NET AREA(HCR): 926 S.F. project number: 10002 U scaled inch 0 sheet number U O U z 1 FIRST FLOOR FURNITURE PLAN BUILDING A A13.01 SCALE: 3/16" = 1'-0" F- 3+- �- N O 911�1' .41 BEATTY HARVEY COCO A R C H I T E C T S , L L P NEW YORK I MARYLAND 1300 Wait Whitman Road, New York, 11747 p: (631)300-1010 owner/developer Conifer Realty 1000 University Avenue Suite 500 Rochester, NY 14607 585.324-0500 civil engineer LKMA 437 &405 South Country Road Brookhaven, NY 11719 631.286.8668 m.e.p. &f.p. WE Engineering, P.E. B 150 North Chestnut Street Rochester, NY 14604 585.288.5590 structural engineer TDM Consulting Engineering 550 North County Road,Suite E Saint James, NY 11780 631.686.5234 key TRUE NORTH \ O \\\ \\ \\ \\ \ \\ \\ \\ \ \ \\ \\ \\ \\ \\ \\ \\ \\ \ \\ \\ \\ \ o /, !, ! - _I' /•:.x�F.'/i,��/rrxxxxxxxxxxx xYY—J//i r!r,//xxxxxxxxx+xr/,—rr//xxxxxxxxxYiIII iiIIIIII//ii--rJ,/xxxxxxxxX—/�—/rrxxxxxxxxx�/rii/,//xxxxxxxxxxxI�xxrI1II�/!�!rrrxxxxxxxxxxxxxx/rri/rF/�!r,!!xxxxxxxxxxxxxXxr!rLJr//rxxxxxxxxxxxxxxx�ri//i/r�/,xxxxxxxxxxxxxxxr'/r/rrxxxxxxxxxxxxxx71//rr/�r!,,/xxxxxxxxxx7rrr rIII/rrxxxxxxxxxx!/ir_�,rr xxxxxxxx+x///_,r/xxxxxxxxxxiii!/r/r/,/_r!r!!!//!xxxxxxxxxxr!,!,//!//r///_xxxxxxxxxxrri/irir/,•-/'///,//xxxxxxxxxx_t,/r/,%///rrr x xxxxxxxxx xxxxxxxxxxx_xxxxrxxxr/////,,/r'%!xxxxxxxxxxV xxxxxxxxxxxxxxxxxxxr/xrr/ri_,r,,,xxxxxxxxxxxxxxxxxxxxxxxxxxxxxr///xr_!/,,/'rxxxxxxxXxx�xxxxxxxxxxxxxxxxxxx////////i IIII_r,,,/xxxxxxxxxxxxxxxxxxxxxxxxxxxxx////`/,,,_/'%rxxxxxxxxxxixxxrxxxxxxxxxxxxxxr!////'xr/i r!,!,,xxxxxxxxxx�xx///xxxxxxxxxxxxxxxxx/;;Ir,,!r,'rxxxxxxxxx`>rF.xxx////.xx:xxxxxxxxxxxx/r/rr/,,rrxxxrxxxxxxxxx.xxxxxxxxxxxxxxxxxxxx//r/'/,,/r'%/xxxxxxxxxxxxx.xxxxxxxxxxxxxxxxxxx////r//,.',,,FFFFFFFFFFFFFFF%,�,�xxxxxxxxxxxxxxxxxX/Jr/rr/!r'rxxxxxxxxxxxxxxxxxxxx////xxxxxxxxxxxxx!i!ri/!,rr,,xxxxxxxxxxxxxxxxxxxxxxxx///xxxx+xxx///r/,/xxxxxxxxxxxxxxxxxxxxxxxxxxxx//!1r/rrri,,/,4 x xxxxxxx(xxxxxxxxxxxxxxxxxxxr/I'xxxxxxxx7>xxxxxxxxxxxxxxxxxx//—®®®,xxxxxxxxxxxxxxxxxxxxxxxxxxxx-r/—xrxx�xxxxxxxx xxxxxxxxxxrxxxxxxxxx/f,x�xxx,.xxxxxxxxxxxxxxxxxxx^ i!I''�+' �xraxx.��s5m�\�x'�5,cxxF"w��"na�.xc.•\\\�\\\��",.s'\\ranRN�a��ro1\;'�5�x*aroxx.x�n��xx,i�\\'\\\�`�`YNwsxrai\\�cew�ww\\\\."�*xxaroxyula��n"—k',�\\\\��\\�"\\\•wx4T�w+swrax+.\\;"xxs�"wxx+�xc+��x"��•�.\\',�\\��xn'�++�ra�M�\\�nRWa»"�wsx�rau��<'�\\\\,\""i,-�x+yW�wxxaxx\\\\\xwWc�a"xx��x��,'�1\\\\1`��\`xxy��d�F\\\\\\\\xw+xs.s��+xra�"nrak,1\��\\\\"�\\\\-,a•\sayx+�ettx\\\-\ x�x5�x��*xs+n�nsx,'r'\�`�\\\�`�\��_�rx\�ro✓.+xx\\\x��xgxw�xcuxx"�.k,uc,\\\'\\\\�",\� .�,mw,vsNx[sy \\ WsX \\•+vzxx�s�na\x"x✓xx.x.,�',�� a"ce5 - \\\\\\\\\\\\\\\\\\\\\\\\ \\\1,\\\\�\\\\rl��'•5ceak4�aarx\\\\\�(,ukI\\\\--KMk'awa✓ce�5n✓� \\\\\xFt,\\\\\\\+\s,xxwkNy Rraxxra\\\\\k��\\\\.+5a+45iw�a*+r\\\\\ck.x.'`\\\\\\axx+Kxx��rarx\x\\\xx,f�e,�\\\\\++Fxx>�4x5�x��\\\\\\rii��\\\\\\\\I wa�ssx�5��x��\\\\\\y kkkp�q_\\\\'+c�vNnx5\\\\\ik�_\\\\\\\\�wz�✓�m+5KF\\\\\\\xkx�\\\\\\_—s5ce�55��xM\\\\\\\\k.,,,(\\\\`\\\\\/�(_—�i�S+Lw'5��\\\\\\\c.\\\\\\ \�+xx5�4��✓ \\\\\—x+TTx�\\�k�,i\—xy�5YS•�\\\—\c�i�\\\\\\L t1I1Ix�o�1II1II�k\\ \ sxku—� \ S55+sw%k��zwx\\ \ c. II project roje ct El = VINEYARD V �C17 IE 2W r � County Road 48 � ��;;; ;�; seal RED ^ ............. BE ........... .x....Y..... ,o yO xxxxxxxxxxxx x.xxFxxxxxxx T "Ixxxxxxxxxx ............... xxxxxxxx xxx O O ----- O j O O OO E F 1 03/15/19 Issued for Construction 44- Ilk IIklII1 xxxxxxxxxxx /rr1 ' rx titleSECOND FLOOR FURNITURE PLAN + UNIT NUMBER: 404,504 UNIT NUMBER: 405,505 drawn by: --- UNIT TYPE: B2 UNIT TYPE: B 2 checked by: --- }UQNmUz BEDROOMS: 2 1 BEDROOMS: 2 GROSS AREA: 1054 S.F. GROSS AREA: 1054 S.F. NET AREA(HCR): 1000 S.F. NET AREA(HCR): 1000 S.F. scale: 3/1 6"= 1'-0" project number: 10002 scaled inch 0 sheet number UO SECOND FLOOR FURNITURE PLAN BUILDING A - o A13.02 SCALE: 3/16" = 1'-0" @ H 4H+ +2 + +5 +6 9 13002m N ch NOTES U-1111.1 I 1. AFTER PROPERTY GROUNDS ARE GRADED AND AGGREGATE IS LAID,THEN THE VENT STACKS ARE INSTALLED. y' 2. ALL VERTICAL RISERS ARE VENTED THROUGH THE ROOF AND ARE NOT TO BE CAPPED.EACH VERTICAL RISER . WILL BE STUBBED TO AN AFPROXIMATE HEIGHT OF 12 INCHES ABOVE THE FLOOR.EACH STUB THROUGH THE CONCRETE FLOOR SHALL HAVE A TEMPORARY CAP UN11L SOLID 4"DIAMETER PIPE RISERS ARE CONNECTED. EXHAUST POINTS SHALL BE A MINIMUM OF 12" ! - 3. THE DESIGNATED CONTRACTOR SHALL APPLY A VAPOR BARRIER BEFORE THE POURING OF THE CONCRETE ABOVE THE ROOF SLAB.THE VAPOR BARRIER SHALL BE TIGHT AND CARE SHALL BE TAKEN TO ENSURE THAT MINIMUM DAMAGE AND SURFACE.THE VERTICAL h T.O.ROOF TRUSS RIDGE _ PUNCTURES OCCUR TO THE:VAPOR BARRIER.ALL SEAMJOINTS FOR THE VAPOR BARRIER SHALL BE OVERLAPPED RISER ROOF EXHAUST ELEV.+25'4" A MINIMUM OF 12 INCHES.ANY PIPE PENETRATION INTERFACES THROUGH THE VAPOR BARRIER SHALL BE SEALED WITH VULKEM POLYURETHANE CAULKING.IT IS ALSO RECOMMENDED THAT THE SEAMS BE SEALED WITH PIPE SHALL BE ELBOWED EXHAUST POINTS SHALL BE AMINIMUM OF - -__� CAULKING OR A TYPE OF ADHESIVE. WITH A 180 DEGREE I � _ BEATTY HARVEY COC O SCHEDULE 40 4"ELBOW 12"ABOVE THE ROOF SURFACE.THE I - ARCHITECTS , L L P 4. ALL UPPER FLOOR PENETRATION HOLES FOR THE VERTICAL RISERS SHALL BE ROUTED WITH SCHEDULE 40 4" VERTICAL RISER ROOF EXHAUST PIPE I SOLID PVC PIPING THROUGH THE ROOF.ALL FLOOR HOLES SHALL BE PROPERLY DRILLED AND PREPPED BY THE WITH VENT GRILL � J \ NEW YORK MARYLAND _ SHALL BE ELBOWED WITH A 180 DEGREE DESIGNATED CONTRACTOR WITH ADHERENCE TO ALL BUILDING AND STRUCTURAL INTEGRITY CODES.ALL SCHEDULE 40 4"ELBOW WITH VENT GRILL \ 1300 Wa It Whitman Road, New York, 1 1747 +VERTICAL RISERS FLOOR PENETRATION INTERFACES SHALL BE FIRE SAFED.A COVER FLANGE SHALL BE 1 I A p: (631)300-1010 INSTALLED TO COVER THE PENETRATION INTERFACE. �--� I I � ` I- owner/developer 5. THE ROOF EXHAUST HOLES SHALL BE CUT BY THE DESIGNATED CONTRACTOR FOR ROUTING VERTICAL T I I I I I I I I I I 1 11I I . RISERS THROUGH THE ROOF.THE DESIGNATED I ' Conifer Realty CONTRACTOR SHALL THEN PROPERLY SEAL THE ROOF OPENINGS AND PIPE EXHAUST PENETRATIONS I 1000 University Avenue Suite 500 ACCORDING TO SPECIFICATIONS,CODE,AND STANDARD OF PRACTICE. --J Rochester, NY 14607 1 585.324-0500 6. IF THE ROOF EXHAUST POINT FROM THE RISERS IS LESS THAN 10 FEET FROM FRESH-AIR RETURN,THEN THE EXHAUST POINT WILL HAVE TO BE ROUTED TO MEET THE 10 FEET CLEARANCE REQUIREMENT. I civil engineer 7. THE EXHAUST POINTS SHALL BEA MINIMUM OF 12 INCHES ABOVE THE ROOF SURFACE.THE VERTICAL RISER 1 ROOF EXHAUST PIPE SHALL BE ELBOWED WITH A 180 DEGREE SCHEDULE 40 4"ELBOW.THIS PROCEDURE WILL i, j LKMA ENSURE THAT MINIMUM RAI V AND OTHER WATER WILL REENTER THE VENT STACK,EACH VERTICAL RISER SHALL F_ i 437 &405 ALSO HAVE A GRILLED EXHAUST VENT.THIS VENT CAP CAN BE PURCHASED FROM VARIOUS SOURCES.THIS i South Country Road PROCEDURE WILL PREVENT SMALL DEBRIS AND VERMIN FROM INFILTRATING THE VENT STACK. . . . — T� —'- j Brookhaven, NY 11719 I I I IFF 631.286.8668 8. VENT STACKS SHALL NOT PENETRATE THE ROOF ASSEMBLY THROUGH VALLEYS OR FIRE RETARDANT I PLYWOOD.SHIFT IN TRUSS SPACE TO CLEAR SUCH ASSEMBLIES. I m.e.p. &f.p. 9. ALL EXPANSION JOINTS AND WALUFLOOR JOINT INTERFACES SHOULD BE FIRE SAFED.ALL ROOF PLAN I I M/E Engineering, P.E. g MANUFACTURERS'S PREPPING,CLEANING AND APPLICATION SPECIFICATIONS SHOULD BE FOLLOWED. FUTURE INLINE EXHAUST FAN.PROVIDE i 1 150 North Chestnut Street DEDICATED RECEPTACLE I + Rochester, NY 14604 10. ALL PIPE AND CONDUIT FLOOR PENETRATION INTERFACES SHALL BE SEALED AND FIRESAFED. -t - - I i 585 288 5590 11. CARE SHOULD BETAKEN TO SEAL BLOCK WALL PENETRATIONS WITH CAULKING. I I structural engineer 12. THE BLOCK WALLS SHOULD HAVE A CAPPED BLOCKAT THE TOP. TDM Consulting Engineering IS _ I 1 I I 550 North Count Road Suite E 13. AFTER THE BUILDING L,BUILT BEFORE CARPET AND DRYWALL IS INSTALLED,A CAREFUL INSPECTION SHOULD 4"PVC PIPE CONTINUOUS— ! 1 � y BE MADE OF THE CONCRETE FLOOR FOOTPRINT AND WALLS TO ENSURE THAT THERE ARE NO MAJOR STRESS I j ^� I Saint James, NY 11780 CRACKS,VOID HOLES,AND OTHER PENETRATIONS THAT MAY BE POTENTIAL SOIL VAPOR ENTRY POINTS.ANY &UNINTERRUPTED \ /� � y�'• I I 631.686.5234 I I OBSERVED POTENTIAL SOIL VAPOR ENTRY POINTS SHALL BE SEALED WITH POLYURETHANE CAULKING. (LABELED) r l T.O.SECOND FLOOR TOP PLATE -- - - ------------------------------------------- - 14. ALL TOILET PLUMBING PIPE PENETRATIONS SHALL BE SEALED AT THE FLOOR INTERFACE. ELEV.+17'-9" �I 15. PROVIDE ELECTRICAL CONNECTIONS AT ROOF FOR=UTURE FAN INSTALLATION AT VENTS.COORDINATE WITH - ELECTRICAL DRAWINGS. K \\ -- O / w �i key Lam: p a I y TRUE ._..._:._ _.._ -= � O O v •ssil � NORTHJ I I i __.—_ — --- -�- - _ J - + r_ �I I _ I - l O 111 T T. T _ ._ ;TTr _ -_7_,- project 44 y _ _ - �rlr'�rrLr��1 � � -_ - -- - J I I'° / ,., 77771_ T Ts ? _ srI = —==1; VINEYARD VIEW _4 y / D I :n N \\\ •--IIn-J- \ I I - I� County Road 48 - -- � �-. � - - =-- i —,, \\\ Greenport, NY 11944 - seal ALL VERTICAL RISER FLOOR PENETRATION \\ ��R_D Aq 4"PVC PIPE CONTINUOUS INTERFACES SHALL BE FIRE SAFED.A �SvA�0RE C, ch/) &UNINTERRUPTED f COVER FLANGE SHALL BE INSTALLED TO \\ FO (LABELED) ~1 � COVER THE PENETRATION INTERFACE. \ O Ll ',I I -� { ---� --- T.O.SECOND FLOOR SUBFLOOR ELEV.+9'-7 Q i 6.a, i i ��F NES w 1c.C� -_ c, .-. =_ issued description date desc _ .. . _ —_ I I 41 E _ / -, oo � = r I I - is O o i� -••- 1 03/15/19 Issued for Construction - i i / -------------------------------------------- 71) "F cm 4"DIAMETER PVC PIPE CONTINUOUS& F F - - - - - - - - a' UNINTERRUPTED(LABELED) , �— — — L — J — — J ADHESIVE SEALANT CLAMPING RING title 1 I I I VAPOR BARRIER PIPE BOOT 4"DIAMETER PVCbD PASSIVE SOIL-GAS COLLECTOR i I 1 SEALANT&BACKER ROD \ `\ PERFORATED PIPE&TEE I I CONNECTOR I INaI "COMPRESSIBLE SEALER-PERMANENT, \\ ` RADON-RESISTANT l l I I GAS TIGHT SEAL 1 I 4"POURED CONCRETE SLAB SYSTEM L- ------- -----1 i C-34, i ---- ------- i PVC'7FITTING \ I 1 F T I 4"PERFORATED PVC PIPE. 11'-7"j 15'-3" 6 MIL CLASS"A"VAPOR BARRIER UNDER drawn b ENTIRE SLAB \ checked by: F_ I `„ co l I I boI h T.O.FIRST FLOOR SLAB N scale: N.T.S. 1 I I "' ELEV.0-0 I I I I I 1 --°--s- ° project number: 10002 1 I I I I 6"GAS-PERMEABLE LAYER OF RCA 1 I I I 1 AGGREGATE SIZE 1"TO 1%" o scaled inch ° o o I I 1 J °. /\\/\\j\/�\/�\/\\/\\�\\j\\/\\/\\/\\ sheet number a I L - - - - - - J UNDISTURBED NATURAL SOILS OR // // o I- - - - - r ° - \\ \\\\\ \\ \\ \\ \\ \\ U L _ _ _ — — _ _ COMPACTED ENGINEERED FILL �� \// \//\ \ L — — — — J — — — — — — — — — — r / BUILDING A a� L - - - - - - —� L — — — — — — J i X/ BUILDING/ / //\//\//\////i\/i\//�//\//\//\//\//\//\/\ T I a �---------�__�l I 1 BUILDING SECTION I— 0 --------��J Low------LA14.00 SCALE: 3/4" = 1'-0" a) FOUNDATION PLAN `\ m �- 1 H 1 3� 41 51' 7 g{- H 4 ,900 + �- 9-I-- a GENERAL N GRAVITY DESIGN LOAD SCHEDULE (ALL LOADS SHOWN ARE IN POUNDS PER SQ. FT.) 5D , - CODES AND STANDARDS WOOD FRAMING \COMPONENT 1. ALL WORK SHALL CONFORM TO THE REQUIREMENTS OF THE NEW YORK STATE UNIFORM FIRE PREVENTION & BUILDING 1. LIGHT FRAME CONSTRUCTION HAS BEEN DESIGNED IN ACCORDANCE WITH THE FOLLOWING 2016 NYSUC REFERENCES: Q � CODE,2017 UNIFORM CODE SUPPLEMENT AND,AS REFERENCED,THE 2015 INTERNATIONAL BUILDING CODE. 1.2015IBC,CHAPTER 15 �, N 2.2015 AWCC SDPWC ¢ c 2. WHERE MORE STRINGENT,THE LATEST EDITION OF THE FOLLOWING CODES SHALL APPLY TO WORK: 3.2015 ANSI/AWC NDS. W " 4. 2015 AWC WFCM. LD A. ACI 301, SPECIFICATION FOR STRUCTURAL CONCRETE FOR BUILDINGS z m = mCD BEATTY HARVEY COCO B. AISC "SPECIFICATION FOR STRUCTURAL STEEL BUILDINGS-ALLOWABLE STRESS DESIGN AND PLASTIC DESIGN." 2. ALL TIMBER WORK SHALL COMPLY WITH DOC PS 20, "AMERICAN SOFTWOOD LUMBER STANDARD" OR EQUAL. o mo W o A R C H I T E C T S , L L P C. AISC "CODE OF STANDARD PRACTICE FOR STEEL BUILDINGS AND BRIDGES," LATEST EDITION, -' "' " -J NEW YORK I MARYLAND D. "STRUCTURAL WELDING CODE -STEEL",ANSI/AWS D1.1, BY THE AMERICAN WELDING SOCIETY. 3. ALL NEW GENERAL FRAMING LUMBER SHALL BE #2 OR BETTER GRADE DOUGLAS FIR OR HEM-FIR. (MIN BASE DESIGN: E. "BUILDING CODE REQUIREMENTS FOR STRUCTURAL CONCRETE",ACI 318. FB=825 PSI, FV=75 PSI, FC(PERP)=370 PSI, E=1,300,000 PSI) INSULATION 3 3 3 3 5 1300 Walt Whitman Road, New York, 11747 + (2XB=825*1.15*1.2=1139,2X10=825*1.15*1.1=1044,2X12=825*1.15=949) p: (631)300-1010 GENERAL FRAMING 5 5 5 5 5 owner/developer 1. IF THERE IS A DISCREPANCY ON THE CONSTRUCTION DOCUMENTS, THE ARCHITECT/ENGINEER SHALL BE NOTIFIED 4. ALL LUMBER SHALL BE PROPERLY SEASONED AND SHALL BE NEW UNLESS OTHERWISE APPROVED BY THE ARCHITECT/ENGINEER. MEP 3 3 3 3 5 Conifer Realty IMMEDIATELY SO THAT IT MAY BE RESOLVED. UNLESS OTHERWISE NOTED, THE MORE CONSERVATIVE INTERPRETATION 1000 University Avenue Suite 500 OF THE CONSTRUCTION DOCUMENTS SHALL APPLY, 5. ALL LUMBER DIMENSIONS, AFTER SEASONING, SHALL CONFORM TO THE MINIMUM DIMENSIONS REQUIREMENTS AS PER PARTITIONS 3 3 3 3 - Rochester,NY 14607 PS-20. 585.324-0500 2. THE CONTRACTOR SHALL BE RESPONSIBLE FOR ADEQUATELY BRACING AND PROTECTING ALL WORK DURING SUBFLOOR 8 88 12 3 CONSTRUCTION AGAINST DAMAGE, BREAKAGE, COLLAPSE, DISTORTION, AND MISALIGNMENT, THE CONTRACTOR SHALL 6. ALL LUMBER SHALL BE FREE FROM KNOTS, SHAKES, ROT OR OTHER DEFECTS. I civil engineer BE FULLY RESPONSIBLE FOR MEANS AND METHODS OF CONSTRUCTION. TOTAL DEAD LOAD 22 22 22 26 18 7. CONTRACTOR SHALL REFER TO ARCHITECTURAL DRAWINGS FOR ROUGH CARPENTRY FRAMING AND DETAILS. LKMA 3. ALL EXISTING CONDITIONS SHALL BE CHECKED AND VERIFIED IN THE FIELD BEFORE WORK IS BEGUN. ANY OBSTRUCTION 437 8.405 ENCOUNTERED DURING EXCAVATION, DEMOLITION, OR CONSTRUCTION SHALL BE REPORTED TO THE 8. ALL NEW FLOOR AND ROOF JOISTS, HEADERS AND TRIMMERS AND OTHER HORIZONTAL WOOD MEMBERS SHALL BE SET South Country Road ARCHITECT/ENGINEER IMMEDIATELY SO THAT CORRECTIVE MEASURES OR ADJUSTMENTS CAN BE MADE. WITH THE CROWN EDGE UPWARD, Brookhaven, NY 11719 631.286.8668 4. PRIOR TO CONSTRUCTION, THE CONTRACTOR SHALL VERIFY ALL STRUCTURAL ELEVATIONS AND DIMENSIONS WITH 9. ALL WOOD BEAMS BEARING ON MASONRY SHALL HAVE A MINIMUM BEARING OF 411 EXISTING CONDITIONS AND WITH OTHER PROJECT DRAWINGS. ANY DEVIATIONS SHALL BE BROUGHT TO THE m.e.p. &f.p. ARCHITECT/ENGINEER'S ATTENTION, 10. ALL WOOD BEAMS BEARING ON STEEL SHALL HAVE A MINIMUM BEARING OF 2" LIVE LOAD M/E Engineerin , P.E. + 5. THE CONTRACTOR SHALL FURNISH ALL CERTIFICATIONS, LABORATORY TEST REPORTS AND INSPECTION REPORTS 11. JOIST HANGERS, HOLD DOWN CLIPS, ETC. SHALL BE SIMPSON, TECO OR APPROVED EQUAL SECURED WITH ANNULAR 150 North ChestnutStreet REQUIRED. NAILS AS PER MANUFACTURER) PROVIDE SADDLE-TYPE, HEAVY DUTY BEAM HANGERS AS REQUIRED. �4 12 10 0 30* Rochester, NY 14604 585.288.5590 6. CONTRACTOR SHALL COORDINATE STRUCTURAL DRAWINGS WITH ARCHITECTURAL, MECHANICAL & ELECTRICAL 12. ALL JOISTS SHALL BE CROSS-BRIDGED WITH 1-1/4"X3" BRIDGING AT MIDSPAN OR INTERVALS NOT TO EXCEED 8'-0" O.C. DRAWINGS, AND SECURELY NAILED AT EACH END. BRIDGING SHALL NOT BE NAILED UNTIL AFTER PARTITIONS ARE IN PLACE. structural engineer PROVIDE SOLID BRIDGING BETWEEN BEAMS OVER GIRDERS AND PLATES OF BEARING PARTITIONS. METAL BRIDGING TDM Consulting Engineering 7. OPENINGS IN WALLS, ROOF, ETC. SHALL BE COORDINATED, SIZED, FURNISHED, AND INSTALLED PER MECHANICAL, STRAPS MAY BE SUBSTITUTED AND INSTALLED ACCORDINGLY. 550 North County Road,Suite ELECTRICAL, AND PLUMBING REQUIREMENTS, EVEN IF NOT SHOWN AS SUCH ON ARCHITECTURAL OR STRUCTURAL TOTAL LOAD 62 147 122 86 48 Saint James, NY 11780 DRAWINGS. 13. PROVIDE A MINIMUM ONE HALF INCH AIR SPACE BETWEEN WOOD AND CONCRETE OR MASONRY. OTHERWISE, PROTECT 631.686.5234 8. THE CONTRACTOR SHALL NOT MAKE DEVIATIONS FROM DESIGN DRAWINGS WITHOUT WRITTEN APPROVAL FROM THE OR TREAT WOOD IN CONTACT WITH CONCRETE OR MASONRY. T* SNOW LOAD ARCHITECT/ENGINEER. WOOD FRAMING- PLYWOOD 9. ALL SECTIONS AND DETAILS SHALL BE CONSIDERED TYPICAL AND APPLY FOR THE SAME AND SIMILAR CONDITIONS, 1, ALL PLYWOOD SHEATHING SHALL COMPLY WITH APA. PLYWOOD SHALL MEET C-D INTERIOR APA, STRUCTURAL I AND it key UNLESS OTHERWISE SPECIFICALLY NOTED. C-D-INTERIOR APA OR STRUCTURAL I AND II,C-C EXTERIOR APA. 9 CONCRETE 2. 16. STRUCTURAL FLOOR AND ROOF SHEATHING, INCLUDING ALLOWABLE SPANS, SHALL COMPLY WITH SECTION NORTH 1. ALL CONCRETE WORK INCLUDING BUT NOT LIMITED TO CONCRETE MIX DESIGN, REINFORCEMENT DESIGN, PLACEMENT, 2304.8 OF THE 2015 INTERNATIONAL BUILDING CODE INCLUDING TABLE 2304.8(3) SUBNOTE D AND SUBNOTE F. ^ + DURABILITY, FORM WORK, SEISMIC REQUIREMENTS, AND QUALITY AND TESTING SHALL BE IN ACCORDANCE WITH 3. PLYWOOD SHALL NOT EXCEED THE SPANS INTENDED FOR USE ON THE GRADE STAMP AND SHALL BE OF THE FOLLOWING + CHAPTER 19 OF THE 2015 INTERNATIONAL BUILDING CODE, AND ALL APPLICABLE REFERENCE STANDARDS AS SPECIFIED THICKNESS, UNLESS NOTED OTHERWISE: SNOW L O A D DESIGN S C H E D U L E IN THAT CHAPTER, INCLUDING BUT NOT LIMIT TO "BUILDING CODE REQUIREMENTS FOR STRUCTURAL CONCRETE", ACI 318 AS AMENDED IN THIS CHAPTER. FLOORS: 3/4" T&G ROOFS: 3/4" T&G INTERNATIONAL BUILDING CODE (2015) was 2. ALL CONCRETE SHALL HAVE A MINIMUM COMPRESSIVE STRENGTH (fc) OF 4000 P.S.I. REQUIREMENTS FOR f'c SHALL BE WALLS: 5/8" BASED ON CONCRETE CYLINDER TESTS, TESTED AT 28 DAYS, AS PRESCRIBED IN SECTION 1905.6.3 OF THE NEW YORK ITEM SYMBOL MIN STATE BUILDING CODE. 4, ALL PLYWOOD SHALL BE GLUE NAILED TO THE FLOOR JOISTS USING AN APA APPROVED ADHESIVE. (B.F.GOODRICH PL400 3. CEMENT USED TO PRODUCE CONCRETE SHALL COMPLY WITH ACI 318,SECTION 3.2. OR EQUAL). GROUND SNOW LOAD Pg f 4. REINFORCING STEEL SHALL CONFORM TO ASTM A-615, GRADE 60, EXCEPT STIRRUPS AND TIES WHICH MAY BE GRADE 40. EARTHWORK SNOW EXPOSURE FACTOR Ce B (1.0) 1. THE FINISH EXCAVATION FOR FOUNDATIONS SHALL BE NEAT AND TRUE TO LINE WITH ALL LOOSE MATERIAL REMOVED. project 5. ALL AGGREGATES USED IN CONCRETE SHALL COMPLY WITH ACI 318,SECTION 3.3. SNOW LOAD IMPORTANCE FACTOR IS 1.0 6. WATER USED IN MIXING CONCRETE SHALL BE CLEAN AND FREE FROM INJURIOUS AMOUNTS OF OILS, ACIDS, ALKALS, 2. FOUNDATION EXCAVATIONS SHALL BE KEPT FREE OF LOOSE MATERIAL AND STANDING WATER. VINEYARD VIEW SALTS, ORGANIC MATERIALS OR OTHER SUBSTANCES THAT ARE DELETERIOUS TO CONCRETE OR STEEL THERMAL FACTOR Ct 1.0 REINFORCEMENT AND SHALL COMPLY WITH ACI 318, SECTION 3.5, 3. BACKFILL WITHIN BUILDING AREA SHALL BE MECHANICALLY COMPACTED IN LAYERS, FLOODING WILL NOT BE PERMITTED. FLAT ROOF SNOW LOAD (.7*1.0*1.0*1.0*2.0) Pf 30 p'Sf)lIN.) --I-- 7. ADMIXTURES USED IN CONCRETE SHALL COMPLY WITH ACI 318, SECTION 3.6 AND SHALL BE SUBJECT TO PRIOR 4. ALL EXISTING FILL MATERIAL SHALL BE REMOVED AND REPLACED WITH ENGINEERED FILL AS SPECIFIED IN THE T APPROVAL BY THE ENGINEER. AIR ENTRAINMENT IS PERMITTED TO BE USED IN EXTERIOR CONCRETE. GEOTECHNICAL REPORT. County Road 48 8. SPLICING OF REINFORCEMENT IS PERMITTED ONLY AT LOCATIONS SHOW ON THE CONTRACT DRAWINGS OR AS 5. ALL STRUCTURAL FILL SHALL BE INSTALLED IN NINE (9) INCH LIFTS AND COMPACTED TO 95% OF ITS MAXIMUM DENSITY Greenport, NY 11944 ACCEPTED BY THE ENGINEER, UNLESS OTHERWISE NOTED, REINFORCING STEEL SHALL BE SPLICED TO DEVELOP ITS AT OPTIMUM MOISTURE AS DETERMINED BY MODIFIED PROCTOR DENSITY TESTS (ASTM D1557), THE EXISTING SITE FILL seal FULL TENSILE CAPACITY IN ACCORDANCE WITH ACI 318. SOF NEP,,,, Q'� MAYBE USED IF IT CONFORMS TO GRADATION REQUIREMENTS AND IS APPROVED BY THE GEOTECHNICAL ENGINEER. 9. MINIMUM CONCRETE COVER FOR REINFORCEMENT SHALL BE AS GIVEN IN PARAGRAPH 7.7.1 OF ACI 318, UNLESS OTHERWISE NOTED, 6. STRUCTURAL FILL GRADATION REQUIREMENTS ARE AS FOLLOWS: r- 10. DETAILING OF REINFORCING STEEL SHALL CONFORM TO "ACI MANUAL OF STANDARD PRACTICE FOR DETAILING A. MAXIMUM PARTICLE SIZE -6INCHES.B. AT LEAST 10% AND NOT MORE THAN 75% BY WEIGHT RETAINED ON THE#10 SIEVE, �I�, �, wj! REINFORCED CONCRETE STRUCTURES (ACI 315). C. NOT MORE THAN 12% BY WEIGHT OF NON-PLASTIC FINES(MATERIAL PASSING THE#200 SIEVE). 11. NON-SHRINK GROUT SHALL BE NON-METALLIC WITH A MINIMUM COMPRESSIVE STRENGTH OF 5000 P.S.I. \`rFG 076919 7. CONTROL FILL OPERATIONS SHALL BE INSPECTED AND TESTED BY A QUALIFIED GEOTECHNICAL ENGINEER OR ��°,Q�F 12. PROVIDE PROPER HIGH CHAIRS, SPACERS AND SUPPORTS TO HOLD REINFORCING SECURELY IN PLACE WHILE PLACING INSPECTOR PRIOR TO THE PLACEMENT OF ANY CONCRETE. THESE TESTS SHALL BE PERFORMED AT SUFFICIENT LATERAL LOAD DESIGN SCHEDULE ESSION CONCRETE. BAR SUPPORTS SHALL BE ALL GALVANIZED METAL WITH PLASTIC TIPS. FREQUENCY AND SPACING TO ENSURE PROPER SUBGRADE PERFORMANCE. THE TESTING LAB SHALL SUBMIT COMPACTION REPORTS FOR ALL FILL TO THE ENGINEER OF RECORD, E 13. PROVIDE EXPANSION,CONTROL AND CONSTRUCTION JOINTS AS REQUIRED BY APPLICABLE SECTIONS OF ACI 301-84. 8, LOADED,WITH ANY DEMOLITION DEBRIS,MATERIALS OR EQUIPMENT THAT MAY ENDANGER ITS SAFETY. WIND LOAD E issued date description 14. CONSTRUCTION JOINTS, WHEN REQUIRED, ARE SUBJECT TO THE REQUIREMENTS OF THE CONTRACT DOCUMENTS AND 9, THE CONTRACTOR SHALL BE FULLY RESPONSIBLE FOR CONSTRUCTION MEANS AND METHODS THROUGH DEMOLITION 1 03/15/19 issued For Construction SHALL BE IN CONFORMANCE WITH ACI 318. DRAWINGS SHOWING LOCATION AND DETAILS OF THE PROPOSED AND CONSTRUCTION. ITEM SYMBOL VALUE CONSTRUCTION JOINTS SHALL BE SUBMITTED WITH REINFORCING STEEL SHOP DRAWINGS. v 15. EXPANSION AND CONTRACTION JOINTS BETWEEN CONCRETE MEMBERS SHALL BE FILLED WITH APPROVED MATERIAL. 10. CONTRACTOR SHALL VERIFY ALL DIMENSIONS AND EXISTING CONDITIONS IN THE FIELD. ANY DISCREPANCIES SHALL BE HEIGHT ABOVE GROUND LEVEL h �25� SEE SPECIFICATIONS FOR DETAILS. BROUGHT TO THE ATTENTION OF THE ENGINEER PRIOR TO THE COMMENCEMENT OF WORK. BASIC WIND SPEED (3 SEC. GUST) V 1 16. CALCIUM CHLORIDE SHALL NOT BE USED IN CONCRETE MIXES. 11, THE CONTRACTOR SHALL BE RESPONSIBLE FOR ADEQUATELY BRACING AND PROTECTING ALL WORK DURING CONSTRUCTION AGAINST DAMAGE, BREAKAGE,COLLAPSE, DISTORTION,AND MISALIGNMENT. WIND EXPOSURE CATEGORY - B 17, REINFORCING BARS OR WELDED WIRE FABRIC SHALL NOT BE WELDED,TACK-WELDED OR USED FOR STRIKING AN ARC. 12, ALL DISTURBED AREAS SHALL BE PATCHED TO MATCH EXISTING ADJACENT FINISHES. I 1.00 WIND LOAD IMPORTANCE FACTOR 18, COLD WEATHER CONCRETING SHALL BE IN ACCORDANCE WITH ACI-306. 13. NO DEMOLITION WORK SHALL BEGIN UNTIL APPROVAL IS GIVEN BY THE OWNER AND ENGINEER. REFER TO PROJECT FOUNDATION SPECIFICATIONS FOR ADDITIONAL INFORMATION AND REQUIREMENTS, OCCUPANCY CATEGORY - II 1. ALL FOUNDATION DESIGN, SOIL TESTING, SOIL CLASSIFICATION, AND BEARING CAPACITIES SHALL BE IN ACCORDANCE SUBMITTALS SURFACE ROUGHNESS - B WITH CHAPTER 18 OF THE 2015 INTERNATIONAL BUILDING CODE. 1. PRIOR TO PROCEEDING WITH THE WORK, CONTRACTOR SHALL SUBMIT THE FOLLOYVING TO THE ENGINEER FOR REVIEW: F 2. ALL FOOTINGS SHALL BEAR ON UNDISTURBED SOIL HAVING A MINIMUM BEARING CAPACITY OF 1 TONS PER SQUARE A. MIX DESIGNS FOR ALL GRADES OF CONCRETE INCLUDING CERTIFIED TEST DATA ON STRENGTH OF SAMPLE BATCHES, FOOT. ADEQUACY OF THE SOIL SHALL BE VERIFIED BY A GEOTECHNICAL ENGINEER PRIOR TO THE START OF CONSTRUCTION. B. PLACING AND SHOP DRAWINGS FOR ALL REINFORCING STEEL. 3' 2. REVIEW OF SHOP DRAWINGS BY THE ENGINEER IS ONLY FOR GENERAL COMPLIAN,E WITH DESIGN INTENT. REVIEW OF SEISMIC LOAD 4. MAXIMUM SLOPE BETWEEN BOTTOMS OF FOOTINGS SHALL BE ONE VERTICAL TO TWO HORIZONTAL. THE DRAWINGS DOES NOT RELIEVE THE CONTRACTOR OF COMPLETING THE WORK IN ACCORDANCE WITH THE 5. THE DESIGN, ADEQUACY AND SAFETY OF BRACING, SHORING OF TEMPORARY SUPPORTS, ETC., IS THE SOLE DRAWINGS AND SPECIFICATIONS. CONTRACTOR WILL ALLOW A MINIMUM OF 10 WORKING DAYS FOR REVIEW OF ALL ITEM SYMBOL VALUE title RESPONSIBILITY OF THE GENERAL CONTRACTOR. SUBMITTALS,FOLLOWING RECEIPT BY ENGINEER. 6. ALL FOOTINGS SHALL BEAR AT OR BELOW MINIMUM BEARING DEPTH OF 3'-0" BELOW FINISHED GRADE. 3. SUBMIT THE FOLLOWING TO THE ENGINEER FOR RECORD PURPOSES: IMPORTANCE FACTOR le 1.00 GENERAL NOTES 7. NO BACKFILLING OR COMPACTION AGAINST WALLS SHALL BE DONE UNTIL THE CONCRETE HAS ATTAINED FULL A. RESULTS OF CONCRETE SPECIMEN COMPRESSIVE STRENGTH TEST, SUBMIT WITHIN 48 HOURS OF TESTING. OCCUPANCY CATEGORY - 11 & LOADING STRENGTH AND SUPPORTING SLABS ARE IN PLACE OR WALLS HAVE BEEN ADEQUATELY BRACED. SS SS .154g 8. FOOTINGS SHALL BE LOCATED SUCH THAT THE WALLS/COLUMNS ARE CENTERED, UNLESS NOTED OTHERWISE ON PLAN. S1 S1 .0568 9. DO NOT INSTALL FOOTINGS IN WATER OR ON FROZEN GROUND. SEISMIC DESIGN CATEGORY - B 10. CONTRACTOR SHALL VERIFY ALL ELEVATIONS AND POSITIONS OF EXISTING FOUNDATIONS AT OR ADJACENT TO NEW + CONSTRUCTION AND SUBMIT FIELD SKETCHES AS MAY BE REQUIRED FOR ARCHITECT/ENGINEERS' APPROVAL BEFORE SITE CLASSIFICATION D + drawn by: JR STARTING ANY FIELD WORK, 11, FOUNDATION EXCAVATIONS SHALL BE CHECKED AND APPROVED BY A QUALIFIED GEOTECHNICAL ENGINEER OR RESPONSE MODIFICATION FACTOR R 6.5 checked by: TM a.. INSPECTOR PRIOR TO THE PLACEMENT OF ANY CONCRETE. CONTRACTOR SHALL NOTIFY GEOTECHNICAL ENGINEER OR SEISMIC RESPONSE COEF. - .025 scale: AS NOTED INSPECTOR WHEN INSPECTION OF EXCAVATION IS READY. GEOTECHNICAL ENGINEER OR INSPECTOR SHALL SUBMIT LETTER Of COMPLIANCE TO OWNER. project number: 10002 r 12. ALL UNSUITABLE FILL MATERIAL SHALL BE EXCAVATED AND REPLACED AS ENGINEERED FILL. scaled inch U 0 13. ENGINEERED FILL SHALL BE PLACED IN EIGHT INCH LOOSE LIFTS (MAXIMUM) AND SHALL BE COMPACTED WITH sheet number 0VIBRATORY ROLLERS. FILL MATERIAL SHALL BE TESTED BY MODIFIED PROCTOR DENSITY METHOD (ASTM D1557-78) AND MUST QUALIFY AS SELECT, WITH LESS THAN 10% PASSING THROUGH NO, 200 SIEVE. SOIL SHALL BE PLACED WITH BUILDING A CD MOISTURE CONTENT AND ENERGY TO PROVIDE 95% OF MAXIMUM DRY DENSITY. IN PLACE DENSITY TESTS SHALL BE p TAKEN FOR EACH 10,000 S.F.IN EACH LIFT, NO TESTS SHALL BE PERMITTED TO FALL BELOW 92% COMPACTION. x 14. THE TESTING LAB SHALL SUBMIT COMPACTION REPORTS FOR ALL FILL TO THE ENGINEER PRIOR TO REQUESTING m FOUNDATION INSPECTION. m H� L + S010 + + 8f' H • 9 a nj SECTION 1704 SPECIAL INSPECTIONS AND TESTS, CONTRACTOR RESPONSIBILITY AND 1704.4 Contractor responsibility. 1705.3 Concrete construction. 41y 1705.6 Soils. , STRUCTURAL OBSERVATION Each contracto' responsib a for the construction of a main wind- or seismic forceresisting system, Cesignated Soeclal Inspections and tests of ron^rete ron;trurtirn shall he performed In accordance with this section an:f Special Inspections and tests of existing site soil noncitions, fill p1ninpirrientand Irnd-bearingre uirernents shall � seismic system or a wind-or seismic force-resisting component listed in the statement of special Inspecticns Table 1705.3. oe performed In accordance with this section and Table 1705.6. The approved gectechnical report and the 1704.1 Generate sha I submit a written statement of responsibility to the buliding officia;and the owner or the owner's authorized construction documents prepared by the registered design profess:oneis shall be used to determine compliance, Special 'ns ections and tests, statements of special ecial ins_ections, responsibilities of contractors, submittals to the agent pr to the commencement of work on the s stem or component.The contractor's state of Exception: S acral ins ectior7s and tests shall not be required for: During fit placement, the special Inspector shall vert that proper materials and rocecures are used in B E ATTY HARVEY COC O P- P- r P P 9 P Y P p p P q 9 P P" P f1' P P P building official and structura obserrations shall meet the ;applicable requirements of this section. responsibility sha I contain acknowledgement cf awareness of the special requirements ccntained in the accordance with tie provisions of the approved geotechnical report. ARCHITECTS LlP statement of special inspections. 1. Isolated spread concrete footings of buildings three stories or less above grace plane that are fully supported NEW YORK I MARYLAND 1704,2 Special inspections and tests, on earth or rock. Exception: Where Sertior 1803 dies not require reporting of materials and pronedixing for fill placement, 'he 1300 Walt Whitman Road, New York, 11747 A Where Opplication is made to the building official for construction as specitied In Section 105, the cwner or the 1704.5 Submittals to the building official, special Irspector shall verify that the in-place dry density of the compacted fill Is not less than 90 percent of the A p: (631)300-1010 owner's authori2:ed agent, other than the contractor, shall employ one or more ap roved agencies to provide Ir addition to the submittal of reports orts of s ectal ins ectlons 2nd tests In accordance with Section 1704.2.4 2. Continuous concrete footings supporting wall^ of buildings three stories or Ic^^ above rude lane that are inaxim.trn d density at optimum moistures content determined in accordance with ASTM D1 X57• owner/developer er 9 P Y p g- P P p l' g PP 9 g - p dry Y F 5- p special Inspections and tests during ronstrurtion on the types of work specified in Sertion 1705 and identify the reports and certificates shall be submitted by the owner or the owner's authorized agent to the building official for fLily supported on earth or rock where: soprovod agencies to the bu`lding official. "hese special Inspections and tests are in additicn to the ins?ections eaci of the following: TABLE 1705,6 REQUIRED SPECIAL INSPECTIONS AND TESTS OF SOILS Conifer Realty 1000 University Avenue Suite 500 by the buliding af`icral that arc identified In Section 110. 2.1.The footings Support ways of light-frame ConStruCtiori. 1, Certificates of compliance for the fabrication of structural, load-bearing or lateral load-resisting members or TYPE XNTINUOIJ S SPECIAL INSPECTION PERIODIC SPECIAL INSPECTION Rochester,NY 14607 Exceptions: assemblies on the prem'ses of a registered and approved fabricator in accordance with Section 1704.2.5.1. 2.2.The footings are designed In accnrdance with Table 1839.7. 1. Verify materials below shalhw foundaticns are adea.rate to - x 585.324-0500 achieve the design bear'ng capacity 1. Special Inspections and tests are not required for ccnstruction of a minor nature or as warranted b conditicns 2. Certificates of compliance for the seismic qualification of nonstructural com orients supports and attachments 2.3. The structural design of the footing is based on a specified compressive strength, V not more than 2,500 verify excavations are extended b p-oper depth and hive x civil engineer p Y p q P PP 9 9 P P 9 c eEched proper material g In the jurisdiction as approved by the building c!`ficial. in a:,cordanc, with Section 1705,13.2. pounds per square Inch (psi)(17.2 A1Pa) regardless of the compressive strength specified In the approved 3. Perform classifcalior and tastngof compacted fill ma-Ierials. - X LKMA construction do;uments or used in the footing constructicn. 4 Verify use of paper materials.densities ani IN thl6nesses x437 437&405 ^ r t urine placement ant compactor of compacted fill 2. Unless othervrt3e required b�,the building offclal, �pecla Ir�^pections and tests� arc not required for Grcup L 3. Certificates of compliance for designatex seismic system.. In accordance with Secilon 1700.13.3. South Country Road 5. Prior to plar-em?nt of compacteo fill,Inspect subgrade anc,ver 11719 - occuparcles that are accessory to a residential occupancy including, but not limited to, those listed in Section 3. Nonst-uctura concrete slabs sL•pported directly on the grounc, including prestressed slabs on grade,where ifi thet ste nes been prepeired proarty - x Brookhaven,NY 631.2868668 . 312.1, 4. Reports of preconstructlor tests for shotcrete In accordance with Section 1908.5 the effective prestress In the concrete is less than 150 psi (1.0 Mra). .8668 1705.11 Special inspections for wind resistance. 3. Special lnspe.tio,ns and tests are not required for portions of structures designed and constructed In 5. Certificates of compliant®for open web steel joists and joist girders In accordance with Seclion 2207.5. 4. Concrete foundation wal's constructed In accordance with Table 1807.1.6.2. Special inspections for wind resistance specified in Sections 1705.11.1 through 1705.11.3, unless exempted by m.e.p. &f.p. arrordiire with the paid-formed steel light-frame ronstrur'ion prrvlsirns of Section 2211.7 or the conventional the exceptions to Section 1704.2, are required for buildings and structures constructed In the following areas: M/E Engineering, P.E. light-frame construction provisions of Se:tion 2308. 6. Reports of mat-rlal properties verifying compliance with (tie requirements of AWS D1.4 fo, vieldability as 5. Concrete patos, driveways and sidewalks,on grade. g 150 North Chestnut Street specitied In Section 26.1.4 of ACI 318 to reinforcing bars in concrete ccmplying with a standard other than 1. In wind Exposure Category B, where Vasd as determined In accordance with Section 1609.3.1 is 120 miles per Rochester, NY 14604 4. The contractor is permitted to employ the approved agencies where the contractor is also the owner. ASTM A706 that are to be welded; and 1705.3.1 Welding of reinforcing bars. 585.288.5590 Special inspections of welding and qualifications of speciaf Inspectors for reinforcing bars shall be in accordance hour (52.8 misec)or greater. 1704.2.1 Special inspector qualifications. 7. Reports of mill tests in accordance with Section 20.2.2.5 of ACI 318 for reinforcing bars complying with ASTM with the requirements of AWS D1.4 for special Inspect:on and of ANS D1.4 for special Inspector qualification. structural engineer Prior to the start of the construction,the approved agencies shall provide written documentatlon to the bufld!ng A615 and used to resist earthquake-induced flexural or axial forces in the speclal moment frames, special 2. In wind Exposure Category C or D, where Vasd as determined in accordance with Section 1609.3.1 is 110 mph official demoistratir the competence and relevant experience or training of the s ecial Inspectors who will structural wa Is or coupling beams connectin special structural walls of seismic force-resistirr s s'ems in 1705.3,2 Material tests. (49 m/sec)or greater. TDM Consulting Engineering 9 Pe P 9 p P 9 g P g !' 550 North County Road,Suite E perform the specialinspections and tests during construction. Experience or training shall be considered relevant structures assloned to Seismic DeVan Cateoory B. C, D. E or F. In the abs•ance of sufficient data or documentation providing evidence of conforinlaice to quality standards for Saint James, NY 11780 where the documented experience or training is related in complexity to the same type of special Inspection or materials In Chapters 19 and 20 of ACI 318, the building official shall require testing of materials In accordance 1705.11.1 Structural wood. 631.686.5234 1704.6 Structural observations. Continuous special Inspection is required during field gluing operations of elements of the main windforce- testing act vltles for projects of similar complexity and material qualities. These qualifications are In addition to with the appropriate standards and criteria for the material in Chapters 19 and 20 of ACI 318. P p q g g g P qualifications speclt ed In other sections of this code. Where required by the provisions of Section 170.1.6.1 or 1701.6.2,the owner or:he cwner's authorized ageit resisting system. Periodic special inspection is required for nailing, bolting, anchoring and other fastening of shall employ a registered design professional to perform structural observations. Structural observation does no: 1705.4 Masonry construction. elements of the main wlndforce-resisting system, including wood shear walls, wood diaphragms, drag struts, The registered design professional in responsitle charge and engineers of record Involved in the design of the incluce ur waive the tesponsibility for the inspections in Sectiuri 110 or itie special inspections in Sectlurl 1705 or Special Inspections and tests of masonry construction shall be performed in accordance with the quality braces and hold-downs. project are permitted to act as the aopro✓ed agency and their personnel are permitted :o act as special other sect ons of ttnls code. assurance program requirements of TMS 402/ACI 53C/ASCE 5 and TEAS 602/ACI 530.1/ASCE 6. key Inspectors for the work cesigned by them, provided they gL:alify as special inspectors. Exception: Special inspections are not required for wood shear walls shear panels and diaphragms, Including Prior to the commencement of observations, the structural cbserver shall submit tc the building offclal a written TRUE Exception: Socia/ins ectiors and tests shall not be re uired for: nailin bolting, anchorin and other fastening to other elements of the main >rvindforce-resisting system, where NORTH 1704,2.2 Access for special Inspection. statement identif/Ing the frequency and extent of structural observations. P p p q g' g g g Y The construction or work for which special Ir7specnor or testing Is required shall remain accessib'e and exposed 1. Emolrlcally designed masonry, glass unit masonry or masonry veneer designed In accordance with Section the fastener spacing of the sheathing is more than 4 inches (102 mm) on center. for special Inspection ar testirg ourposes until completion of the required specfallnspecticns or tes's. At the concluslor of the work Included in the permit, the structural observer shall submit to the bulldirg official a 2109, 2110 or Chapter 14, respectively, where they are part of a structire classified as Rlsk Category t. 11 or ill, 1705.11.2 Cold-formed steel light-frame construction. + written statement that the site visits have been made and Identify any reported deficiencies that,to the best of Periodic special inspection is required for welding operations of elements of the main windforce-resisting system. 1704.2.3 Statement of special inspections. the structural observer's knowledge, have not been resolved. 2. Masonry foundatior wa Is constructed in accordance with Table 1807.1,6.3(1), 1807.1.6,3(2;, 1807.1.6. 3 or Periodic special inspection is required for screw attachment, bolting, anchorin and other fastening of elements The applicant sha i submit a statement of special Inspections in accordance with Section 107.1 as a condition for O p q 9, g 9 permit Issuance. Thl3 statement she I be in acccrdance with Section 1704.3. 1704.6.1 Structural observations for seismic resistance. 11307.1.6.3(4). of the main wlndforce-resisting system, including shear walls, braces, diaphragms, collectors (drag struts) and •�e - Structural observations steal be provided for those structures assigned to Seismic Design Category D, E or F hold-downs. Exception: A statement of speciaf Inspections Is not required for portions of structures designed and ccnstructed where one or more of the following conditions exist: 3. Masonry fireplaces, masonry heaters or masonry chimneys installed or constructed In accordance with o In accordance with the cold-formed steel light-frame "onstrc ctlon provisions of Section 2211.7 or the Section 2.11, 2112 or 2113, respectively. Exception: Special Inspections are not required for cold-formed steel light-frame shear walls and diaphragms, ronventlonal lirg,it-frame ronstrtlrtion provisions of Ser*ion 2308, 1. The structure Is classlfled as Risk Category iII or IV. including screwing, bolting. anchoring and other fastening to components of the windforce resisting system, 1705.4,1 Empirically designed masonry, glass unit masonry and masonry veneer In Risk Category IV. where either of the following applies: 1704,2.4 Report: requirement. 2. The height of the strL.ct.ire Is greater than 76 feet (22 850 mm) above the base as defined In ASCE 7. Special inspections and tests for empirically designed masonry, glass unit masonry or-nasonry veneer designed In accordance with Section 2109, 2110 or Chapter 14, respectively. where the are art of a structure classified project App��aved agencies shall keep records of special inspections and tests.The approved agency shall submit P P Y• Y P `� 1.The sheathing Is gypsum board or fiberboard. p 1 reports of special nspections and tests to the building official and to the registered design professional in 3. The structure is assigned to Salsmic Desigr Category E, is classified as Risk Category I or II, and is greater as Risk Category IV shall oe performed in accordance with TMS 402/ACI 530/ASCE 5 Level B Quality responsible charge. Reports shall indicate that work inspected or tested was or was not completed in than two cto*c above grode plane. AsSUrance. 2.The sheathing Is wood structural panel or steel sheets on only one side of the shear wall, shear panel or VINEYARD VIEW conformance to approved construction documents. Discrepancies shall be brought to the immediate attention of diaphragm assembly and the fastener spacing of the sheathing is more than 4 inches (102 mm) on center(o.c.). the contractor for correction. If they are not corrected, the disrrepanries shall he brought to:he attention rf the 4. when so designated by the registered deslan professlcnal responsible for the structural design. 1705.4,2 Vertical masonry foundation elements. p building officlal and to the registered design professional In responsible charge pricy to the completion of that Special Inspections and tests of vertical masonry foundation elements shall be performed In accordance with 1705.11.3 Wind-resisting components. -�- phase of the oral k. A final report documenting required specie, Irspections and tests, and correction cf any 5 when such observatior Is soecifrcally required by the building officlai. Section 1705.4. Periodic special inspection is required for fastening of the following systems and components: p disc-epanc es noted in the inspections or tests, shall be submitted at a point in time agreed upon prior to the start County Road 48 of work by the owner or tie owner's authorized agent to the building officiel, 1704.6,2 Structural observations for wind requirements. TABLE 1705.3 REQUIRED SPECIAL INSPECTIONS AND TESTS OF CONCRETE CONSTRUCTION Greenport, NY 11944 1. Roof covering roof deck and roof framing connections. Structural observations steal be provided for those structures sited where Vasd as de'ermined in accordance with CONTINUOUS seal 1704.2.5 Special Inspection of fabricated items. Section 1609.3.1 exceeds 110 Mph 49 misect where one or more of the following conditions exls:: ERNSPE TION REFERENCED IBC P ( � g TYPE SPECIAL Where frbricitlon of structural, load-bearing cr lateral load-resisting members or assemblies Is being ccnducted INSPLCI ICN INSPECTION STANDAFDa REFERENCE 2. Exterior wall covering and wall connections to roof and floor diaphragms and framing. c pF NE on the premises of a fabricator's shop, speclaf Inspections of the fabricated!terns shall be performed durirg 1. The structure is classified as Risk Category I II or IV. 1 Inspect reinforceriert. Including prestressing - x act 318 Gh 20. i5.2 1908 4 Q�`' ,NEW r0,� fabrication. tendons and verfv iacemem 25 3. 26 6 1.26&.3 6)- o�p,5 t"ih, fp/l t�-- ^ + , Rctn°orcing bor weld ng - � �. The building haighil is greater than 75 feet (22 860 mm,, n Verb weldibllity of reinforcing bars Exceptions: other than ASTM A706. x AWS D1 4 1 r b. Inspect sin le ass fille:welds. maximum ACI 318:26 6.7 (' s 3. WI-en so designated by the reglstered design professicnal responsible for the structural design. S.'16* aid p x 1. Special inspections during fabrication are not required where the fabricator maintains approved detailed c. Inspect all:th?rvvetds x F �� fabrication and civall:y control procedures that provide a basis for control of the workmanship and the fabricator's 4. WN en such observatior Is soecifrcally required by the buliding officlai. 3. Inspect ancho-s cast In concrete - X ACI 318 17 e.2 - 075919 ability to conform to approved constructicn documents and this code.Approval shall be based upon review of 4. inspect ancho-s post-Installed In har"erecl ,Q a\�•� Ro`v fabrication and duality control procedures and periodic inspection of fabrication practi;,es by the building officio' SECTION 1705 REQUIRED SPECIAL INSPECTIONS AND TESTS I:unok-te rnerrrtse 5 b _-_FESS,__ a Adhcsiva anchors installed in iorl=zontaly or upwardly inclined orientations to resist ACI 318, 17 8.2 4 2.Soeclal inspectiors are not required where the fabricator is registered and apprcved in acccrdance with 1705.1 General, sustain?d:ension load=_. x Sectloi '7042.15.1. Special Inspections and tests of elements and nonstructural components of buildings and structures shall meet b Mechanical anchors and achesive anchors - E issued date description tie app scab a requirements of this section. rut derived hr 4 t x ACI 318: 17 8 2 �- 1704,2.5,1 Fabricator approval. 5. Verify use of required design mix - x Acl 310 ch 119 119041, 1SO4 2 1 03/15/19 Issued For Construction Pp 26,43 264s '903 2 1908 3 Special Inspections during fabrication are not required where thr work is done on the premises of a fabricator 1705.1.1 Speelal cases. r, Pier to corcrete placemen', fabri:ata space- ASTP.1 -172 reg shred and approves to perform such work without special Inspection. Approval shall be based upon review Spacial inspections and tests shall be required for proposed work that is in the opinion cf the building official, mens for strength tests perform slump and a r x - ASTM C01 19110 10 of the fabrcator's written procedural and quality control manuals and esodic auditing of fabrl;,,a:ion practices b unusual Ir its nature such as but not limited to the following examples: content tests,and dete�rnhe the ternperatire of A�t 31 E:26.1 2C.12 P q tY P 9 P Y 9 p he concrete. an approved ageicy. At completion of fabrication,the approved fabricator shall submit a certificate of compilance 7 Inspect concrete enc srotcrete placement ror x - ACE 318:26,5 1Me. 19)a 7. to the owner or tl•e owner's authorized agent for submittal to the buliding official as specified Ii Section 1704.5 1. Construct on materials and systems that are alternatives to materials and systems prescribed by this coCe. proper aprtication technirnes. 1900.0 stating teat the work was performed in accordance with the approved construction docarnenfs. rararrrra pail tr+rhni�riac 8 Verifv n•alntenance of acetified grin g tem- - x ACI 318 26 5.3-26 5 5 1908.9 2. Unusual cesign applica'ions of materials c'escribed in this "ode. 9 Inspect prestressed^orcrete for 1704.3 Statement of special inspections. a A.,plication of prestress ng forces and x - ACI 318 26.10 Where special lnspecrions or tests are required by Section 1705, the registered design prcofessional io 3. Mpte,iais and systems required to he installed in ncrrrdaninp with additional manufacturer's iis%irtiors'hat b. Grouting of boidec prestressing tendons x - resporislb/e charge shall prepare a statement of spec/al inspections In acccrdance with Secticn 1704.3.1 for prescribe requirements not contained in this code or In standards referenced by this code. 10 Inspect erection cf ore:ast concrete rrembers. - x ACI 3'8 ::h 2E•8 - 11 Verity in- s to:oncrete strength prior tc stress- submtial by the applicant in accordance with Sec'fon 1704.2.3. Ing of tendon! In pose-tenslontd•oncrete and - x ACi 318 26 112 - 1705.2 Steel construction. prior to removal of sioras and formrfrom beams and st-uckurlslabsExce tion: The statement of special Msoecbors is permitted tc beprepared b a qualified person approved CY The special Inspections and nondestructive testln of steel construction In buildings, structures, and portions 12 Inspect fornnvor� for shape ocat(on and the building offcfal for ronstrir'lon not designed by a registered design professioral tiereof shall be In accordance with this section. dimens ons of the concrete member being - x ACI 318 26.1'.1 2fb1 - _1_ formed r T 1704.3.1 Content of statement of special inspections. Exception: Special inspections of the steel fabrication process shall not be required where the fabricator does The statement o,r special inspections shall Identify the following: not perform any weldinc, tiermal CLlttinra or heating operation of any kine' as part of the fabrication process. In For St. 1 Inch=25 4 m such cases, the fabricator shal be required to submit a delatlec procedure for material control that demonstrates e-Where appicahle see also Section 17CS-12 Special Inspections for seismic•es stance 1. The materlals, systems,components and work required to have s,pecla!Inspections or tests b the bai/dip tic fzbrlcator's ability to maintain suitable records and procedures such :hat at an time during the fabrication b Speen A requlrem�ts for special lnsp race stall be included ifi the uiramen apart for the anther Issued by an ion req it source In accordance with YS p � y g Y P r Y g 11 ti l In RL;1 31>3. oroiher quallticailor pr:cedules. L 'lora specific requtr„ments are not provided special Inspection requirements shall be sper•Ified by cfffcial or by the registered design professions)responsible for each portion of the work. process, tie material speclficatioi and grade for the main stress-carrying elements are capable of being tie registered design professional and shell be approved by the building official prior to the commencement of the til 06.. determlied. M II test reports shall be Nentlflable to the main stress-carrying elements when required by the title 2. The type and extent of each speclar inspection. approved construction documents. 1705.5 Wood construction. S P E C I A L Special insoect,ons or prefabilcated wood stiuctuia[elements and assernblies shal' b-- in accordance with 3. The type and extent of tach test. 1705,2.1 Structural steel. Secilon 1704.2.5. Speclai Inspections of sltebullt assemblies shall be In accordance vrith this section. Special Inspections and nondestructive testing of structural steel elements in builr'ings, strt_rtmes and prrtinns INSPECTION 4. Addltloral reqs-Iremerts for special inspections or tests for seismic cr wind resistance as specified In Sections tiereof shall be In accordance with the quality assurance inspection requirements of AISC 360. 1705.5.1 Hlgh-load diaphragms. 1705.11, 1705.12 and 1705.'3. High-load diaphragms designed in accordance with Section 23C6.2 shall be Installed with special Inspections as REQUIREMENTS Exception: Specie!Inspection of railing systems composed of structural steel elements shall be limited to Irdicated In Section 1704.2. The specia! Inspector shall inspect the wood structural panel sheathing to ascertain 5. For eaci type of special Inspection, Identificaticn as to whether it will be continuous special Inspection, we diig Inspection or welds at the base of cantilevered rail posts. whether it Is of the grade and thickness shown on the approved construction documents. Additionally,the special perodir special inspection or performed In nrrordnnre with the ncltntirn used in the referenced standard where Irspector must verify the nominal size of framing members at adjoining panel edges, the nail or staple diameter the Inspections are deflred. aid length, the number of fastener lines and that the spacing between fasteners In each line and at edge margins agreeswith the approved constructlon documents 1704.3.2 Seismic requirements in the statement of special Inspections. + drawn by: JR Where Secilon 1705.12 of 1705.13 specifies specia:lrspectlons cr tests for seismic resistance, the statement of 1705.5.2 Meta I�plate-con nected wood trusses spanning 60 feet or greater. special inspections shall Idertify the designated seismic systems and seismic force-resisting systems that are Where a truss clear span Is 60 feet(18288 mm) or greater,the special inspector shall verify that the temporary checked by: TM IL subject to the special Inspections or tests. irstallation restraint/bracing and the permanent individual truss member restraint/bracing are installed in i a;cordance with the approved truss submittal package. scale: AS NOTED •d 1704.3.3 Wind requirements In the statement of special inspections. project number: 10002 Where Section 1705.11 specifies speciaf inspection for wind resistance, the statement of spe,cia:inspections shall (dent fy the main w'ndforce-resisting systems and wind-resisting components that are subject to speclal scaled inch < Inspections. 0 sheet number U O U z BUILDING A 0 0 + + - - + �- �- �- + • c a MW BEATTY HARVEY COCO ARCHITECTS , LLP NEW YORK j MARYLAND 58._x�}}..3,,.." 1300 Walt Whitman Road, New York, 11747 4 I q p: (631)300-1010 14'-51" 6-8■ 6'-8" 14'-5j" owner/developer Conifer Realty 1000 University Avenue Suite 500 Rochester, NY 14607 585.324-0500 I -- - - - - - - -- -- , - - - - - - - - -- ` I civil engineer I r I - - -- - - - - I LKMA 7777 L- - - --- 4a -- - - -- - - - - - - - -- I I 43Road South Country Road Y— —- -— —— — — , —— — I I Brookhaven, NY .8668 i T T, 1719 631.286.8668 m.e.p. &f,p. _ M/E Engineering, P.E. e.� IaI I I I I ISI 150 North Chestnut Street I I 1 I I I I Rochester,585.288.5590 19'-3j" 2'-0!. 14'-1�,! 2' 0.. 19'-31" ■ fV CV I structural engineer 1 I ( I I I TDM Consulting Engineerin 1 I I I NEW 4" CONC. SLAB W/ I ( I `' I 550 North County Road,Suite? IWWM 6x6 W4.Ox4. Saint James, NY 11780 0 OVER � ' I I I I 6 MIL. POLYETHYLENE I I 1 ": I ''�' 631.686.5234 VAPOR BARRIERON I ' M I I I I COMP.SUBGRADE I I I I M 3 I I I I (T.o.s. EL.=o' o") s2.00 I I I I I I 1 key TRUE I I I I I I i I NORTH • i �- - - - - - - -- -- -- -- -- -I I I r- - - -- - - - - -- o -- - - --i i • I-- - - -� -- - - -- - - -- -- I I l I- - - - - - - - -- - - N — MRI. _ I I I HAUNCHED SLAB TO ALIGN W/ LOAD BEARING WALLS & SHEAR WALLS COORD, LOCATIONS W/ARCH. DWG'S I I I 0" — . .. I I I I ,..,.� �.. r — I I 1 I I —.n ',. project I VINEYARD VIEW M I I I I M 14 I D " -�-- 1 141- County Road 48 Greenport, NY 11944 seal V I I I I I 1 OF NEN,, I I I I �'- -'- L --I r - - -- - -I--- - - -- - - - ---- - --L--- -- -- - -� r —u •'b '�'. I I .�.. ... l .ti .r...l. :,�' •�:•' 'c. ffi I-1 L- -- - - -- --- - J ;'Pry :, oL- --.- - - — ._ - - J r ti 1. w! :TV +, N 1.��' .•N �J 4�tv l "t :.t 4. � 0 7 G - 1 '•�' .c=am•. — — O OD' �- V •'N •i: N 6:15• .'1 �J SIO T� •,i •4 j j.• 1' l .,L• 12. A: Y' - :,,: •.' F2. issued a description tionF2,5 F2.5 F2.5 dat F2.5 F2, F2,5 F2. 1 03/15/19 Issued For Construction 10'11° 1!- 6" 6'-6!! 15'-1�" s•2,00 6' 6" 6" _4241 10'-11 j" V.9111 2'-0■ 29'-1�" 14'-51" 2'-0" 62'-01" : t FOUNDATION PLAN title SCALE:3/16"=1'•0" NOTES: FOUNDATION PLAN 1. REFERENCE ELEVATICN =0'-0" AT TOP OF GROUND FLOOR SLAB, 2. BOTTOM OF FOOTING ELEVATION =4-0" UNLESS OTHERWISE NOTED THUS (-,,,) ON PLAN. 3. ALL UNSUITABLE BEARING MATERIAL SHALL BE EXCAVATED AND REPLACED WITH ENGINEERED FILL IN ACCORDANCE WITH THE PROJECT SPECIFICATIONS: SOIL SHALL BE INSPECTED AND TESTED PRIOR TO THE INSTALLATION OF THE FOOTINGS. drawn by: JR 4. f OR FOOTING SCHEDULE AND TYPICAL FOUNDATION DETAILS, REFER TO DRAWING S-4:00. checked by: TM 5. f OR PIER DETAILS, REFER TO DRAWING S-4,00. CL scale: AS NOTED J aqUi project number: 10002 scaled inch sheet number 0 U O z BUILDING A a @ 4H S1 * 00 0 � � I - P 1 o !, I „ I i BEATTY HARVEY COCO ARCHITECTS , LLP NEW YORK I MARYLAND 58'- 1300 Walt Whitman Road, New York, 11747 A A p: (631)300-1010 14'-5 15'- 1" 1 14'- owner/developer 1' 6'-8" �"4 '-8" Conifer Realty 4'.3�" 2'-71" 3'.31" 4'-3�" 21.011 2'-11i" /1'_.x_011 2'-41" 2'-11 J" 21.511 2'-11 - 1 21.011 4'-3�" 5'-11 4'-3 1000 University Avenue Suite 500 Rochester, NY 14607 585.324-0500 — H1 H1 — — S2o1 H1 H1 — — 0 0 civil engineer 14'-5 " N HI H 1 �;, 14'-51" LKMA SW-2 H 1 H 1 LH SW-2 437&405 ! South Country Road Brookhaven,NY 11719 631.286.8668 I i m.e.p.&f.p. M/E Engineering, P.E. B • B 150 North Chestnut Street Rochester,NY 14604 20'-21" 15'_311 20'-2 11 c� 585.288.5590 "� structural engineer 0 3 b TDM Consulting Engineering 550 g CO CO r N r M 3 NorthCounty Road,Suite Saint James, NY 11780 • N N ■ 18" FLOOR TRU S 18" FLOOR TRU 18" FLOOR TRU S 631.686.5234 M 24" O.C. 24" O.C. 24" O.C. M M 1 =I I key 10'41" F 10'-41" TRU! 18"DEEP GIRDER TRUSS NORTH SWA SW-4 I V _ N C MI-It ,R�■ .n ' 4 OPEN QO S2.01 s R ■ P W P �� cht 18"DEEP GIRDER TRUSS 18"DEEP GIRDER TRUSS iv 21.0" 21.0" N 18"DEEP GIRDER TRUSS project " P"x3} PSLP " 1 VINEYARD VIEW PSL POSTS(TYP.) PSL POSTS(TYP,) OPEN Sot OPEN S2.o1 W W DT� C C ■ 67 ■ County Road 48 W W i" NOTE:GYPCRETE NOT ;, Greenport, NY 11944 REQUIRED ON CENTER UNIT SEE ARCH. seal "DEEP GIRDER SS30'-4" "DEEP GIRDER USS P��,QF NEW rO l H1 H1 H1 H1 H1 H1 H1 H1 � — — - — — — — --- — — — - � -- 1 H1 H1 �; j �� N — — — — N 2'-10" �? 2'-10" N - — — — — N ,c^' �1 0 076919 1 911 5'-1111 2'-0 ' 3'-0" 9' N 3'-0" 1 3'-0" 2'-0" 2'-711 3'- 3'-011 1_ 1 31 011 2'-0 " 5'-1111 11. " ��' ESSo�/�� X N � • N � ■ x (3)2x12— 21. E N CVe5l <V �' issued date description 1312x12 5 01 13)2x12 1 11 6 1 11 �� 6 I 1 03/15/19 Issued For Construction 1'-911 10'-1111 1 - 6'-6" 15-111 6 6 11 9 5 10'-1111 1 -911 21-011 14'-5111 29'-1 ■ 141-111 2'-011 62'-0l" ff _SECOND FLOOR FRAMING PLAN- HEADERSCHEDULE tit SCALE:3/16"=1'-0" NOTES: MARK MATERIAL SUPPORT EACH END CONN.AT SUPPORT SECOND FLOOR 1. FLOOR CONSTRUCTION SHALL CONSIST OFJ" GYPCRETE OVERJ" T&G PLYWOOD SUB-FLOOR ON H1 (2)2X10 (2)2X6 STUDS FRAMING PLAN WOOD FLOOR TRUSSES. 2. TOP OF SUB FLOOR ELEVATION=10'-9" H2 (2)1X11LVL (3)2X6 STUDS 3. INDICATES WOOD STUD BEARING WALL. SEE PLAN AND SCHEDULE FOR SIZE AND SPACING. —f= drawn by: JR 4. ALL DIMENSIONS SHALL BE COORDINATED WITH ARCHITECTURAL DRAWINGS. checked by: TM CL 5. SW_ INDICATES WOOD SHEAR WALLS. SEE SCHEDULE AND TYPICAL DETAILS ON DRAWINGS S-3.00 T H R U S-3.10. scale: AS NOTED U project number: 10002 m r scaled inch o sheet number u O z BUILDING A - @ 4H S1 001 0 0 co 1"W! moor_'C BEATT"Y HARVEY COCO ARCHITECTS , LLP NEW YORK I MARYLAND 1300 Walt Whitman Road, New York, 11747 p: (631)300-1010 T 14'-51" 6'_8 15'-9 " _8 14'-5 owner/developer Conifer Realty 4'-3j" 5'-11 " 4'-3 " 2'-11 " 5'-11 " 4'-1 3" 2--1"1" '- 1" 51-11111 1000 University Avenue Suite 500 2'-0" 4 -112-0 4 34 � 4-3 Rochester, NY 14607 585.324-0500 szoi - - — — H1 - - H1 — _ - - civil engineer 14'i5 N —H1— - - H1— 14','51" I LKMA - - - - - 1 I .-�* 437&405 1_2 — — — — s -2 � // � \\ I � South Country Road Brookhaven, NY 11719 631.286.8668 \ m.e.p.&f.p. En f M/E Engineering, P.E.V I I I N gg 150 North ChestnulStreet / \ Rochester, NY 14604 / \ ( 1 20'-2i' 15'-6 " 0'-2 585.288.5590 / \ i structural engineer o I / \ I o 3 ' TDM Consulting Engineering C) 3 I I I I o 550 North County Road,Suite I N I / \ I N I Saint James, NY 11780 1 SIN / \ C7 631.686.5234 L =III = key ,,S I 10'4j" i / \ i 10'-4j" I TRUE NORTH SW-4 I \ SW-4 0 0 CM N Id I I \\ N V N V N V // I I M� ■r■ .I LO O o: O = O N O N O N r \ O O O @1 @1 @1 , \ O O O / N 3:: I 2,_ „ I I project VINEYARD VIEW I Ar + County Road 48 I I- "' I I LO Greenport, NY 11944 \ / seal F NEW p x00I / I - �� PS MrRA IL71 I 1 H1 I a - r- T-- Cl iv H2 - - - - - - - - - - - - - - - -N H2 iv — — — — • 11'-7 076919 4'=3 _ 6'B„ - -4�" 111-711 5'-11 " 3"- - 6'@" - -# - '° Q T- 7 �'QFESS�Q� I II II I ROOF BELOW I ROOF BELOW E I I I I E issued date description — 1 03/15/19 Issued For Construction OUTLINE OF ROOF BELOW 2'-0" 14,_ „ 29'-1�" 14'-5j" 21_011 62'-q" 14 ROOF FRAMING PLAN- HEADER SCHEDULE title SCALE:3/16"=1'-0" NOTES: MARK MATERIAL SUPPORT EACH END CONN.AT SUPPORT ROOF FLOOR 1. FLOOR CONSTRUCTION SHALL CONSIST OF J" T&G PLYWOOD SUB-FLOOR ON WOOD FLOOR H1 (2)2X10 (2)2X6 STUDS TRUSSES. FRAMING PLAN 2. Im 1A INDICATES 2x6 WOOD STRUCTURAL WALL, H2 (2)1X11JLVL (3)2X6 STUDS 3. ALL DIMENSIONS SHALL BE COORDINATED WITH ARCHITECTURAL DRAWINGS. 4. SW_ INDICATES WOOD SHEAR WALLS. SEE SCHEDULE AND TYPICAL DETAILS ON DRAWINGS S-3,00 -�-= drawn by: JR THRU S-3.10. checked by: TM J scale: AS NOTED Uproject number: 10002 c Q scaled Inch 0 sheet number U O U z BUILDING A a O ca O g T- g H IT IT IT 6 CIO 77 O "O ANCHOR BOLT 3'-0" O.C. J"O ANCHOR BOLT - 0 3'-0" O.C. PLYWOOD SHEATHING 3x3xJ" PLATE PLYWOOD SHEATHING SEE SHEARWALL SCHED. WASHER SEE SHEARWALL SCHED. PLYWOOD SHEATHING WAS PLATE WASHER SIMPSON TYPE SSP 2x6 STUDS @16" O.C. SEE SHEARWALL SCHED. #4 BARS @ 2'-0" O.C. SIMPSON TYPE SSP 1" PREMOLDED STRAP AT EACH STUD EACH WAY STRAP AT EACH STUD FILLER I 3x3x " PLATE 4" SLAB ON GRADE J"0 ANCHOR BOLT WASHER 4" SLAB ON GRADE 1 PRE-MOLDED BEATTY HARVEY COCO „ 4" SLAB ON GRADE FILLER A R C H I T E C T S , L L P W.W.F. @ 3 -0 O.C. 4" SLAB ON GRADE FIN. GRADE FIN. GRADE NEW YORK I MARYLAND q T.O.SLAB T.O. GRADEL T.O.SLAB T.O.GRADE ° SLAB �q p: (631)300-1010 —i- 1300 Walt Whitman Road, New York, 11747 ° ° —s- EL,=SEE ARCH. °� — ° px—x-- X—X o x I x ■ ° x—■-x—x—x° EL.=0'-0" EL.=SEE ARCH, II x ■4 x—X—x`x—x—xQ-- EL,=O'-0 x x—X—x—x,x—x r-x—x—x—x—x x—�c EL.=O-0 ° a ° II 11 owner/developer 4. d ° $ 21" it - - - - - - - - Conifer Realty d�1 1=1 1=1 1= 1000 University Avenue Suite 500 6" CRUSHED—/� #5@12Rochester, NY 14607 STONE 1—I 1 —I I_� 585.324-0500 .111. 111-1 I IE—El I I—I i t—III 111-1 I I—I I I—III—III—I — Y 9 1 —__—___ i- _ , �� I�—I�=�—) I(-111— - 6 CRUSHED STONE COMPACTED = I_ _I — 2#5 BARS CONT. II s" CRUSHED Z „ I—III—I —III 111 SUBGRADE I— •I— , — -- — , — —, g �I ' #5 � 10" O.C. Z � STONE #512 ■ #4 12 III—I = I —III civil engineer HKMA I — ,— , ,— � —III—III—ITi- 12 I=1 I I III=1 I I=1 I I=1 I I=1 I I 111= � I I I– a —III—I —I I—I —I I—III—I 2 0 2'-0■ 3#4 CONT, 0 1 1I 1 I r, 437&405 COMPACTED ° COMPACTED South Brookhaven, NY 81719 oad BACKFILL BACKFILL #4 @ 12" ° ° 631.286.8668 d ° ■ m.e.p. &f.p. d d 3#5 BARS M/E Enineering, P.E.° 150 North ChestnutStreet 3#5 BARS Rochester, NY 14604SECTION 17 585.288.5590 SCALE:3/4"=1 -0" V00 1=_ IIIA 111 #5 @ 12" O.C. #5 0 12" O.C. structural engineer III=1 I ' 6" 8" 6" COMPACTED TDM Consulting Engineering g 6" 8" 6" COMPACTED 11-811 wl BACKFILL 550 North County Road,Suite 1'_ ■ BACKFILL Saint James,NY 11780 631.686.5234 SECTION 3 SECTION 2 SCALE:3/4"=1'-0" 5-2,00 key SCALE:3/4" =1'-0" S-2.00 _L::�LT RUE NEW 6x6 WOOD POST NORTH IIIIIIIIII TYP. SIMPSON STRONG-TIE CB66 POST ANCHOR own ° o OO 1'-0"x1'-0" PIERW/4#5 d VERT. BARS &#3 ° STIRRUPS @ 12" O.C. project ° z o VINEYARD VIEW d M County Road 48 Greenport, NY 11944 W U W H seal H OF NES. SEE FOOTING �NS MIR SEE FOOTING SCHEDULE SCHEDULE FOR REINFORCEMENT !rt SECTION ('4_� -- ` `� �� `'F� 076919 SCALE:3/4" =14" S-2.00 A�o�ESS10NP�" E + issued date description 1 03/15/19 Issued For Construction title FOUNDATION SECTIONS + drawn by: JR checked by: TM scale: AS NOTED J N Maui project number: 10002 scaled inch ¢` sheet number 0 U O BUILDING A Z a a ca + + - �- - �- �- - + -9 • 00 + + ` ,. ROOF TRUSSES ROOF TRUSSES @ 24" O.C. (TYP.) ROOF TRUSSES @ 24" O.C. (TYP) 24" O.C. (TYP.) BEATTY HARVEY COLO ARCHITECTS , LLP NEW YORK I MARYLAND 1300 Walt Whitman Road, New York, 11747 A p: (631)300-1010 �'- owner/developer ARochester, Conifer Realty 1000 University Avenue Suite 500 ` oc es er, NY 14607 r 585.324-0500 \-2X TRUSS BRACING. SEE civil engineer HGA10 @ 4'-0" O.C. TRUSS SHOP DWGS LKMA 437&405 South Country Road Brookhaven, NY 11719 T,0„TOP PLATE T.O.TOP PLATEfib T.O.TOP PLATE 6.8668 0,TOP PLAN EL.=SEE PLAN EL.=SEE PLAN m.e.p. &f.p. M/E Engineering, P.E. B SIMPSON TYPE H2.5A SIMPSON TYPE H2.5A B 150 North ChestnutStreet --�-- FASTENER FASTENER -�- Rochester, NY 14604 DOUBLE TOP PLATE SIMPSON TYPE H2.5A UBLE TOP PLATE DOUBLE TOP PLATE 585.288.5590 FASTENER structural engineer TDM Consulting Engineerin 550 North County Road,Suite? A Saint James,NY 11780 631.686.5234 WOOD TRUSSES AT 24" O.C. 2x6 STUDS @ 16" O.C. SOLID BLOCKING @ END 2x6 STUDS @ 16" O.C. 2x6 STUDS @ 16" O.C. key (TYP.) OF TRUSSES (TYP.) (TYP.) (TYP.) TRUE NORTH CC�� DOUBLE TOP PLATE SIMPSON -T FASTENER TYPE H2.5A 2X6 STUDS AT 16" O.C. SIMPSON STRAP TIEtEE PLYWOOD SUBFLOOR. EE SCHED FOR NAILING SIMPSON STRAP TIEtEE PLYWOOD SUBFLOOR. " PLYWOOD SUBFLOOR. MSTC28 @ EACH STUD SCHED FOR NAILING MSTC28 @ EACH STUD SCHED FOR NAILING (TYP.) SECTION A (TYP) T,0.2ND Fl.SUB Fl, T�O.2ND FL.SUB FL, T.0.2ND FL.SUB Fl. EL.=SEE PLAN EL.=SEE SEE PLAN EL.=SEE PLAN �o 0 2x6 BAND JOIST LADDER TYPE TRUSS AT EXTERIOR WALLS project O C ALONG PLYWOOD 0 CPALONG PLYWOOD VINEYARD VIEW JOINT 18" DEEP FLOOR JOINT 18" DEEP FLOOR 18" DEEP FLOOR TRUSSES @ 24" O.C. TRUSSES @ 24" O.C. TRUSSES @ 24" O.C. County Road 48 Greenport, NY 11944 seal NOTE: OF NEW.4i,,6, SIMPSON HOLDOWNS TO BE INSTALLED AS SIMPSON HOLDOWNS TO BE INSTALLED AS *,> eo '.S �i'�- NOTE: PER MANUFACTURER SPECIFICATIONS. PER MANUFACTURER SPECIFICATIONS. I PSON HOLDOWNS TO BE INSTALLED AS PER MANUFACTURER SPECIFICATIONS. oe l 1, cY �� SECTION 1 SECTION 3 SCALE:3/4"=1'-0" S-2.01 18" DEEP WOOD TRUSS GIRDER -SECTION 2 SCALE:3/4"=1'-0" S-2.01 076919 P�t� SCALE:3/4"=1'- " FESS14� S o S-2.01 r issued date description =�- + 1 03/15/19 Issued For Construction " PLYWOOD SUBFLOOR, 2x8 LEDGER FASTEN EE SCHED FOR NAILING TO BLOCKING W/%" LAG SCREW @ 2'-6' O.C. HANGER BY TRUSS DESIGNER SECTION 4 (3)2X12 WOOD GIRDER SCALE:3/4"=1'-0" S-2.01 ; \-2x8 JOISTS @ 16" O.C. SIMPSON TYPE LB (2)2x8 BLOCKING 18" DEEP FLOOR SIMPSON TYPE CCQ HANGER (TYP.) BETWEEN STUDS TRUSSES @ 24" O.C. T COLUMN CAP, SIMPSON DTTZ1 DECK NEW 6x6 WOOD POST TENSION TIE AT EACH TYP. END & AT POINTS. FASTEN T BLOCKING 1 771 71, W/%" LAG BOLT. title FRAMING SECTION 5 SECTIONS SCALE:3/4"=1'-0" S-2.01 --� drawn by: JR checked by: TM J scale: AS NOTED Uproject number: 10002 r Q scaled inch 0 sheet number U O Z BUILDING A a a a� m O + L S2901 1� gl- 9 H aco 11 1!D BEATTY HARVEY COCO , ROOF P=9K ROOF P=4.5K ROOF P=10.5K �RARCHITECTSLLP elkeb, ROOF P=4,3K NEW YORK ( MARYLAND EL.=19'-8" EL.=19'-8" — EL.=19'-8" SEL.=19'-8" 1300 Walt Whitman Road, New York, 11747 A SIMPSON ANCHOR----, SIMPSON ANCHOR SIMPSON ANCHOR---_, SIMPSON ANCHOR-----, _IA p: (631)300-1010 TIEDOWN SYSTEM TIEDOWN SYSTEM zo TIEDOWN SYSTEMTIEDOWN SYSTEM CD T owner/developer 2.5K 2,5K VN 3K 3.25K Conifer Realty N N N N 1000 University Avenue Suite 500 4D FLOOR = P=10.5K 2ND FLOOR = P=5.25K 2ND FLOOR V=362 pif P=12K 2ND FLOOR V=400 pif P=4.95K Rochester, NY 14607 EL.=10'-9" EL.=10'-9" EL.=10'-9" EL.=10'-9" 585.324-0500 civil engineer LKMA 9K ft 9K 10,5K 11,7K 437&405 X X N N N N South Country Road 1NY 11719 � ST FLOOR V=6 3 pif 1ST FLOOR V=672 pif 1� ST FLOOR _ V=778 pif 1ST FLOOR V=873 pif Brookhaven,631.286.8668 86.866 66 r31-32 . 8 -0 -0 5'.9" -0 -4'-31"- 51.1111 4%3j" 7'-10 m.e.p.&f.p. 2'-1 14'-5 ' 10'-4�„ 11 -11,18%101' ' 2'-11 M/E Engineering, P.E. n] BL 30'- ig 150 North Chestnut Street T 9K "4 9K 9K 9K 10'R 10.5K 11.7K 11.7K "r Rochester, NY 14604 585.288.5590 structural engineer SHEAR WALL S W 1 SHEAR WALL S W 2 SHEAR WALL S W 3 SHEAR WALL S W 4 TDM Consulting Englneerinq� SCALE:1/8`=1'-0" SCALE:1/8"=1'-0" SCALE:1/8"■1'-0" SCALE:1/8"=1'-0" 550 North County Road,Suite Saint James, NY 11780 631.686.5234 key TRUE NORTH on 0 16d NAILING AT BOTTOM n PANEL PLATE PER SCHED. EDGE NAILING 2x 130170M PLATECONNECTION TO BLOCKING HOLDowNs1717. 77, project SIMPSON LTP4 ® 16" o SW SHEATHING PANEL EDGE NAILING PANEL EDGE STUDS ANCHOR BOLTS TOP PLATE BOTTOM PLATE ANCHOR BOLTS/ox. (N OTE 5) 3/4"O/SILL PLATE EMED, DEPTH VINEYARD VIEW w/ 12-8d x 1 NAILS SW1 15/32"APA PLY ONE SIDE 10d AT 3" O.C. (3)2x 36" O.C.-(2)2x SIMPSON LTP4 AT 16" O.0 SIMPSON LTP4 AT 16" O.0 SIMPSON ATS HOLDOWN SYSTEM 1"O SB/24" SW2 15/32"APA PLY ONE SIDE 10d AT 3" O.C. (3)2x 36" 0,C,-(2)2x SIMPSON LTP4 AT 16" O.0 SIMPSON LTP4 AT 16" O.0 SIMPSON ATS HOLDOWN SYSTEM 1"O SB/24" �— SW3 15/32"APA PLY ONE SIDE 10d AT 3" C.C. (3)2x 36" O.C.-(2)2x SIMPSON LTP4 AT 16" O.0 SIMPSON LTP4 AT 16" O.0 SIMPSON ATS HOLDOWN SYSTEM 1"O SB/24" 48 SW4 15/32"APA PLY ONE SIDE 10d AT 3" O.C. (3)2x 36" O.C.-(2)2x SIMPSON LTP4 AT 16" O.0 SIMPSON LTP4 AT 16" O.0 SIMPSON ATS HOLDOWN SYSTEM 1"O SB/24" County Road Greenport, dNY 11944 FLOOR TRUSS seal PANEL EDGE NARROW OR WIDE �E NEW NAILING TO R TOP RIM (OR BLOCKING) �O 6 UPPEPLATE c-,'�P DBL TOP PLATE 3' EPOACNCHOR PANEL EDGE 7 NAILING -c 076919 PC SLAB OR P.T. SILL PLATE aFESS�Q��P�, FOUNDATION I (2)2x PER SCHEDULE NOTE:THE ABOVE SPECIFIED SHEATHING CAN BE REPLACED WITH STRUCTURAL GRADE 1 OSB OF THE SAME THICKNESS AND QUANTITY. issued date description ° 1 03/15/19 Issued For Construction °�`° •�'..'° oa o a' ATS BEARING PLATE ATS PLATE WASHER Z c y° m • ATS TAKE-UP DEVICE LL' �• ATS BEARING PLATE SEE NOTE: �rI SHEATHING COMPRESSION POSTS SHEATHING BRIDGE BLOCK PER ATS DWGS SHEAR WALL & HOLDDOWNADETAIOLSAL AND NAILING I AND NAILING CUMULATIVE COMPRESSION Level 4 EDGE NAILING TO FULL HEIGHT STUD CUMULATIVE TENSION �• • I• COMPRESSION PER ATS ATS ROD DWGS CRIPPLE STUD TYPICAL SHEAR WALL NAILING DETAIL INCREMENTAL BEARING ATS ROD rl CONNECTION FROM KING STUD TO CRIPPLE STUDS PER ATS DWGS FU PER ATS DWGS EDGE NAILING TO LL HEIGHT STUDS PER ATS DWGS SHEAR WALL NOTES: CUMULATIVE COMPRESSION Level 3 F TOP PLATE DETAIL BRIDGE BLOCK DETAIL 1. SHEAR WALL DESIGN IS BASED ON THE PERFORATED DESIGN METHOD AS SPECIFIED IN SECTION 2305,3.8.2 AND CUMULATIVE TENSION TABLE 2305.3.8.2 OF THE NYS BUILDING CODE. SEE SHEAR WALL DETAILS FOR PANEL RATIOS. INCREMENTAL BEARING 2. ALL SHEAR WALL SEGMENTS WERE CHECKED FOR DEFLECTION AND DRIFT AS REQUIRED BY SECTION 23 if RUN TERMINATION DETAILS -------- OFTHE NYS BUILDING CODE. title 3. ALL PANEL EDGES TO OCCUR OVER STUDS, PLATES, RIMS OR HORIZONTAL BLOCKING, SHEAR WALL 4. NAIL SHEATHING TO INTERMEDIATE SUPPORTS AT 12" OC. 5. ALL NAILS INTO 3x MEMBERS SHALL BE STAGGERED, (OR DOUBLE -2x STUDS PER NOTE 12) 6. MIN. NAIL PENETRATION INTO STUDS IS 15/8" AT 10d NAILS. CUMULATIVE COMPRESSION Leve12 ATS ROD PER ATS DWGS —� �+—PERATSDWGS ELEVATIONS 7. PANEL EDGE STUDS INDICATE REQUIRED STUD OR HORIZONTAL BLOCKING MEMBER WIDTH AT ABUTTING PANEL CUMULATIVE TENSION SHEATHING ,I ATS TAKE-UP DEVICE OR EDGES. PROVIDE STAGGERED NAILING AT SHEATHING EDGES TO 3x6 STUDS BEHIND ADJOINING PANEL EDGES, AND NAILING •I COUPLER COMPRESSION POSTS COMPRESSION POSTS & DETAILS 8. WHERE SHEATHING IS APPLIED TO BOTH SIDES OF WALL-OFFSET PANEL EDGES TO FALL ON DIFFERENT STUDS. INCREMENTAL BEARING—N-, �•I PER ATS DWGS rl 9. NARROW BLOCKING REFERS T01 1/2" LSL RIM OR BLOCKING. WIDE BLOCKING REFERS TO 3-1/2" LSL RIM OR ATS BEARING PLATE SHEATHING EDGE NAILING TO SHEATHING EDGE NAILING TO COMPRESSION PER ATS COMPRESSION PER ATS AND NAILING DWGS AND NAILING DWGS BLOCKING. RIM JOIST/ SOLID BLOCKING 10. PROVIDE SHEAR WALL SHEATHING AND NAILING FOR ENTIRE LENGTH OF WALLS NOTED ON PLANS. FLOOR FRAMING BEYOND(TYP) I ATS COUPLER ORCTUD ATS COUPLER PROVIDE HOLDOWNS PER PLAN AT EACH END OF WALL, UNO. ATS ROD ATS ROD �' EDGE NAILING TO PROVIDE PANEL EDGE NAILING IN EACH HOLDOWN STUD AT END OF WALL, i— OVERSIZE SILL PLATE I— OVERSIZE SILL PLATE �= drawn b : JR 11. STAGGER BOTTOM PLATE NAIL. CUMULATIVE COMPRESSION Level 1 COMPRESSION PER ATS • • AT ROD CONCRETE •- • a y AT ROD y DWGS FOUNDATION 12. ALL FOUNDATION SILL PLATES SHALL BE P.T. MEMBERS AND HAVE 1/4" x 3" x 3" PLATE WASHER. CUMULATIVE TENSION �•� �• COMPRESSION POSTS WOOD BEAM checked by: TM ATS ANCHOR 0- 13, EMBED ANCHOR BOLTS 7" MINIMUM INTO CONCRETE, SEE STRUCT PLAN '' 14, (2)2x STUDS MAY BE USED IN LIEU OF 3x STUDS AT PANEL JOINTS. scale: AS NOTED NAIL STUDS TOGETHER W/2 ROWS 16d AT 6" O.C. AT SINGLE SIDE SHEATHING AND NAIL W/2 ROWS 16d AT PER ATS DWGS ATS BEARING PLATE c 3" O.C. AT DOUBLE SHEATHED WALLS. 7 AT ISOLATOR NUT project number: 10002 r RUN START(CONCRETE, 15. WHERE NOTED IN DETAILS, USE SIMPSON A35 IN LIEU OF LTP4 PLATES. SPACE AT 2/3 LTP4 SPACING. scaled inch WOOD BEAM,STEELBEAM) ID OR DETAIL WOOD BEAM DETAIL CONCRETE DETAIL .... .- 16. END OF WALL ANCHOR BOLTS SHALL BE LOCATED MAX 12" AND MIN 5" FROM END OF THE PLATE. sheet number v 17. SMALL SHEARWALL PENETRATIONS PER "BLOCKING AT SHEAR WALL DETAIL" THIS SHEET, 0 z RUN START DETAILS BUILDING A 0 0 m 9 c NAILS N2 ROWS SCHED. SHEARWALL AILS ER SCHED. SHEARWALL A' SHEATHING SHEATHING 2304.10.1 Fastener Requirements (continued) (continued) TABLE 2304.10.1-continued FASTENING SCHEDULE TABLE 2304.10.1-continued FASTENING SCHEDULE 10d NAILS 10d NAILS Connections for wood members shaft be designed in accordance with the appropriate methodology in Section 2301 2.The number and PER SCHED. PER SCHED. size of fasteners connect ng wood members shall not be less than that set forth in Table 2304.10.1. I II '•"" r SPACING AND LOCATION DESCRIPTION OF BUILDING ELEMENTS NUMBER AND TYPE OF FASTENER SPACING AND LOCATION TABLE 2104.10.1 FASTENING SCHEDULE FASTENER DESCRIPTION OF BUILDING EL,��NUMBER AND TYPE OF Wood structural panels(WSP),subfloor,roof and Interior wall sheathing to framing and particleboard wall sheathing to DESCRIPTION OF BUILDING ELEMENTS NUMBER AND TYPE OF FASTENER SPACING AND LOCATION Wall framing' 3 8 >') . __F 2-8d common(2'IZ"=0.131");or Edges intermediate supports FLOOR JOISTS " Roof inches inches 10d NAILS AT 4 O.C. 2-10d box(3"x 0.128');or 1 ) (inches) (21/2' 1 2 19.1'brace:o each stud and plate 2-3"x 0.131"nailb,of 7 Face nail panelling SIDE REQ'DH 3-8d common 2/"x 0.131');or Interior email 1.Blocking between caping joists,rafters or trusses 3.10d box(3"x 0.128");or 2-3"it gage staples, /18 crown to top plate or other framing below 3-3"x 0.131"nails:or Each end,toenail 4d casinci(1'12 x 0 080');or 3.3"14 gage staples,7118 x 0.1 crown 20.1•x 6"sheathing to each bearing 2-80 common x 0.131~);or Face nail 41.114 4d finish 0112 x 0.072"1 b 11 B E A T T Y HARVEY COC O 2-10d box(3"x .12s•) ARCHITECTS , L L P 2-8d common(21/2 x 0.131") 1 42 '/a' 6d casing(2"x 0.099");or 6 12 NEW YORK I MARYLAND x 0.131"nails Each end,toenail 21.1'x 8"and wider sheathing to each bearing 3-Bd Common(2 l2""0.131");or :ace nail 9 6d f Wish(Panel scpports et 24 Inches) BLOCKINGLTPBLOCKING Blocking between rafters or truss not at the wall 2.3"14 gage staples 3-10d box(3"x 0.128') BLOCKING PER BLOCKING PER O SCHED. SCHED. 1300 Walt Whitman Road, New York, 11747 top plate,to rafter or truss , " Floor For SI.1 incl•=25.4 mm. (A p: (631)300-1010 2.16 d common(3/2 x C.162") + 3-3"x 0.131"nails End nail 3 8d common(2112"x 0.131");or c.Neils spaced at 6 Inches at Intcrmodinto supports where spors are 48 hones or more,For moiling of wood structural panel and owner/developer 3-3"14 gage staples floor particleboard diaphfayms and shear walls,rail to Section 2305.Ndils forwall aheaUlinu are permuted to be common,box or 22.Joist:o sill,top plate,or girder 3-10d box(3"x 0.128'):or Toenail cat irp. Conifer Realty 16d common 31/"x 0.162" 6"o.c. 3-3"x D.131"naps;or PANEL EDGE NAILING ( 2 )� t.Spacing shall be 6 inches on center on the edgss and 12 inches on carte"at intermediate supports for nnnstrurtural applications. 1000 University Avenue Suite 500 Flat blocking to truss and web filler 3'x 0.131"nails @ 0"o.c. Face nail 3-3"1t gage Etaples,7116"crown Panel supports at 16 inches(20 inches if strength axis In the long direction of the panel,unless otherwise marked). NARROW BLOCK W I D E B LO C K PER SHEARWALL SCHED. FLOOR/ROOF FRAMIN 3'x 14 gage ste pies s"o.c SEE PLAN Rochester,NY 14607 8d common(21/2"x 0,131");or c.Where a rafter is fastened to an adjacent parallel ceiling joist in accordance with this schedule and the coifing joist is fastened to 585.324-0500 i 23.Rim joist,band joist,or blocking to top plate,sill the top plate in accordance with this schedl-le,the numbe•of toenails in the rafter shall be permitted to be reduced by one nail. 3.8d common(2 !�"x 0.131");or 10d box(3"x 0.128");or 3.1Od box 3•x 0.128 ;or or 6"o.c.,toenail ( ) other below 3""0.131"nails;or SHEARWALL. SEE-/ 2.Ceiling joists to top plate Each joist toenail 9 7 3.3'x 0.131"nails;Or 3"14 gage staples, Its"crown PLAN 3.3"14 Cage staples.7f18 crown civil engineer 24.1•x 6"subfloor or fess to each joist 2-8d common(2112"x 0.130:or Face nail TYPICAL DETAIL AT SHEARWALL PERP. TO FRAMIN G _LJ 3.184 carunon(3112"x 0.162');or 2-10d box(3"x 0.1261) 7&405 3.Gelling Joist not attached to parallel rafter,laps 4-10d box(3'x 0.128");u , c 437&405 over partitions(no thrust) Face nail 25.2'subfloor to joist or girder 2-16d common(3/2"x 0.162') ace nail SHEATHING AND NAILING PER 2 2X6 BLOCKING OR Country a-3~x 0.131"nails;or South Count Road (coo Section 2308.7.3.1,Table 2308.7.3.1) , , SHEARWALL SCHED. (TYP.) ( ) TYPICA CAL DETAIL AT S H EARWALL PARALLEL TO FRAMIN G 4.3"14 gage staples, 116 crown 26.2•planks(plank Rbeam-floor&roof) 2-16d common(3'/2"x 0.162•) Eacn bearing,face nail FLAT 2X4 BLOCKING Brookhaven,NY 11719 4.Ceding joist attached to parallel rater(heel joint) Per Table 2308.7.3." Face nail BEHIND STRAP, (TYP.) (stle Section 2308 7.3.1,Table 2308.7.3.1) 32"o.c..face mad at top and 631.286.8668 20d common(4"x 0.192") bottom staggered on opposite sides m•e.p. 8&f.p• 3.10d common(3"x 0.148"):or x 4.10d box(3•x 0.128");or 1O box(3"x 0.128"):or 6 PLYWOOD SHEATHING f.Collar tie to rafter 4.3"x 0.131"nails;or Face Hall 3"x 0.131'nails:or sta ger face nail at top enc bottom M/E Engineerin , P.E. 7, 7 staggered on opposite sides SIMPSON ATS PLYWOOD SHEATHING R I 4.3"14 gage staples, ,1B"crown 27.Built-up girders and beams,2"lumber layers 3"14 gage staples, /16"crown -- NOTE: USE CMSTCi 6 ANCHOR BOLT B 150 North ChestnutStreet =t-- SIMPSON ATS 3.10 r:nmmnn(3"x 0.148");or And: ANCHOR BOLT STRAP U.O.N. Rochester, NY 14604 3.16d box(31/2"x 0135");or 2-20d common(4•x 0.192");or NP COMPRESSION MEMBERS 585.288.5590 6.Rafter or roof tries to top plate c 3-10d box(3"x 0.128');or Ends and a*each splice,face nail ( ) SEE SHEAR WALL SCHEDULE 4-10d box(3'x 0.128");or Toenail (See,Section 2308.7.5,Table 2308.7.5) 3-3"x 0.131"nails;or 4.3"x gag nails; ti 7 3-3"14 gage staples,7/16"crown 2X6 FILLER TO • structural engineer R.O. AS REQUIRED SEE SHEAR WALL SCHEDULE TDM Consulting Engineerin 4.3"14 gage staples,!1e crown m COMPRESSION MEMBERS 3-16d common(3'/2"*0.162');or 7.16x1 common(3112"x 0.167");or 4-10d box(3"x 0.128'):or EXTEND STRAP PAST 3.110d box(3'x 0 178"):or End tall 2B.Ledger strip supporting joists or rafters 4-3"x box(3 nails; 8 Eacn joist or rafter,face nail WINDOW:W 550 North County Road,Suite? INDO : Saint James, NY 11780 3.3"x 0.131"Halls:or 4-3"14 gage staples,7/16"crown 16" FOR CS16 3-3"14 gage staples,7118'crown;or631.686.5234 7.Roof rafters to ridge valley or hip Wiens;or root 1 3-16d common(3'12"x 0.162');or 24 FOR CMSTCi6� 36" FOR CMSTC 14 PERPENDICULAR TO WALL rafter to 2-inch ridge boom 3.104 common(3 /2"x 0,148");or 4-10d box(3"x 0.128');or PANEL EDGE NAILING 3.16d box(31/2'x 0.135");or 29.Joist to band Joist or rim joist 4-3"x 0.131"nails;or End nal: 48" FOR CMST 12 3.10d box(3•x v 0.1);or Toenail 4-3"14 gage staples,7116 crown STRAP TOP & BOT. ALONG KING STUD 4.3"x ox(3 Waits; 8 , SHEATHIOF NG OVER FULL LENGTH A-A 4-3"14 gage staples,7110'crown 2-8d common(2112"x 0.131");or 2-10d box(3"x 0.128•);or G CORNER key 30.Bridg ng or blocking to joist,rafter or truss -ac t end.toenail SIMPSON ATS 2-3"x 0.131"nails;or 2-3"1t gage staples,7116"crown (continued) TRUE STRAP ANCHOR BOLT NORTH TABLE 2304.10.1-continued FASTENING SCHEDULE PLYWOOD SHEATHING COMPRESSION MEMBERS (confinued) L SEE SHEAR WALL SCHEDULE + DESCRIPTION OF BUILDING ELEMENTS NUMBER AND TYPE OF FASTENER SPACING AND LOCATION TABLE 2304.10.1-continued FASTENING SCHEDULE Wall SILL DESCRIPTION OF BUILDING ELEMENTS I NUMBER AND TYPE OF FASTENER SPACING AND LOCATION -Z X4, el 16d common(31i2"x 0.162"); 24"o.c.face nail L 2X6 SILL PLATE WITH FLAT 2X BLOCKING Wood structural panels(WSP),subfloor,roof and interior wall sheathing to framing and particleboard wall sheathing to 8.Stud to stud(not at braced wall panels) 10d box(3•x 0.128"):or framing' ADDED FLAT BLOCKING (USE 3X BLOCKING IF 6" ■I .P 3"x 0.131"nails;or SPLITTING OCCURS 16"o.c.face Helles Intermediate BEHIND STRAP ) 3-3"14 gage staples,71le"crown (nch s) Inform(inches�PPorts SECTION A-A 0 ID- ALL ° 16d common(3112"x 0.162");or 16"o.c.fare nail 6d common or deformed(2^x 0.113") 6 12 �! (subfloor and wall) 9 Stud to stud and abutting studs at Intersecting wait 16d box(3112"x 0.135"):or 12"o.c.face moilTYPICAL WINDOW SHEARWALL D ETAI L 14gage 3.3"14 gageestaples,corn3"" corners(at braced wall panels) 8d box or deformed(2'12*x 0.113")(roof) 6 12 71i8 crown 12"o.c.face nail 2318'x 0.113°Wali(subfloor and wall) 6 12 ANCHOR BOLT LOCATION DETALtaor 31.318'-�/2 10d common(3112"x 0.162"),or 16"o,c,each edge.face nail 1314.16 gage staple,7116"crown 4 a project 10 Built-up header(2"to 2"header) (subfloor and well) 16d box(3112"x 0.135") 12"o,c.each edge,face nail 2318"x 0.113"nail(roof) 4 8 ;" PLYWOOD SUBFLOOR. SIMPSON STRAP TIE SSP2 VINEYARD VIEW 2X BLOCKING AT PANEL EDGE NAILING STUDS PER BEARING WALL SEE SCHED FOR NAILING AT EACH STUD TYP. 11.Continuous header to stud 4.8d common(2112 x 0.131");or Toenail 1314.16 gage staple,7116"crown(roof) 3 6 SHEATHING EDGES PER SHEARWALL SCHED. OR SHEARWALL SCHED. 4.10d box(3"x 0.128") (TYP.) (TYP-) 8d common(21a'x 0.131"):or 1 ed common(3112"x 0.162");air 16"o c,face nall 6 12 2X BLOCKING AT STRAP L / T.O. ROOF D 6d deformed(2"x 0.113") + i2.Top plate to top plate 10d box(3"x 0.128"):or 32.19/3?" 314" 2318•x 0.113"nail;or EL,= SEE PLAN County Road 48 3"x 0.131"nails;or 12"o c.face nail 7 4 B Y 3"14 gage staples,7115 crown 2"i6 gage staple, 116 crown Greenport, NY 11944 , 10d common(3"x 0.148"):or LADDER TYPE TRUSS 8-16d common(3112*x 0.162").or 33. 18"-1 /4" 6 12 Each aide of and joint,face nail 8d deformed(2112"x 0.131") AT EXTERIOR WALLS seal C F N 13..Top plate to top plate,at end joints 12-iOd box(3"x 0.128');or (minimum 24"lap splice length 4o G 12-3"x 0.131•Waits;or Other exterior wall sheathing SIMPSON LTP4 INSTALLED c 12-3"14 gage staples,7118"crown each side of and joint) g 111"gnlvarl roofing nail AS PER MANUFACTURERCEI CEI "ll 6, 16d common(31/2 x 0.162");or 16"oe.face nail 34.112"fiberboard sheathing' (7118"head diameter);or 3 6 SPECIFICATIONS. !� * 14.Bottom plate to joist,rim joist,band joist or 1 1114"16 gage staple with 7/16"or 1'crown ° as y 1 00, 16dbox(312"x0.135');or , SIMPSON LTP4 ® 2 -0 O.C. �' blocking(not at braced wall panels) 3"x gage nails;or 12"o.c.tate Heil 1314"gnlvrni7ed renting mad ALONG PLYWOOD JOINT 3"14 gage staples,7/16"crown 35.25/32"fiberboard sheathing' (711x'diameter head);or 3 6 1,'• tri �F '} ; 2-16d common(31/2'x 0.162");or 1112'16 gage staple with 7116'or 1"crown �+ C `f' 07 919 C r 15.Bottom plate to joist,rim joist,bend joist 3-16d box(3112"x 0.135"):or Wood structural panels,combination subfloor underlayment to framing 2x6 STUDS ® 16" O.C. SIMPSON STRAP TIE ©All- 5S1o�P�, All- or blocking at braced well panels 4.3"x 0.131"nails:or 16"o c.Lace nail ( 1 _C J�� 4.3"14 gage stapfeS,7118•crown 36 314"end lase 8d common(21"2""0.131");or 6 12 6d deformed(2"x 0.113") TYP. (TYP.)$ ® EACH STUD 4-8d common(21/2"x 0.131");or , 8d summon(2 !2"x 0.131");or i - a L 71,_3 4.10d box(3"x 0.128');or 37.718-1" 6 12 Toenail 8d deformed(2!2"x 0,131") J a-3"x 0.131"Waits;or issued date description 4-3"14 gage staples,7118"crown;or LSTA12 STRAP (TYP.) E 10d common(3"x 0.148);or 18.Stud to top or bottom plate 38.1118 -111," 8d deformed(2112'x 0.131") 6 12 OVER STRUCTURAL T.O. 2ND FL. SUB FL, 2.16d common(3112 x 0.162");or SHEATHING 3-10d box(3"x 0.128'►;or End nail Panel siding to framing 3-3"x 0.131"nails;or EL.= SEE PLAN 1 03/15/19 Issued For Construction 3.3"14 gage staples,7116''crown 39.112 or less (a/,"x0 106"): 'sofantsiding 6 12 OPENING WITHIN STUD SPACE OPENING LESS THAN 2 STUD SPACES 2-18d common(3112'x 0.162"),or 6d corrosion-resistant casing(2"x D 099") 3-10d box(3"x 0.128');or 8d corrosion-resistant sidin 17.Top or bottom plate to stud 3.3"x 0.131'nails;or End nail (2315"x 0 128"):or gSIMPSON LTP4 INSTALLED 3.3"14 gage staples,7115'crown 40.pie' 8d corrosion-resistant casing 6 12 TYPICAL DETAIL AT SMALL SHEARWALL PENETRATI0NS AS PER MANUFACTURER 2-16d common(3112"x 0.162"):or (2'12"x 0.113") SPECIFICATIONS. 18.Top plates,laps at corners and Intersections 3.10d box(3"x 0.128");or Face nail SIMPSON LTP4 ® 2'-0" O.C. 3.3"1 m0.13`1"age na l7 ALONG PLYWOOD JOINT 3.3"14 gage staples, 11�'crown FLOOR PLATE (10) 16d NAILS EA SIDE OF SPLICE RIM BOARD NAILING SHCED. 2x6 STUDS ® 16" O.C. STRAP TYPE SSP FLOOR L (TYP ) e;' E STRAP AT EACH STUD (NO BOTTOM SPLICE IN THIS AREA) FLOOR PLATE-1Ed (3 4") BOX 16" O.C. 3x3x�" PLATE WASHER 1" PREMOLDED Jill HOOKED ANCHOR F+ 4'-o" MIN. 4'-0" MIN. BOLT @ 3'-0" O.C. ,. F 2 IN OF)1BOTE P SIDE FLOOR/WALL PANEL-8d (2 �") COMMON s" O.C. FILLER TYP. SPLICE " 4 SLAB ON GRADE TOE NAIL-10d (3) BOX 6 O.C. T.O. 1ST FL. SLAB X I x x x x x x x x I I x NAIL EL.= SEE PLAN x-x-X-X-X RADE EE ARCH. i x x x I x x x x I x ( x TRUSS JOIST „ RIM BOARD ool li o title 2X6 ® 16 oc Ii l 16d AT 16" O.C. I IJ I 16d AT 16" O.C. (5) 16d D ETAI L AT RIM BOARD 2 1 2" �2" TYPICAL STAGGER TYP. I PLAN� ( STAGGER TYP. 16d ® 8" oc � 3/4" PLYWOOD " #5012" D DETAILS l I 2X6 ® 16oc -H USE AT ALL EXTERIOR I 1 SIM'SON JOIST HANGER 5 DOWELS o WALLS AND INTERIOR ' TOP PIECE SPLICE BOTTOM PIECE SPLICE -- 16d ® 8 oc • 012" O.C."I Z in BEARING AND I AT STUD CL TYP. AT STUD CL TYP. 3/4" PLYWOOD • owl SHEARWALLS i 1 i; I ( FLOOR JOIST D i r drawn by: JR t 1 I 3#5 BARSCONT. U WOOD EEAM checked by: TM J AT CORNER FLOOR JOIST scale: AS NOTED #5012" O.C. f1 " 6 6 project number: 10002 BLOCKING ® 32" oc scaled inch a LFLOOR JOIST HUNG PSL BEAM sheet number 0 UELEVATION FROM PARALLAM HEADER BLOCKING DETAIL TYPICAL WALL STRAPPING & TIE DETAIL z BUILDING A _ a OTE• TYPICAL TOP PLATE LAP SPLICE DETAIL TYPICAL WOOD FRAMING DETAILS SIMPSON HOLDOWNS TO BE INSTALLED AS PER MANUFACTURER SPECIFICATIONS. + + + + + + + + + 4S3 * 10 0, 0 COLUMN FOUNDATION WALL WALL REINFORCEMENT 1'-6" PIPE TRENCH MIN. EXCAVATION NEW COLUMN T/2 ADD 2-#5 ALL AROUND EXTEND PIPE SLEEVE SEE PLAN FOR SIZE 3'-0" 2'-0" 2 -0 MINIMUM BEYOND EDGE OF PIPE TO CLEAR REINFORCEMENT TO MATCH OPENING SLEEVE BY}" BEATTY HARVEY COCO FOOTING REINFORCEMENT _ (TYP) NO PIPE IN IF REQUIRED THIS HEIGHT A R C H I T E C T S , L L P 5" SLAB ON GRADE SEE BASE PLATE DETAIL _ NEW YORK MARYLAND ADD 145 x4' 0" EACH PIPE z 1300 Walt Whitman Road, New York, 11747 CORNER z A p: (631)300-1010 x—x- x—x—x x x x—x—x—x—x BOTTOM OF per �• FOOTING OPTIONAL JOINT--\ owner/developer cD c', / I mi 1000 University Avenue Realty SEE FOOTING TERMINATE INTERRUPTED = _ Rochester, NY 14607 BARS OF SINGLE LAYER WITH A >< STANDARD HOOK.ADD AT S C H E D U L E F O R 2 585.324-0500 0 0 REINFORCEMENT INTERRUPTED BARS IN = _ _ DOUBLE LAYER U-SHAPED 1 W • • • BARS TO MATCH WALL z civil engineer UNDISTURBED EARTH REINFORCING, SPLICE 1.3(LD) LKMA WHERE PIPE TRENCH EXCAVATION IS ) 437&405 SEE FOOTING SCHEDULE 9 REQUIRED PARALLEL TO FOOTING IT SHALL " MIN. (TYP CO South Country Road r T=SLAB THICKNESS (ALTERNATE TO SLOPED FOOTING) BE KEPT ABOVE THIS LINE, STEP FOOTING AS Brookhaven,NY FO 11719 . 1 NECESSARY TO MEET THIS REQUIREMENT. PLIDTH U S4'-O" 631.2868668 .8668 TYPICAL FOOTING DETAIL. TYPICAL STEPPED FOOTING DETAIL TYPICAL WALL OPENING DETAIL SCALE: NTS m.e.p. &f.p. M/E Engineering, P.E g� SCALE: N.T.S. SCALE: N.T.S. TYPICAL DETAILS OF PIPE AT F Rochester, NY 14604 _T g 150 Nor h Chestnut Street 585.288.5590 WALL structural engineer HORIZONTAL TDM Consulting Engineering BARS 550 NorthSaint my Road,Suite TOP OF PIERNY (ANCHOR NOT SHOWN) SEE PLAN HORIZONTAL BARS TYPICAL EDGE OF PIER OR 631.686.5234 BASE PLATE WHICHEVER IS GREATER CD STEEL COLUMN SEE WALL SECTIONS SEE SCHEDULE key • • FOR REINFORCEMENT FOR SIZE _�=L TRUE #4 TIES AT 12" O.C. FULL DEPTH PRE-MOLDED /—STONE CONTRACTION JOINTS NORTH A�— I -JA JOINT FILLER I I • 36 DIA, DOWELS. SAME ,P, FILL AROUND COLUMN 1'-0" °a ° o c AFTER FLOOR IS CAST z SIZE AND SPACINGV ° a ° 45 AS HORIZ. BARS F9 ■� °' FOOTING DOWELS TO N = , -1 ( I 1 =71 n II I=;, =71= I �_ i = 1 =I IT�=_ I _1 I r7= 1 PRE-MOLDED MATCH VERTICAL • • CORNER WALLS INTERSECTING WALLS JOINT FILLER FOR FOOTING SEE PLAN OR NOTE: LAP REINFORCING AS SHOWN OR PROVIDE CORNER BARS.WHERE CORNER REINFORCEMENT - SCHEDULE 8#6 BARS IS DIFFERENT SIZE, BEND AND LAP LARGER SIZE BARS. project TYPICAL ISOLATION JOINT DETAIL. VINEYARD VIEW TYPICAL WALL INTERSECTION DETAIL SCALE: N.T.S. °�- SECTION A-A SCALE: NTS County Road 48 -�— Greenport, NY 11944 seal OF NEW y� NOTE:ALL PIERS TO BE REINFORCED AS SHOWN ABOVE UNLESS OTHERWISE NOTED ON PLAN OR IN SECTION. ��` �p5 MIR4�� 0 TYPICAL PIER DETAIL FOOTING SCHEDULE DESIGN SOIL BEARING 2000PSF ~� SCALE: N.T.S. BOTTOM REINF. MARK SIZE DEPTH EACH WAY REMARKS ��, p76919�� F2.5 2'-6" x 2'-6" 1'-3" 4-#4 r ESQ F3.0 3'-0" x 3'-0" 1'-3" 444 #4 E� FULL DEPTH CONTRACTION JOINT 1/8 " WIDE EXTEND ALL STEELissued date description T JOINT FILLER (SEE GENERAL NOTES FOR LOCATION) THRU JOINT F3.5 3 -6 x3 -6 1 -3„ 4-#4 E �,. 1" CONT. F4.0 4'-0" x 4'-0” 1'-3" 445#5 1 03/15/19 Issued For Construction � KEY F4.5 4'-6" x 4'-6" 1'-3" 545 #5 X—x--X—X— x—x—x—x—x—X x—x—x—X —x—x—x—x—x—x—X X—x—X—x—X x—X x—x—x—x—x F5.0 5'-0" x 5'-0" 1'-3" 6-#5 F5.5 5'-6" x 5'-6" 1'-6" 6-#5 ISOLATION JOINT SAW-CUT CONTRACTION JOINT CONSTRUCTION JOINT F6.5 6'-6" x6'-6" 1'-6" 7-#6 F7.0 7'-0"x 7'-0" 1'-9" 746 #6 TYPICAL SLAB JOINT DETAILS SCALE: N.T.S. CONC. SLAB-ON-GRADE --� W.W.F #4 a 12 DEPRESSION FOR LOCATION 2-0 10 MIL POLYETHYLENE SEE ARCH. DWGS. LOCATION SHEETS VAPOR BARRIER DEPRESSION FOR title 6" CRUSHED STONE 1 #4(CONT SEE ARCH. DWGS. _x_x —x—x—x—x TYPICAL OVER COMPACTED FILL - .) X_x FOUNDATION X—x — x—x—x—x—x—x—x—x—x x—X—x —x N x—x—x—X— 12 t' z • DETAILS 0 0000010-o-0 0 000 0 0 0 0 0 0 0 00°0 12 i�7 _/7�,gr 99�9��i��ij�i��i�..�j� 12 12 LD 8" ^ NOTE: SEE PLAN FOR SLAB THICKNESS AND REINFORCEMENT 8"MIN OR LAB THICKNESS MIN OR SLAB THICKNESS - drawn by: JR S TYPICAL SLAB CONSTRUCTION DEPRESSION <8 DEPRESSION<8" checked by: TM CL CHANGE IN SLAB ELEVATION scale: AS NOTED U project number: 10002 TYPICAL SLAB ON GRADE DETAILS sheet number scaled inch 0 U ° SCALE: N.T.S. z BUILDING A 0 4H S4000 v a� F ENGiNEERiNG THIS PROJECT SHALL BE BUILT AND TESTED FOR ENERGY STAR QUALIFIED HOMES,VERSION Mechanical/Electrical Engineering Consultants M/E Project#170412 3.1 (REV 9).' THE FOLLOWING ITEMS ARE INTENDED AS AN OUTLINE OF THE REQUIREMENTS FOR Rochester I Buffalo I Syracuse I Schenectady HVAC SYMBOL LIST THE HVAC CONTRACTOR. REFER TO THE ENERGY STAR WEBSITE FOR THE FULL LIST OF 150 N.CHESTNUT ST. 585288.5590 I , OFFICIAL REQUIREMENTS. ROCHESTER NY 14604 www.meengineering.com SYMBOL DESCRIPTION MBH THOUSAND BTU/HOUR 1. DOCUMENTATION: 5. WHOLE-BUILDING DELIVERED VENTILATION: NTS NOT TO SCALE a. PROVIDE DOCUMENTATION ESTABLISHING THE FOLLOWING: a. RESNET-APPROVED THIRD PARTY RATER-MEASURED VENTILATION RATE SHALL GENERAL DESIGN CRITERIA: (E) EXISTING BEATTY HARVEY COCO , (L) ACOUSTIC THERMAL LINING - 1%2" THICK I. THE HVAC CONTRACTOR MUST BE AN ENERGY STAR PARTNER & BE WITHIN 100-120%OF DESIGN VALUE. A. THIS PROJECT SHALL BE DESIGNED AND CONSTRUCTED IN ACCORDANCE WITH ARCHITECTS L L PTHE FOLLOWING ENERGY CONSERVATION AND FUNDING PROGRAMNEW YORK MARYLAND COMPLETE THE ONLINE VERSION 3 BUILDER ORIENTATION. 6. CONTROLS S CFM CUBIC FEET PER MINUTE THE MOST STRINGENT CRITERIA SHALL APPLY. 1300 Walt Whitman Road, New York, 11747 AFF ABOVE FINISHED FLOOR II.THE HVAC CONTRACTOR MUST BE CREDENTIALED BY AN a. OVERRIDE CONTROLS FOR CONTINUOUSLY OPERATING VENTILATION/EXHAUST p:(631)300-1010 AD ACCESS DOOR - ENERGY STAR V3.1 (REV 9), WITH CHECKLISTS. EPA-RECOGNIZED HVAC QUALITY INSTALLATION TRANING & FANS SHALL BE READILY ACCESSIBLE AND CLEARLY LABELED. - ENTERPRISE GREEN COMMUNITIES owner/developer RL REFRIGERANT LIQUID OVERSIGHT ORGANIZATION. - HCR HANDBOOK (VERSION: 2018) RS Conifer Realty REFRIGERANT SUCTION b, PROVIDE 24V, DIGITAL, 7-DAY PROGRAMMABLE THERMOSTAT FOR EACH Rochester, NY e 5 00 5 ity Avenue Suite 1000 Univers VRV REFRIGERANT PIPING - 2 PIPES b. THE HVAC CONTRACTOR MUST COMPLETE AND SUBMIT THE LATEST VERSION HEATING/COOLING SYSTEM. PROVIDE ADAPTIVE RECOVERY IF SUPPLEMENTAL VRV REFRIGERANT PIPING - 3 PIPES OF THE"HVAC SYSTEM QUALITY INSTALLATION CONTRACTOR CHECKLIST" FOR ELECTRIC HEATING COIL IS UTILIZED. 14607 00 EACH BUILDING IN THIS PROJECT. 585.324-0500 D DRAIN 7. VENTILATION AIR INLETS & SOURCE: W/C WALL CAP THIS CHECKLIST INCLUDES THE HVAC CONTRACTOR PROVIDING THE RD RADIATION DAMPER FOLLOWING ITEMS: a. ALL VENTILATION AIR INLETS SHALL BE LOCATED A MINIMUM OF 10'-0'FROM civil engineer CONTAMINATION SOURCES SUCH AS EXHAUST STACKS,VENTS, FLUES,VEHICLE LKMA 12" ROUND DUCT - IN INCHES - CONDENSING UNIT REFRIGERANT TESTS&CALCULATIONS EXHAUST. GENERAL CODE CRITERIA: 437&405 South Country Road DUCT SECTION - SUPPLY - AIRFLOW TESTS b. VENTILATION AIR INLETS SHALL BE LOCATED A MINIMUM OF W-0'ABOVE A. THIS PROJECT SHALL BE DESIGNED AND CONSTRUCTED IN ACCORDANCE WITH Brookhaven, NY 11719 GRADE/ROOF LEVEL IN CLIMATE ZONES 4-8(NEW YORK IS IN CLIMATE ZONE 6). THE FOLLOWING BUILDING CODES 631.286.8668 ELECTRICAL MEASUREMENTS® DUCT SECTION - RETURN c. PROVIDE INSECT SCREEN ON EACH AIR INLET. - 2015 INTERNATIONAL CODE COUNCEL CODES- 2017 NYS ICC COMMENTARY m.e.p. &f.p. A - DOCUMENTATION OF FURNACES,CONDENSING - NATIONAL ELECTRICAL CODE M/E Engineering, P.E. �— ®B WIDTH A x DEPTH B UNIT AHRI CERTIFICATION; BALANCE REPORTS 8. LOCAL.A MECHANICAL EXHA ST: - LOCAL CODES AND ORDINANCES I 150 North Chestnut Street I Rochester, NY 14604 ter► AIR FLOW - DOCUMENTATION INDICATING VENTILATION SYSTEM TYPE, a. IN EACH KITCHEN &BATHROOM,A SYSTEM SHALL BE INSTALLED THAT 585.288.5590 LOCATION, DESIGN RATE EXHAUSTS DIRECTLY TO THE OUTDOORS. ® 4 WAY SUPPLY DIFFUSER structural engineer c. THE HVAC CONTRACTOR MUST COMPLETE&SUBMIT THE LATEST VERSION OF 9. VENTILATION & EXHAUST FAN RATINGS: ® 3 WAY SUPPLY DIFFUSER THE"HVAC SYSTEM QUALITY INSTALLATION RATER"CHECKLIST. TDM Consulting Engineerin a. INTERMITTENT OPERATING FANS SHALL BERATED FOR =< 3 SONES. 550 North County Road,Suite? ® 2. DUCT QUALITY INSTALLATION Saint James, NY 11780 2 WAY SUPPLY DIFFUSER b. CONTINUOUSLY OPERATING FANS SHALL BE RATED FOR =< 1 SONE. 631.686.5234 THE HVAC CONTRACTOR SHALL CERTIFY THAT: RETURN OR EXHAUST c. FANS SHALL BE ENERGY STAR LABELED. REGISTER OR GRILLE a. ALL DUCTWORK SHALL BE INSTALLED WITHOUT KINKS OR SHARP BENDS. A REGISTER, GRILLE OR DIFFUSER TAG 10. COMBUSTION APPLIANCES B A - TYPE b. AN OPPOSED BLADE VOLUME DAMPER IS PROVIDED IN EACH SUPPLY DIFFUSER. GENERAL NOTES: key C B - NECK SIZE a. FURNACES&WATER HEATERS SHALL BE MECHANICALLY DRAFTED OR C e CFMc. BEDROOMS SHALL BE PRESSURE BALANCED USING ANY COMBINATION OF DIRECT-VENTED TO THE OUTDOORS. A. GENERAL NOTES, SYMBOLS LIST AND DETAILS ARE APPLICABLE TO ALL TRUE TRANSFER GRILLES, RETURN DUCTS AND/OR UNDERCUT DOORS TO PROVIDE 1 DRAWINGS WITHIN DIVISION 23. 1111111 L NORTH SD DUCT SMOKE DETECTOR SQ. IN. FREE AREA OPENING PER 1 CFM OF SUPPLY AIR DELIVERED TO 11. FILTRATION: BEDROOM,OR A RATER-MEASURED PRESSURE DIFFERENTIAL OF <= 3 PA.WITH B. COORDINATE WORK OF DIVISION 23 WITH THAT OF OTHER SECTIONS. C 7-DAY PROGRAMMABLE THERMOSTAT RESPECT TO MAIN BODY OF HOUSE. ALL DUCTS JOINTS CONNECTIONS a. PROVIDE MINIMUM MERV 8 FILTER IN EACH DUCTED AIR CONDITIONING SYSTEM. � 7-DAY PROGRAMMABLE THERMOSTAT BOXES, BOOTS ETC SHALL BE SEALED WITH MASTIC. (REFER TO EPA'S'HVAC C. READ SPECIFICATIONS FOR REQUIREMENTS PERTAINING TO THESE DOCUMENTS. I G W/ GUARD SYSTEM QUALITY INSTALLATION RATER CHECKLIST"DESIGN MANUAL FOR b. PROVIDE GASKET OR OTHER SEALING MECHANISM TO PREVENT ------- AAD AUTOMATIC AIR DAMPER MORE INFORMATION.) BYPASS/LEAKAGE. D. FITTINGS SHOWN ARE TO BE PROVIDED. NO SUBSTITUTES SHALL BE ALLOWED — WITHOUT PRIOR CONSENT FROM ARCHITECT/ENGINEER. ��■ --------FD FIRE DAMPER --------SD SMOKE DAMPER 3. DUCT INSULATION: 12. EFFICIENCY: E. INSTALL DUCTWORK AND PIPING CONCEALED, UNLESS SPECIFIED OTHERWISE AND --------FC FLEX CONNECTOR -_ DUCTWORK a. ALL DUCTWORK& FAN COILS/AIR HANDLERS SHALL BE INSTALLED WITHIN a. AIR-COOLED CONDENSING UNIT SHALL BE MINIMUM 15 SEER. UNIT SHALL BECLEAR OF CEILING INSERTS. --------M MOTORIZED DAMPER THERMAL ENVELOPE. NO DUCTWORK OR EQUIPMENT SHALL BE INSTALLED IN ENERGY STAR QUALIFIED. F. ALL WORK SHALL BE COORDINATED WITH ALL TRADES INVOLVED. OFFSETS IN —I VOLUME DAMPER UNCONDITIONED SPACES SUCH AS ATTICS OR GARAGES. PIPING AND DUCTS (INCLUDING DIVIDED DUCTS) AND TRANSITIONS AROUND a SINGLE LINE DOUBLE LINE DUCT TAKEOFFS b. AIR SOURCE HEAT PUMP SHALL BE MINIMUM 8.5 HSPF/15 SEER/12 EER WITH OBSTRUCTIONS SHALL BE PROVIDED AT NO ADDITIONAL COST TO THE OWNER. b. INSTALL INSULATION WITHOUT MISALIGNMENTS, COMPRESSIONS,GAPS OR ELECTRIC BACK-UP. UNIT SHALL BE ENERGY STAR QUALIFIED. G. VERIFY ALL EQUIPMENT CONNECTIONS WITH MANUFACTURER'S CERTIFIED project TRANSITION VOIDS,AROUND ALL CONNECTIONS AND EXPOSED DUCTWORK. SQUARE TO ROUND DRAWINGS. VERIFY AND PROVIDE DUCT TRANSITIONS TO FURNISHED R R RISE IN DUCT - IN c. DUCT BOOTS SHALL BE INSULATED. EQUIPMENT. FIELD VERIFY AND ALL DIMENSIONS BEFORE FABRICATION. VINEYARD VIEW DIRECTION OF AIRFLOW H. ALL MATERIAL AND EQUIPMENT SHALL BE NEW. d. INSULATE DUCTWORK PER SPECIFICATIONS. D D D DROP IN DUCT - IN I. INSTALL ALL EQUIPMENT PER MANUFACTURER'S INSTRUCTION AND —�— �— DIRECTION OF AIRFLOW 4. DUCT AKA : LOCAL, STATE, AND NATIONAL CODES. D DNS 24x12 WUP DN �24x12 UP SUPPLY DUCT TURNING County Road 48 UP OR DOWN a. DUCT LEAKAGE SHALL BE MEASURED AND DOCUMENTED BY A J. MECHANICAL CONTRACTOR SHALL PROVIDE ALL PENETRATIONS THROUGH Greenport, NY 11944 ,„ 24x12 ,, RETURN DUCT TURNING RESNET-APPROVED THIRD PARTY RATER, USING RESNET-APPROVED TESTING WALLS, FLOORS AND ROOFS NECESSARY FOR INSTALLATION OF MECHANICAL DN,��UP DN L 24x12 UP PROTOCOL,AFTERALL COMPONENTS OF SYSTEM HAVE BEEN INSTALLED. SYSTEMS. DO NOT DRILL, CORE OR CUT ANY PORTION OF COLUMNS, BEAMS, seal UP OR DOWN LEAKAGE LIMITS SHALL BE ASSESSED ON A PER-SYSTEM BASIS. JOISTS OR BRIDGING RIBS. N 6" BOOT K. ARCHITECT TO PROVIDE CUSTOM COLOR SELECTION FOR WALL CAPS, ROOF ��F�.. pq N TAP SUPPLY/RETURN I. TOTAL RATER-MEASURED DUCT LEAKAGE SHALL MEET ONE OF THE JACKS, VENT TERMINATIONS & LOUVERS. x RECTANGULAR MAIN FOLLOWING: cv 14x8 RECTANGULAR BRANCH L. PROVIDE INSULATED REFRIGERANT PIPING BETWEEN EACH FAN COIL UNIT & HEAT 6 BOOT - ROUGH-IN: <= 4CFM25 PER 100SF OF CONDITIONED FLOOR PUMP UNIT. PIPING SHALL BE SIZED AND INSTALLED PER MANUFACTURER'S ci N AREA. INSTRUCTIONS. CAULK & SEAL REFRIGERANT PIPE PENETRATION THRU EXTERIOR x 14" � TAP SUPPLY/RETURN WALL, WEATHER-TIGHT. r 04 RECTANGULAR MAIN - FINAL: <= BCFM25 PER 100SF OF CONDITIONED FLOOR AREA. �' N N 14" ROUND BRANCH Fo 069 M. COORDINATE FINAL DUCTWORK ROUTING & FITTINGS WITH APPROVED TRUSS II.DUCT LEAKAGE TO OUTDOORS SHALL BE <= 4CFM25 PER 100SF OF DESIGN. MODIFY LAYOUT AS NECESSARY TO ROUTE DUCTWORK THRU TRUSS CONICAL CONDITIONED FLOOR AREA. WEBS. 14„ 00 TEE SUPPLY/RETURN ROUND MAIN b. ALL DUCTWORK SHALL BE RIGID METAL DUCT. NO FLEXIBLE DUCTWORK WILL N. REFER TO MANUFACTURER'S INSTRUCTIONS FOR SIZING & INSTALLATION OF issued date description Ek � 14" ROUND BRANCH BE ALLOWED. REFRIGERANT PIPING IN "LONG LINE" APPLICATIONS. E LATERAL 0. PROVIDE MASTIC SEALANT ON ALL JOINTS, LONGITUDINAL & TRANSVERSE 1 03/14/19 Issued for Construction SUPPLY/RETURN c. DUCT BOOTS SHALL BE SEALED TO THE FLOOR,WALL OR CEILING USING SEAMS AND CONNECTIONS IN DUCTWORK. MASTIC SEALANT SHALL BE LISTED 14" 50 ROUND MAINMASTIC. & LABELED IN ACCORDANCE WITH UL 181A OR UL 1818. DUCTWORK SHALL BE INSPECTED BY OWNER'S REPRESENTATIVE PRIOR TO INSTALLATION OF 14" ROUND BRANCH d. SEAL DUCTWORK INSULATION TO BOOT WITH MASTIC TO PREVENT INSULATION. SEALANT SHALL BE LOW VOC. ACCUMULATION OF CONDENSATION. J P. WALL CAPS & ROOF JACKS SHALL BE CORROSION RESISTANT GALVANIZED MITERED ELBOW WITH e. SEAL EXHAUST FANS TO DUCTWORK. FANS SHALL BE SEALED TO DRYWALL STEEL WITH BIRD SCREEN AND BACK DRAFT DAMPER. COLOR SELECTION TURNING VANES WITH MASTIC. BY ARCHITECT. f. SEAL ALL REGISTER/GRILLE/DIFFUSER BOXES TO DUCTWORK. Q. MOUNTING HEIGHT FOR THERMOSTATS SHALL BE 46" TO TOP OF COVER, ABOVE FINISHED FLOOR. DUCTWORK WITHIN g. PROVIDE MASTIC SEALANT ON ALL JOINTS, LONGITUDINAL&TRANSVERSE TRUSS SPACE R. MAINTAIN A MINIMUM 36" CLEARANCE BETWEEN SUPPLY DIFFUSERS/ REGISTERS SEAMS,AND CONNECTIONS IN DUCTWORK. MASTIC SEALANT SHALL BE LISTED AND SMOKE DETECTORS. &LABELED IN ACCORDANCE WITH UL 181A OR UL 181 B. DUCTWORK SHALL BE INSPECTED BY OWNER'S REPRESENTATIVE PRIOR TO INSTALLATION OF S. COORDINATE DUCTWORK ROUTING AND INSTALLATION WITH OTHER TRADES. INSULATION. T. FOR IN-UNIT DEVICES (THERMOSTATS), REFER TO ARCHITECTURAL & ELEVATION F PLANS FOR EXACT LOCATIONS & HEIGHTS. U. CONTRACTOR SHALL PROVIDE REFRIGERANT CHARGE TEST CERTIFICATION. title GENERAL NOTES AND SYMBOLS - GENERAL DUCTWORK NOTES: HVAC A- COORDINATE EXACT LOCATION OF ALL DUCTWORK ROUTES, EQUIPMENT AND DEVICES WITH OTHER SERVICES. G� B• MAINTAIN SERVICE CLEARANCES OF ALL EQUIPMENT. ENSURE NO OTHER 0 SERVICES RUN THROUGH ACCESS AREA. drawn by: BNS C• DISPOSE OF ALL WASTE MATERIALS, CAUSED BY CONSTRUCTION, OFF SITE IN checked by: CEF A PROPER LEGAL MANNER. D_ WHERE DUCTS PASS ABOVE EACH OTHER, OFFSET AS REQUIRED INTO JOIST scale: SPACE. E. INSTALL ALL DUCTWORK WITHIN THERMAL ENVELOPE OF BUILDING. project number: 10002 scaled inch F. ALL DUCTWORK BOOTS MUST BE SEALED TO THE DRYWALL OR FLOOR sheet number SHEATHING PENETRATION. BUILDING A `° ENGiNEERiNG -J Mechanical/Electrical Engineering Consultants WE Project#170412 Rochester I Buffalo I Syracuse I Schenectady 150 NiCHESTNUT ST. 585 288.5590 s ;fit�i�, V ROCHESTER ww. NY 14604 wmeengineering.com iw i+.t ri'aiep IL BEATTY HARVEY COCO A R C H I T E C T S , L L P NEW YORK I MARYLAND A 1300 Walt Whitman Road, New York, 11747 p:(631)300-1010 DUCTLESS SPLIT SYSTEM/HEAT PUMP AIR CONDITIONING UNIT SCHEDULE owner/developer OUTDOOR UNIT INDOOR UNIT Conifer Realty COOLING CAPACITY HEATING Q 47F/43F ELECTRICAL DESIGN EQUIPMENT 1000 University Avenue Suite 500 SYSTEM N0. OF UNIT N0. LOCATION TMBH SMBH MBH COP HSPF SEER REFRIG INDOOR UNIT N0. UNIT TYPE LOCATION CFM VOLTS PHASE MCA(A) REMARKS Rochester, NY 14607 UNIT.. VOLTS PHASE MCA MOP INDOOR UNIT OUTDOOR UNIT 585.324-0500 SD-HP-1 SLIMDUCT MECH CLOSET 265 208 1 - FUJITSU MODEL ARU9RLF civil engineer DSS-1 CU-DSS-1 GRADE 18.0 - 22.0 3.79 10.3 21.5 410A 2 208 1 19.7 20 FUJITSU MODEL AOU18RLZFZH 1,2,3,4 DSS-HP-1 HIGH WALL LIVING ROOM 253 208 1 - FUJITSU MODEL ASU9RLF1 LKMA 437&405 SD-HP-2 SLIMDUCT MECH CLOSET 324 208 1 - FUJITSU MODEL ARU9RLF South Country Road Brookhaven, NY 11719 DSS-2 CU-DSS-2 GRADE 18.0 - 22.0 3.79 10.3 21.5 410A 2 208 1 19.7 20 FUJITSU MODEL AOU24RLXFZH 1,2,3,4 631.286.8668 DSS-HP-1 HIGH WALLI LIVING ROOM 253 208 1 - FUJITSU MODEL ASU9RLF1 B SD-HP-3 SLIMDUCT MECH CLOSET 353 208 1 - FUJITSU MODEL ARU9RLF M/E Engineering,150 North Chestnut treet P.E. ,R m.e.p. &f.p. DSS-3 CU-DSS-3 GRADE 24.0 - 25.0 4.04 10.3 20 410A 3 208 1 25.1 30 DSS-HP-2 HIGH WALL LIVING ROOM 253 208 1 - FUJITSU MODEL ASU7RLF1 FUJITSU MODEL AOU24RLXFZH 1,2,3,4 -� Rochester, NY 14604 DSS-HP-1 HIGH WALL LIVING ROOM 253 208 1 - FUJITSU MODEL ASU7RLF1 585.288.5590 REMARKS: structural engineer 1. PROVIDE WITH LOW AMBIENT KIT, AND WIND BAFFLE, HARD WIRE TSTAT KIT. TDM Consulting Engineering 2. PROVIDE WITH AN INTERNAL CONDENSATE PUMP 550 North County Road,Suite E 3. PROVIDE WITH LOW TEMPERATURE HEATING (-15 DEG F) Saint James,NY 11780631.686.5234 4. PROVIDE QUICK SLING 18" MINI SPLIT STAND (QSM1800). STAND SHALL BE PERMINITLY FIXED TO THE CONCRETE PAD PER HCR REQUIREMENTS key TRUE NORTH FAN SCHEDULE �c FAN CHARACTERISTICS MOTOR CHARACTERISTICS 0 UNIT NO. LOCATION SERVICEBLADE MANUFACTURER & MODEL No. REMARKS S.P. FAN TYPE CFM SONES DRIVE RPM HP (W) VOLTS HZ PHASE STARTER w TYPE (In. WC) RPM �■ EF-A1 TOILET APTS CLG FC 80 0.25 - 0.3 DIRECT (7.0) 120 60 1 INCLUDED PANASONIC WHISPERGREEN SELECT FV-0511VKSL2 1,3,4,5,7,8,9 EF-A2 TOILET APTS CLG FC 1 80 0.25 - 0.3 DIRECT (7.0) 120 1 60 1 1 1 INCLUDED PANASONIC WHISPERGREEN SELECT FV-0511VKSL2 2,3,4,5,7,8,9 ° REMARKS: 1. TWO SPEED, CONTINUOUS OPERATION. SET LOW SPEED FOR 30 CFM. ° 2. TWO SPEED, CONTINUOUS OPERATION. SET LOW SPEED FOR 45 CFM. 3. INVERTER DUTY MOTOR project 4. ADJUSTABLE SPEED DRIVE 5. RIZED DAMPER 6. BACKODRAFT DAMPER VINEYARD VIEW 7. PROVIDE WITH FACTORY LED LIGHT KIT 8. PROVIDE WITH FACTORY RADIATION DAMPER ASSEMBLY D 9. PROVIDE WITH FACTORY GFCI PROTECTION FOR WET LOCATION INSTALLATION D County Road 48 Greenport, NY 11944 seal OF NE` ELECTRIC HEATER SCHEDULE - ELECTRIC �� CPN ' 0 N� 0 HEATING ELEMENT UNIT NO. LOCATION TYPE CFM NOTES DESIGN EQUIPMENT f ip KW VOLTS PHASE AMPS EWH-S VARIOUS SURFACE MOUNTED 100 1.8 120 1 15.0 1,2 QMARK AWH3180 �` w EWH-R VARIOUS RECESED 100 1.8 120 1 15 1 QMARK AWH3180 �< c� JFK j 069-7&g <'' NOTES: ��ESSIO\A 1. PROVIDE UNIT WITH FACTORY CONCEALED TAMPER RESISTANT THERMOSTAT. SET AT 50 DEG F. 2. PROVIDE UNIT WITH AWH-SM SURFACE MOUNTING FRAME. E� _+E issued date description 1 03/14/19 Issued for Construction REGISTER AND GRILLE SCHEDULE TYPE APPLICATION MATERIAL FINISH DESIGN EQUIPMENT REMARKS RS SUPPLY STEEL WHITE CONTINENTAL SERIES 32 1,2 RSA SUPPLY ALUMINUM WHITE CONTINENTAL SERIES 32A 1,2 RSF FLOOR SUPPLY STEEL WHITE CONTINENTAL SERIES 28 1,2 RR RETURN STEEL WHITE CONTINENTAL SERIES G35 FRG FILTER RETURN STEEL WHITE CONTINENTAL SERIES FG3 TG TRANSFER STEEL WHITE LIMA MODEL 700 +F NOTES 1• PROVIDE WITH RADIATION DAMPER & BALANCING DAMPER. 2• PROVIDE WITH OPPOSED BLADE DAMPER. title SCHEDULES - HVAC THERMOSTAT SCHEDULE. BUILDING UNIT BUILDING 4 B1, C1 Gl BULDING 5 B2 G drawn by: BNS checked by: CEF scale: AS NOTED project number: 10002 scaled inch sheet number BUILDING A HF + 61 � + 9 H HO . 0 Fg ENGiNEERiNG p`+33 ® l ) Irw✓ ® ® Mechanics(/Electrical Engineering Consultants M/E Project#170412 Rochester 1 Buffalo I Syracuse I Schenectady 150 N.CHESTNUT ST. 585.288.5590 ROCHESTER NY 14604 www,meengineenng.com ® 4 5 4 4 5 DRAWING NOTES. BEATTY HARVEY COCO ARC H I T E C T S , LLP s 4 O1 ELECTRIC METER BY DIV. 260000 SHOWN FOR COORDINATION ONLY. NEW YORK I MARYLAND 1300 Walt Whitman Road, New York, 11747 5 5 1 O2 ELECTRICAL TRANSFORMER BY DIV. 260000 SHOWN FOR COORDINATION ONLY. _�A p:(631)300-1010 BLDG. 1 (TYPE C) 6 ❑3 GAS METER BY DIV. 220000 SHOWN FOR COORDINATION ONLY. owner/developer Conifer Realty FIN. FLR. EL. =23.25' ® CONCRETE PAD BY SITE CIVIL CONTACTOR FOR COORDINATION ONLY. 1000 University Avenue Suite 500 5 HEAT PUMP CONDENSING UNITS SEE UNIT PLANS FOR CONNECTION DETAILS. Rochester, NY 14607 585.324-0500 ° © PROVIDE 5'-0" CLEARANCE BETWEEN GAS PRESSURE RELIEF VALVE FROM ANY INGNITION SOURCE OR OPENING INTO THE BUILING. civil engineer ® b s LKMA 437&405 South Country Road Brookhaven,NY 11719 631.286.8668 m.e.p. &f.p. ❑ 2 M/E Engineering, P.E. ❑ ® ° 150 North Street Ro he ter,N�14604 585.288.5590 T C� structural engineer ® TDM Consulting Ru Saint James, NY 11780 631.686.5234 y • e 5 y ° 4 4 key BLDG. 2(TYPE B) 5 TRUE FIN. FLR. EL. =23.25' NORTH 1 5 5 5 5 6 4" Q° 3 4 4 4 �a R� 3 6 1 4 a OO o 0 0 O 4 2 T O a project 0 0 5 5 0 0 0 O 4 4 4 00o 4 VINEYARD VIEW O 5 ® 5 5 5 3 + County Road 48 4 BLDG. 3(TYPE B) BLDG.4 (TYPE A) 5 Greenport, NY 11944 FIN. FLR. ® FIN. FLR. sealEL.= s BLDG. 6 (TYPE D) EL. = 23.25' 5 23.25' FIN. FLR. OF E 1 EL. o 23.25' CID F� j 4 2 4 SII 0 5O s 4 � ® F� 697 h3 ® 5® 5 ° n`��rrssioNP� O3 6 1 4WPM- ® 4 ❑❑❑❑ Issued date description ❑ ❑ 6 1 03/14/19 Issued for Construction ❑ ❑ 3 4 ❑ ElFIN. FLR. EL. =29.0' 5 s • 5 4 T BLDG. 7(TYPE D) 1 2 FIN. FLR. ® ® EL. 5 5 23.25 4 4 4 ® 5 .y 5 BLDG. 5 (TYPE A) ° FIN. FLR. EL. =25.15' 4 O 4 title 3 55 SITE PLAN - 6 1 ® 4 4 O D HVAC O � ❑ T drawn by: BNS checked by: CEF scale: 1/8"= F-0" project number: 10002 Drawing Name scaled inch SCALE: 1"=30'-0" sheet number BUILDING A 9 HO - 02 F_ �- � ' PELICAN THERMOSTAT SCHEDULE ENGiNEERiNG�� Mechanical/Electrical Engineering Consultants i BUILDING UNIT M/E Project#170412 Rochester I Buffalo I Syracuse I Schenectady 150 N.CHESTNUT ST. 585.288.5590 412 OL,. 'W'1)1 i "460 BUILDING 4 B1, C1 ROCHESTER NY 14604 www.meeMineMring.com BULDING 5 B2 GENERAL NOTES: A. CENTER REGISTERS ON THE WINDOW(S) WHERE BEATTY HARVEY COCO SHOWN AT WINDOWS. ARC H I T E C T S , LLP B. ALL DUCTWORK THAT PENETRATES THE FIRE RATED LID NEW YORK I MARYLAND SHALL AVE A RADIATION DAMPER INSTALLED. 1300 Walt Whitman Road, New York, 11747 q C. SEE SITE PLAN FOR ACTUAL LOCATION OF CONDENSING UNITS. p:(631)300-1010 UNITS SHOWN ON THIS PLAN FOR FOR MULTIPLE BUILDINGS AS owner/developer NOTED BELOW. Conifer Realty 1000 University Avenue Suite 500 Rochester, NY 14607 585.324-0500 DRAWING NOTES: civil engineer LKMA 1 CODE REQUIRED HEAT PUMP CLEARANCE, KEEP AREA FREE FROM 437&405 OBSTRUCTIONS. South Country Road Brookhaven, NY 11719 O PROVIDE A 20x10 RETURN AIR FILTER FOR ALL FILTER RETURN6 4 3 17 17 4 3 26 17 3 26 631.286.8668 GRILLE. FILTERS SHALL MATCH THE RETURN GRILLE SIZE. CU-DSS-2 CU-DSS-3 CU-DSS-2 CU-DSS-2 O TRANSFER GRILLE TO BE MOUNTED CENTERED ABOVE DOOR WHERE 1g 18 19 19 m.e.p. &f.p. B 19 , P.E. 18 AVAILABLE. BLADES OF THE RETURN GRILLE SHALL POINT TOWARD uI THE CEILING. 18 18 CU-DSS-2 17 326 + M/E Engineering, Noah ChestnStreet Rochester, NY 14604 585.288.5590 7 4 6 1 4 FILTER RETURN TO BE MOUNTED 8" AFF. BLADES ON THE GRILLE -{r�(2J 2)�2� SHALL POINT DOWN TOWARDS THE FLOOR. 19 0structural engineer O5 COORDINATE THE HEIGHT OF THE THERMOSTATS WITH THE ADJACENT 0 0 x O TDM Consulting En ineerin LIGHT SWITCHES. THE CENTERLINE OF THE THERMOSTATS AND LIGHT 8 550 North County Rad,Suite? SWITCHES SHALL BE THE SAME. 18 "---_-----"—"---"—"-- R-S" — ----------- Saint James, d, 11780 X ------ ---- x - --- 12x8 - - ----- ----13 631.686.5234 © EXHAUST FANS ARE TO HAVE A FACTORY RADIATION DAMPER. __- 100 �7 PROVIDE 7" DUCT DOWN THROUGH THE FIRE RATED CEILING WITH A ©PELICAN EWH-S X 0 RADIATIDN DAMPER AND FIRE STOP THE PENETRATION. PROVIDE AN WIRELESS _ _ _ _ _ _ ACCESS DOOR IN THE SOFFIT. REFER TO DETAIL #7 ON DRAWING REPEATER ----- RS --- ------- -------- ---------- - H-401 FOR FURTHER INFORMATION. RS - - - 12 _ _ 12x8 _ _ - x8 key® -100 COORDINATE THE EXACT LOCATION OF WALL CAPS WITH 100 � ----- — ------- ----------------------- ---- -- ---"- -"—"— TRUE ARCHITECTURAL ELEVATIONS. THE EXHAUST WALL CAPS MUST HAVE A ___ _____________ ___ NORTH MINIMUN. 3'-0" SEPARATION FROM ANY INTAKE OR OPERABLE WINDOW. _____ _ ___ _______ _________ ____________ COLOR SHALL BE SELECTED BY ARCHITECT. 16 9 RR R 10 CO 22x6 3 00 5 00 O9 DUCTWORK LOCATED ABOVE LOWERED CEILING, NOT IN THE TRUSS —_—_— 20x8 — — — — — — — — - � SPACE. _ ---- --- --- - ------- ------------ 13 22x6 � o T 10 CLOSET TO HAVE A LOWERED CEILING. COORDINATE WITH - - --- -- ---- ----------- —-—- _ _�,G ARCHITECTURAL RCPS 22x6 9 16 o 11 PROVIDE 45 DEG. HEAL TAP AT EACH BRANCH DUCT. - - --- -- — -------------- ---- _—_—_ - _—_—_—_—_ O N O 12 BLADES OF THE RETURN GRILLE SHALL POINT TOWARD THE ADJACENT _ - WALL. ----- --------- ------------ - ------ ---- - � -- - -- --- --- - ------ ---- --- --- --6�� - 13 PROJECTED TRUSS LAYOUT. COORDINATE WITH STRUCTURAL. N ------ -----_ 10 14 PROVIDE EXHAUST FAN WITH WET LOCATION GFCI KIT. LOCATE FAN ( j 8 project _ _ _ _ _ _ RSA _ RR CENTERED ON LONG DIMENSION OF THE TUB, CENTER FAN ON SHORT _ VINEYARD VIEW DIMENSION OF TUB AS TRUSS LAYOUT ALLOWS. 10x6 11 — 1 - 22x 11 RSA EF-A 18 o - -- - ---- - - 30 O - ----- 10x6 6 1 17 426 15 EXHAUST DUCT UP TO GOOSENECK ON ROOF. SEAL PENETRATION _—_—_—_—_— —_— 24- — — WEATHER TIGHT. SEE DRAWINGS HA-104 FOR FINAL LOCATION AND - -- -- - - p p ROUTING. 1 L_ �J II 4x10 } O - -- --- ---RR - - - --EF=A1 _ --- SD-HP ------ --------- --- -- -- ----- 0-- County Road 48 16 INSIDE OF DUCT WORK TO BE PAINTED FLAT BLACK. ______ 2ox8 6 14 00 CU-DSS-2 Greenport, NY 11944 17 CONDENSING UNITS To BE MOUNTED ON QUICK SLING 18" MINI SPLIT -- -- - - o ----- --- ----------- - ------ - -- -- - seal STAND ( E PAD P STAND SHALL BE PERMANENTLY FIXED TO THE — — — — — — — — — 8 — CONCRETE PAD PER HCR REQUIREMENTS. 0 C) — ------ •8x8 18 PROVIDE TITAN GS30 (OR EQUIVALENT) EXTERIOR WALL PENETRATION. ao - OF N Y 20x102 N�. DA 19 CONCRETE PAD BY SITE CIVIL CONTRACTOR. SHOWN FOR U - - - - ----- -- - - -- -- - - ----- ----- 3Z4-4---- --- 0 - CU-DSS-2 COORDINATION ONLY. �0 CONTRACTORS SHALL ROUTE THE RL/RS PIPING TO INTERIOR UNITS RS 15 7 PER MANUFACTURES RECOMMENDATIONS. 12x8 100 - -E i - ------ Q - ----- ------------- ------ — --- - 1� 18 17 4 6 21 PROVIDE MINIMUM 16" CLEARANCE BETWEEN CONDENSING UNITS. x - n��F_ 10NP X r_Ss © PROVIDE MINIMUM 10" BETWEEN CONDENSING UNITS AND EXTERIOR -- - - --------- - --------- -- - 19 WALL -- -------------------- -- - © CONDENSING UNIT FOR BUILDING 4. - - --- --------- - _-_-_-_-_-_ _- EF E issued date description T 1 03/14/19 Issued for Construction ® CONDENSING UNIT FOR BUILDING 5 _ REPLACE THERMOSTAT WITH PELICAN WIRELESS ON UNITS SPECIFIED THIS UNIT DOES NOT RELIEVE A ON THERMOSTAT SCHEDULE. PELICAN WIRELESS THERMOSTAT ------------------------------------ ______________________________________ 26 CONTRACTOR SHALL COORDINATE WITH SITE CIVIL TO ENSURE T CONDENSERS ARE ON THE CONCRETE PAD. © PELICAN WIRELESS REPEATER TO BE PLUGGED INTO THE 5 5 DSS-HP-1 CONVINCE OUTLET IN WATER/ELEC ROOM. __—_—_T_—_—_—_—___—_—_—_—_—_—_—_—_—_ ----------- ----- --------- ------ ------------------------------------- DSS-HP-2 -------------------------- -- - ---- EWH-R ----- ------------------------------- EWH-R ---- ------ ----- ------------------- title ----- ------ ----- ------ BUILDING A - FIRST FLOOR ® ® PLAN - HVAC drawn by: BNS checked by: CEF scale: AS NOTED project number: 10002 BUILDING "A" FIRST FLOOR PLAN -HVAC scaled inch SCALE: 1/4"=1'-0" sheet number BUILDING A PELICAN THERMOSTAT SCHEDULE1[7.�J,' ENGiNEERiNG Lo Mechanical/Electrical Engineering Consultants BUILDING UNIT M/E Project#170412 ivi Rochester I Buffalo I Syracuse I Schenectady 150 N.CHESTNUT ST. 585.288.5590 , BUILDING 4 B1, C1 ROCHESTER NY 14604 www,meengineenng.com BULDING 5 B2 BEATTY HARVEY COCO A R C H I T E C T S , L L P NEW YORK I MARYLAND 1300 Walt Whitman Road, New York, 11747 p:(631)300-1010 owner/developer Conifer Realty 1000 University Avenue Suite 500 Rochester, NY 14607 585.324-0500 civil engineer LKMA 437&405 South Country Road Brookhaven,NY 11719 631.286.8668 m.e.p.&f.p. WE Engineering, P.E. Ia E N E RAL NOTES: + 150 North Chestnut Street A. CENTER REGISTERS ON THE WINDOW(S) WHERE Rochester, NY 14604 SHOWN AT WINDOWS. --------- _—_—_—_ 585.288.5590 B. ALL DUCTWORK THAT PENETRATES THE FIRE RATED LID _ structural engineer SHALL HAVE A RADIATION DAMPER INSTALLED. -—-—- —-—-—-—- - -—-— RS TDM Consulting Engineering 550 North County Road,Suite —_—_—_—_—_—_—_—_—_—_ _—_—_—_-- _— —_— 12x8 Saint James, NY 11780 DRAWING NOTES: ----------- _ __________ 100 631.686.5234 - -- ----- - --12-- ----------- - (D CODE REQUIRED HEAT PUMP CLEARANCE, KEEP AREA FREE FROM - ----------------- - ------------ OBSTRUCTIONS. RS 12 ---- ---------------- -------- ------------ key _ __________ 12x8 _____ ____-�_- RR (D PROVIDE A 20x10 RETURN AIR FILTER FOR ALL FILTER RETURN GRILLE. 100 22x6 FILTERS SHALL MATCH THE RETURN GRILLE SIZE. -—-— --- -—-—-—- ----- -- ------------ TRUE ( D TRANSFER GRILLE TO BE MOUNTED CENTERED ABOVE DOOR WHERE _ ___________ ____ __ _____________ NORTH 15 8 9 - AVAJLABLE. BLADES OF THE RETURN GRILLE SHALL POINT TOWARD THE RR ---_ -- --------- - - - ----------------------- -- CEILING. 2Ox8 3 ---- ------------ RR 5 - __ __ 22x6 (D FILTER RETURN TO BE MOUNTED 8" AFF. BLADES ON THE GRILLE SHALL - 14 8 - POINT DOWN TOWARDS THE FLOOR. _ _ _ __ __ -------- ____-_______- 00- ao 10 -- - - -- T----15 -- ---------- (D COORDINATE THE HEIGHT OF THE THERMOSTATS WITH THE ADJACENT O LIGHT SWITCHES. THE CENTERLINE OF THE THERMOSTATS AND LIGHT - - - --- ----- --_- - -----_-_--- 8 15 SWITCHES SHALL BE THE SAME. T - N - — ---- -- — — a (D EXHAUST FANS ARE TO HAVE A FACTORY RADIATION DAMPER. - - ------------ - -- - - - TG RR 6�� _ _ _ _ _ _ _ _ x6 _ EF-_A_2__ PROVIDE 7" DUCT DOWN THROUGH THE FIRE RATED CEILING WITH A RADIATION DAMPER AND FIRE STOP THE PENETRATION. PROVIDE AN O9 22x6 1 6 13 ACCESS DCOR IN THE SOFFIT. REFER TO DETAIL *7 ON DRAWING H-401 RSA - -- --I -- -�- - ----- - project FOR FURTHER INFORMATION. - -------------- - - 103 ------- 1 0 10 14 0x6 VINEYARD VIEW (8� DUCTWORK LOCATED ABOVE LOWERED CEILING, NOT IN THE TRUSS 14 - -- -- - ------ - ------ - - --------- 24 SPACE. 0 ------------- --- ----- L 0 10x1 D (D CLOSET TC HAVE A LOWERED CEILING. COORDINATE WITH -Sl)--HP= - - ----- --- - --- -- ------ ----- d -f- ARCHITECTURAL RCPS _ _ 10 PROVIDE 45 DEG. HEAL TAP AT EACH BRANCH DUCT. -FRG ----------- - ------ - L -- --- -- County Road 48 > Greenport, NY 11944 (11 BLADES OF THE RETURN GRILLE SHALL POINT TOWARD THE ADJACENT 353 seal WALL. - ------- -2 ------ =1-� x8 1> ------------ ------ FRG -- @2 PROJECTED TRUSS LAYOUT. COORDINATE WITH STRUCTURAL. SD-HP-3 _-_-_-_-_- 20x10 - - - - �F N-F_W 00 324 -- o--- ---- - �. AN @ PROVIDE EXHAUST FAN WITH WET LOCATION GFCI KIT. LOCATE FAN -- ------- ------ -- --------------- 2 3 00 CENTERED ON LONG DIMENSION OF THE TUB, CENTER FAN ON SHORT _ _-_ _ -_-_-_-_-_-_ _-_-_-_-_------------ _ C/) DIMENSION OF TUB AS TRUSS LAYOUT ALLOWS. (1� EXHAUST DUCT UP TO GOOSENECK ON ROOF. SEAL PENETRATION ---------- ---------- ------------------ WEATHER -------- --------- -------WEATHER TIGHT. SEE DRAWINGS HA-104 FOR FINAL LOCATION AND ROUTING. - ------- ------- --------------- ----------- -------- ----- — LsF��OFES�069`7 15 INSIDE OF DUCT WORK TO BE PAINTED FLAT BLACK. _ _-_-_-_ _-____ _ ______-_-___-_- RS X ___________ 16 REPLACE THERMOSTAT WITH PELICAN WIRELESS ON UNITS SPECIFIED ON 100 12x8 ------- ---- issued date description THERMOSTAT SCHEDULE. - ------- --------- --------------- E E - ------------------------------------- 1 03/14/19 Issued for Construction ------ -------- -- T ----------------------------------------- THIS UNIT DOES NOT RECIEVE A DSS-HP-2 --------------------------------------- PELICAN WIRELESS THERMOSTAT - --------- --- ---- --------------- 5 DSS----- ---H --P-1 ------------------------------- - ------------------------------------ - --------------------------------------- - ------------------------------------ ----------------------------------------- ------------------------------------ --------------------------------------- title BUILDING---------------------------- A - SECOND FLOOR PLAN - HVAC drawn by: BNS checked by: CEF scale: AS NOTED project number: 10002 � BUILDING "A" SECOND FLOOR PLAN -HVAC scaled inch SCALE: 1/4"=V-0" sheet number BUILDING A ENGNEERiNG Mechanics!/Electrical Engineering Consultants M/E Project#170412 Rochester Buffalo I Syracuse I Schenectady 150 N.CHESTNUT ST. 585.288.5590 :ar "h. ►y ROCHESTER NY 14604 www.meengineering.com GENERAL NOTES: A. DUCTWORK SHOWN DASHED SHALL BE BEATTY HARVEY COCOARCHITECTS , L L P ROUTED IN ROOF TRUSSES. NEW YORK I MARYLAND AAII B. ROOF JACKS SHALL BE INSTALLED WITH A CENTER INES ALIGNED AS SHOWN IN THE 1 Wait Whitman Road, New York, 11747 DRAW p:(631)300-1010 owner/developer Conifer Realty 1000 University Avenue Suite 500 er, NY 14607 DRAWING NOTES: Roches 585324-0500 Cl) PROVIDE RODF JACK EXHAUST OUTLET FOR BATHROOM EXHAUST. SEAL PENETRATION WEATHER civil engineer TIGHT. REFER TO DETAIL 5, DRAWING H5.01 LKMA C2) 437 8.405� PROVIDE ROOF JACK EXHAUST OUTLET FOR RANGE HOOD EXHAUST. SEAL PENETRATION WEATHER South Country Road ER TO DETAIL 6, DRAWING H5.01. Brookhaven, NY 11719 631.286.8668 C) DUCT DOWN TO TYPICAL UNITS. SEE PLANS FOR ROUTING. m.e.p. &f.p. WE Engineering, P.E R 150 No h Chestnu Street �= Rochester, NY 14604 585.288.5590 structural engineer TDM Consulting Engineering 550 North County Road,Suite Saint James, NY 11780 631.686.5234 key TRUE NORTH 4C 1 ■ R7■ 0 0 1 17771 1 0 �A project I 3 VINEYARD VIEW D1 2 3 I D County Road 48 3 Greenport, NY 11944 seal pF NE 2 3 `P F 3 711 r�0 06974'' 4�1 f��CS S l ONP issued date description 1 03/14/19 Issued for Construction _fF title BUILDING A - ROOF PLAN - HVAC G + drawn by: BNS checked by: CEF scale: AS NOTED project number: 10002 BUILDING "A" ROOF PLAN -HVAC scaled inch SCALE: 114"=V-0 sheet number - - BUILDING A F EXTERIOR WALL OR PARAPET WALL SEAL ENGNEERNGG PENETRATION TRATION OUTLET WITHELASTOMERIC Mechanical/Electrical Engineering Consultants LINE-SET COMPRESSION SLEEVE TYPE M/E Project#170412 TITAN GS30 (OR EQUIVALENT) Rochester I Buffalo I Syracuse I Schenectady FILTER DRIER— 150 N.CHESTNUT ST. 585.288.5590 4 ROCHESTER,NY 14604 www.meengineeing.com 1 ktl 14 REFRIGERATION INSULATION ACCESS VALVE PROTECTIVE PVC DECK TYPICAL COVER BEATTY HARVEY COCO T S , L L P ELASTOMERIC LINE-SET ANCHOR TO DECK TYPICAL LIQUID LINE NEW YORK I MARYLAND COMPRESSION & ANTI- HEATPUMP A VIBRATION SLEEVE L4 CONDENSING RL 1300 Wait Whitman Road, New York, 11747 UNISTRUTCHANNEL--'�� TOTAL DIMENSION VARIES UNIT IRS A p:(631)300-1010 REFRIGERATION PIPING WITH QUANTITY OF PIPES owner/developer ANCHOR OVER INSULATION SUPPORTED INSULATION FOR HANGER RODS Conifer Realty REFRIGERANT REFRIGERATION /SEE ROOFTOP 1000 University Avenue Suite 500 SUCTION LINE PIPING INSULATED INSULATION CONDENSING UNIT Rochester, NY 14607 MOUNTING DETAIL 585.324-0500 UNISTRUT LABEL PIPING TO-----... IDENTIFY AS HOT f 1 civil engineer REFRIGERANT GAS, LIWUIL OR REMOTE SENSING LKMA SUCTION. SECURE REFRIGERANT BULB ON IRS PIPING SUCTION LINE 437&405 PIPING TO SUPPORTS WITH 0 STRUT MOUNTED CLAMP South Country Road UNISTRUT CHANNEL Brookhaven, NY 11719 0 631.286.8668 REFRIGERANT o INSULATION RS m.e.p. &f.p. LIQUID LINE 0 (TYP.) INDOOR L-1 DSS UNIT M/E Engineering, P.E. B LLkC5:) I B 150 North Chestnut Street RL -4 Rochester, NY 14604 UNISTRUT CHANNEL structural engineer 585.288.5590 INSULATION SHALL BE J BETWEEN CLAMP AND THERMAL SUCTION TRAP EXPANSION (VERIFY WITH TDM Consulting Engineenn PIPING ? . VALVE (TXV) UNIT MANUFACTURER) 550 North County Road,Suite MECHANICAL CONNECTION Saint James, NY I'l 780 631.686.5234 SECURED WITH FOAM PIPE SECURE REFRIGERANT STAINLESS STEEL CLAMP DETAIL NOTES: CADDY PIPING TO SUPPORTS WITH "COSH-A-CLIP" BY A. CONFIRM REFRIGERANT LINE LENGTHS WITH "HYDRO-ZORB" OR EQUAL WALL FASTENERS (TYP.) MANUFACTURER FOR EACH SYSTEM. key SELF-TAPPING 3/8" FEX pp HEAD. 1/4" DIAMERTER ALL i B. VERIFY THE REQUIREMENT FOR A SUCTION LINE TRUE MATERIAL ANCHOR SCREWS TRAP AT THE BASE OF THE REFRIGERANT NORTH 4— WITH ELASTOMERIC WASHERS. L11 LIQUID LINE SUCTION (IRS) LINE WITH THE MANUFACTURER. . THIS IS SHOW THE 4 SUCTION LINE CSYSTEMDETAIL COMPONENTSINTENDED. THETO SYSTEM SHALL BEGENERAL WALL SURFACE SEAL I PIPED IN ACCORDANCE WITH THE MANUFACTURERS ELASTOMERIC GASKET I RECOMMENDATIONS. EN OO N 0 project DX PIPING CONNECTIONS DETAIL VINEYARD VIEW REFRIGERANT PIPE PENETRATION DETAIL r2-'\ PIPE SUPPORT CADDY AT GRADE 3 REFRIGERANT PIPE SUPPORT DETAIL 4 CONDENSING UNIT ABOVE EVAPORATOR COIL H5.01H5.01 D N.T.S. '\H!Voi SCALE: NONE H5.01SCALE NDNE ISCALE NONE D County Road 48 Greenport, NY 11944 seal of y UP TO GOOSENECK TERMINATION ON co OPEN WEB ROOF. SEE ROOF PLAN ROOF JACK (BROAN MODEL TRUSS (TYP)—\ FOR LOCATIONS 634 OR EQUAL). ALIGNCl- ROOF MULTIPLE ROOF JACKS PER ROOF PLAN. 06 -7 ALL DUCTWORK IN COLD ATTIC TRUSS SPACE TO BE EXHAUST FAN INSULATED AS PER THE SPECIFICATIONS. RADIATION EF FACTORY SHOULD NOT CAULK issued date description DAMPER EXTEND BEYOND 3RD GRILLE FACE 1 03/14/19 Issued for Construction ATED GYPSUM BOARD FRLOOR/CEILING FLOOR CAULK ENTIRE CEILING ASSEMBLY PERIMETER OF SLEEVE OPERATE FAN/LIGHT TL I BOTH SIDES. FACTORY ❑ I GRILLE SIMULTANEOUSLY SEAL PER SEAL TO WALL. ARCHITECTURAL PLANS RATED 1 7" EXHAUST FLOOR/CEILING NOTE: PROVIDE SHEETMETAL DUCTWORK. WALL CAP L,,.] OUT TO WALL ASSEMBLY NO FLEXIBLE DUCTWORK PERMITTED. (BROAN 2ND C AP AT EXTERIOR WALL N�OPEN WEB MODEL 647 FLOOR TRUSS (TYP) OR EQUAL) METAL DUCTWORK SLEEVE. INTERIOR EXHAUST FAN MOUNTED IN RATED ASSEMBLY - THIRD FLOOR 7 7 PAINTED BLACK, SIGHT PROOF j (2) COATS. Fk 6" EXHAUST OUT TRANSFER OPEN WEB GRILLE +F TO WALL CAP AT 7110 GYPSUM BOARD EXTERIOR WALL TRUSS (TYP)Z WALL CAP CEILING SOFFIT RETURN GRILLE V V (BROAN MODEL 647 RADIATION W/ BLADES FACING UP EXHAUST FAN OR EQUAL) DAMPER AT ------ --- T—1 1, CEILING PLANE title FACTORY 6110 1 RADIATION ------- i- 8"x8" ACCESS DAMPER DOOR WITH 10"x1O" DETAILS HVAC SHEETMETAL PLENUM. GYPSUM BOARD RATED PLENUM LENGTH To KITCHEN FLOOR/CEILING BE AS REQUIRED CEILING ASSEMBLY TO ALLOW FOR 7" RANGE HOOD EXHAUST DUCT TO BY G.C. FACTORY OPERATE FAN/LIGHT SIMULTANEOUSLY SEAL PER PENETRATE CEILING GRILLE BETWEEN TRUSSES ARCHITECTURAL PLANS ACCESS DOOR IN SOFFIT NOTE: PROVIDE SHEETMETAL DUCTWORK. BY G.C. drawn by: BNS NO FLEXIBLE DUCTWORK PERMITTED. 1ST FLOOR checked by: CEF EXHAUST FAN MOUNTED IN RATED ASSEMBLY - LOWER FLOORS scale: AS NOTED FINISHED BOX-OUT AROUND PERIMETER OF EXHAUST DUCT IN CABINET. SEE ARCHITECTURAL project number: 10002 PLANS. (HCR REQUIREMENT ONLY.) scaled inch sheet number BUILDING A TYPICAL EXHAUST FAN MOUNTING DETAIL TYPICAL KITCHEN RANGE HOOD EXHAUST DETAIL BEDROOM TRANSFER DUCTWORK DETAIL 5.0 E: NONE SCALE: NONE I N.T.S. 1 1 1 5 . 01 21 31 41 _ Y ENGiNEERiNG Mechanical/Electrical Engineering Consultants M/E Project#170412 Rochester I Buffalo I Syracuse I Schenectady 150 N. 8.5590 REFRIGERATION REFRIGERATION ROCHESTES NYA&NUT . ineen g.com # I!� 4 i rn 4 ROCHESTER•NY 14604 www.meengineering.com � , � "" � "�` �"', � ! PIPING RS/RL PIPING RS/RL BEATTY HARVEY COCO PROVIDE A PVC SLEEVE EXTERIOR WALL ARC H I T E C T S , LLP WHERE THE REFRIGERANT OF BUILDING NEW YORK I MARYLAND PIPING PENETRATES THE A BUILDING WALL. 1300 Wait Whitman Road, New York, 11747 —I— I q p:(631)300-1010 -� owner/developer EQUIPMENT BASE Conifer Realty 1000 University Avenue Suite 500 6 Rochester, NY 14607 1 , 1 585.324-0500 QUICK SLING 18" MINI SPLIT STAND 1" 2 5 STAND TO BE PERMANENTLY :;. _':e. °. • °. °, • e. e• e civil engineer FIXED TO THE CONCRETE PAD PER HCR REQUIREMENTS 3" ABOVE o °. o ; : - ;'• LKMA 1'-6" MIN PROVIDE A PVC SLEEVE GRADE GRADE 437&405 WHERE THE REFRIGERANT =° =' �- —=`� = _�r=' MIN. South Country Road PIPING PENETRATES THE T — BUILDING WALL. 3 4 " MIN. Brookhaven,NY 11719 O O O O 631.286.866 m.e.p. &f.p. M/E Engineering, P.E. B 150 North Chestnut Street DETAIL NOTES Rochester, NY 14604 ( ANCHOR BOLT, SIZE & LOCATION AS REQUIRED TO MATCH EQUIPMENT BASE. 585.288.5590 TYPICAL PLASTIC SLEEVE & ANCHOR. structural engineer 6.1 HEAT PUMP MIN 3 REINFORCING BARS, 12" O.C. EACH WAY. TDM Consulting Engineering 1 -6 OUTDOOR UNIT + _ MIN (2-4 CONNECTIONS) 550 North County Road,Suite ® *4 DOWEL, 12" O.C. Saint James, NY11780 631.686.5234 �5 CHAMFER. 1'-611 CONCRETE PAD PER MIN © CONCRETE PAD 4,000 PSI CONCRETE, LENGTH & WIDTH, 6" GREATER THAN THE HCR REQUIRMENTS. EQUIPMENT BASE PLATE. SEE CONCRETE PAD DETAIL FOR MORE key GENERAL NOTES INFORMATION (9TRUE A REFER TO SITE PLAN FOR DETAILS ON CONCRETE SLAB. NORTH B SITE CIVIL CONTRACTORS TO SUPPLY CONCRETE PAD, MECHANICAL CONTRACTORS TO SUPPLY ANCHOR BOLTS. EN 0 OO a project TYPICAL CONDENSING UNIT LAYOUT - AT GRADE INSTALLATION 2 CONCRETE EQUIPMENT BASE DETAIL - FOR CONDENSING UNITS VINEYARD VIEW H5.02 SCALE NONE H5.02 D SCALE NONE County Road 48 Greenport, NY 11944 seal OF N W �D NV O A�or-r_ss�oNP Eissued date description 1 03/14/19 Issued for Construction FF title DETAILS - HVAC -I drawn by: BNS checked by: CEF scale: AS NOTED project number: 10002 scaled inch sheet number BUILDING A F THE DASHED LINE REPRESENTS THE ?ELICAN EQUIPMENT QUANTITYar ' ENGiNEERiNG WIRELESS MESH NETWORK BETWEEN THERMOSTAT (TS200H) 4 THE GATEWAY AND REPEATERS. Mechanical/Electrical Engineering Consultantsr1i ��10) 120 V — (TYPICAL) TEMP AND ALARM SENSOR (TA1) 2 M/E Project#170412 L 4AJNTENANCE LICAN WIRELESS WIRELESS 10K T---MP PROBES (PROBE T-3) 2 Rochester I Buffalo I Syracuse I Schenectady 150 N.CHESTNUT 5T. 585.288 5590 _�., ,1�j j�g .�'•¢, GATEWAY REPEATER ROCHESTER NY 14604 www.meengineering.com r•• 4�'MiA +A MUNITY BUILDING i IN WATER ROO �� ROOMS - INTERNET CONNECTION ,� �� , SPARE PARTS TO BE TURNED OVER TO OWNER BEATTY HARVEY Coco SCALE NONE NEW YORK I MARYLAND ARC H I T E C T S , LLP lJ ' \ UNITS WITH PELICAN MONITORING 1300 Walt Whitman Road, New York, 11747 P• 300-1010 TO INDOOR UNIT � owner/developer Conifer Realty WIRELESS �i T H �1 SLIMDUCT I REMOTE 1000 University Avenue Suite 500� REPEATER CONTROLLER Rochester, NY 14607 IN WATER I UNITS WITH PELICAN CABLE 585.324-0500 ROOMS ; MONITORING HEATING G G yylG WHITE RED W2 civil engineer T H COOLING Y1 G BLACK 437&0405 TRUSS SPACE IN ALL UNITS WHERE South Country Road MONITOR PELICAN TSTATS ARE Y2 Brookhaven,NY 11719 SPECIFIED. FAN - LOW SPEED �\ 1 631.286.8668 H1 p• p• WIRELESS FAN - HIGH SPEED H2 FUJITSU THERMOSTAT CONVERTER m.e. &f. M/E Engineering,WIRELESS MESH NETWORK P.E. 150 North Chestnut Street g `�_, REPEATER TO OTHER THERMOSTATS G3 (UTY-TTRX) Rochester, NY14604IN WATER IN APARTMENTS 24 VAC POWER R ROOMS 24 VAC POWER TO TRANSFORMER TR 585.288.5590 COMMON C COMMON TO TRANSFOMER structural engineer TC TDM Consulting ortEngineerinq� 550 North County Road,Suite l THERMOSTAT SYSTEM NETWORK DIAGRAM Saint James,NY 11780 H5.03 SCALE NONE 631.686.5234 ETRANSFORMER (NOT PROVIDED) key THERMOSTAT (TEMPERATURE/HUMIDITY) NORTH PELICAN WIRELESS MODEL TS200H D 106 10 O D C R Rc Y W C W2Y2 p PELICAN THERMOSTAT SCHEDULE ■w� II O BUILDING UNIT FFr 0 BUILDING 1 A3, C2 BUILDING 2 Al B4 + - SEE TYPICAL APARTMENT BUILDING 3 A2 63 UNIT PLANS FOR LOCATION BUILDING 4 B1, C1 1177 7 BUILDING 5 B2 project BUILDING 6 B7 C3 BUILDING 7 B8, C4 VINEYARD VIEW INTERSTICIAL SPACE D MONITORING PROBE INSULATION PELICAN WIRELESS MODEL T3 (TYPICAL) 4 County Road 48 _ __ Greenport, NY 11944 �«L��ZZ�� seal I I 3 TYPICALSLIM DUCT THERMOSTAT WIRING DIAGRAM N\PD,1 CO J ,� F �I TRUSS SPACE �.\ H5.03 SCALE: NONE f ,� I ' ' X597�3 4✓c DRAWING NOTES. CS�� O1 INSTALL THE INTERSTICAL SPACE MONITORING PROBE DIRECTLY . 2 TO THE WOOD TRUSSES. PROBE SHAL BE IN THE FREE AIR, NOTE issued date description UNDER INSULATION. PROBE SHALL BE MOUNTED NEAR THE SUPPLY - E DUCTWORK. 1 03/14/19 Issued for Construction TEMPERATURE AND O2 SEAL THE INSULATION AROUND THE CONTROL WIRES SERVING ALARM SENSOR THE DUCT TEMPERATURE SENSOR TO MAINTAIN THE VAPOR PELICAN WIRELESS BARRIER. + LOCATED IN O3 THERMOSTAT TO BE LOCATED IN THE TRUSS SPACE DIRECTLY T TRUSS SPACE ABOVE THE MECHANICAL CLOSET. ® DUCT SURFACE + D PROVIDE A 24VAC TRANSFORMER FED FROM A 120 V TEMPERATURE PROBE O + c MODEL UNSWITCHED SOURCE TO PROVIDE POWER TO THE PELICAN PELICAN WIRELESS 0J R TA- 1 4 SYSTEM COMPONENTS. MODEL T3. PROVIDE A 12x12 FIRE RATED ACCESS DOOR IN THE CEILING BELOW THE THERMOSTAT. COORDINATE THE EXACT LOCATION WITH THE TRUSS LAYOUT. F NEUTRAL 24 VAC _IF LOCATION FOR PELICAN WIRELESS THERMOSTAT 3 MODEL TS200H IN TRUSS SPACE FOR ADDITIONAL title TEMPERATURE AND HUMIDITY MONITORING (ACCESSIBLE BUILDING A THERMOSTAT THRU FIRE RATED CEILING (TEMPERATURE/HUMIDITY) ACCESS DOOR). PELICAN WIRELESS PELICAN MODEL TS200H 3 - �{5� TEMPERATURE AND ALARM SENSOR �`" PELICAN WIRELESS MODEL TA1 (ACCESSIBLE THRU FIRE RATED CEILING THERMOSTAT ACCESS DOOR). DETAILS D C R LOCATED IN TRUSS SPACE �----� >/� + drawn by: XXX i 1 checked by: XXX scale: AS NOTED project number: 10002 scaled inch sheet number BUILDING A 3 TYPICAL TRUSS SPACE THERMOSTAT WIRING DIAGRAM - ABOVE CEILING TRUSS SPACE MONITORING EQUIPMENT H5.03 SCALE NONE H 21 3i 7 H 4 8 91 H5 ,eO3 2-I ELECTRICAL SYMBOLS LIST ENGiNEERiNG BASIC MATERIALS AND METHODS COMMUNICATIONS SYMBOLS ONE LINE DIAGRAM SYMBOLS CLOSED CIRCUIT TELEVISION ® J Mechanical/Electrical Engineering Consultants 0 SYMBOL DESCRIPTIONWE Project#170412 "WcC, SYMBOL DESCRIPTION SYMBOL DESCRIPTION SYMBOL DESCRIPTION Rochester I Buffalo I Syracuse I Schenectady 150 N.CHESTNUT ST. SSSA8.5590 �. .� {1; ■•�r,� d g HOME RUN TO PANELBOARD. LETTERS/ ONE (1) TELEPHONE OUTLET AND CABLE. ROCHESTER NY 14604 www.meengineedng.com """"" "'*' "0' y NUMBERS INDICATE PANEL. NUMBERS ® "W" INDICATES MOUNTED AT 46" A.F.F. �— FUSED DISCONNECT SWITCH � CAMERA (NO.1) INDICATE CIRCUITS. NUMBER OF ARROWS EQUALS NUMBER OF CIRCUITS. CIRCUIT 180 - 180' CAMERA SHALL BE 20 AMP, 120 VOLT, 2-+12, 1- 12 TMDF TELEPHONE MAIN DISTRIBUTION FRAME �_ 360 - 360° CAMERA GENERAL DESIGN CRITERIA: BEATTY HARVEY COCO LP-404 EG., IN 1/2 " C, UNLESS NOTED OTHERWISE. NON-FUSED DISCONNECT SWITCH BRANCH CIRCUIT WIRING SIZE AND NUMBER PTz CAMERA WITH PAN/TILT/ZOOM A. THIS PROJECT SHALL BE DESIGNED AND CONSTRUCTED IN ACCORDANCE WITH ARCHITECTS , LLPNEW YORK I MARYLAND TO MATCH HOMERUN. REFER TO SPEC'S TIDF TELEPHONE INTERMEDIATE DISTRIBUTION FRAME �_ THERMAL MAGNETIC MOLDED CASE THE FOLLOWING ENERGY CONSERVATION AND FUNDING PROGRAMS A FOR RACEWAY TYPE. CIRCUIT BREAKER THE MOST STRINGENT CRITERIA SHALL APPLY. 1300 Walt Whitman Road, New York, 11747 COMPUTER WORK STATION - A p:(631)300-1010 TWO <2> COMPUTER DATA OUTLETS AND DVM DIGITAL VIDEO MANAGEMENT - ENERGY STAR V3.1 (REV 9), WITH CHECKLISTS. + owner/developer GANGED DEVICES - HCR HANDBOOK (VERSION: 2018) per CABLES. ONE (2) DUPLEX RECEPTACLES � CURRENT TRANSFORMER - LEED V4 CIRCUITED AS SHOWN ON DRAWINGS. Conifer Realty t�ON MONITOR (N0.1) SPECIAL PURPOSE RECEPTACLE. PROVIDE DATA DROP WITH POWER - 1000 University Avenue Suite 500 PROPER VOLTAGE, CLASS, CURRENT RATINGONE (1) COMPUTER DATA OUTLETS AND Rochester, NY 14607 AND NEMA CONFIGURATION AS REQUIRED BY 9D CABLES. ONE (1) DUPLEX RECEPTACLE A METER/INSTRUMENT LETTER INDICATES 585.324-0500 BRANCH CIRCUIT AND/OR MATCH CAP ON CIRCUITED AS SHOWN ON DRAWINGS. FUNCTION LUMINAIRES GENERAL NOTES (APPLY TO ALL DRAWINGS): EQUIPMENT BEING FURNISHED BY OTHERS. PROVIDE CORD AND CAP. WH - WATTHOUR METER civil engineerSYMBOL DESCRIPTION A. ALL CONDUITS/CABLES SHALL BE INSTALLED AS HIGH AS POSSIBLE ABOVE FINISHED CEILINGS SUBSCRIPT INDICATES TYPE VIDEOPHONE STATION - AND CONCEALED IN WALLS UNLESS OTHERWISE INDICATED. ALL CONDUITS/CABLES SHALL RUN LKMA ONE (1) COMPUTER DATA OUTLETS AND PARALLEL AND PERPENDICULAR WITH BUILDING WALLS AND STRUCTURE. 437&405 D - DRYER RECEPTACLE, 30A, 125/250V V CABLES. ONE (1) DUPLEX RECEPTACLE CEILING MOUNTED LUMINAIRE. UPPER CASE South Country Road CIRCUITED AS SHOWN ON DRAWINGS. G GENERATOR SET LETTERS INDICATE FIXTURE TYPE ON B. CONTRACTOR IS HEREBY CAUTIONED THAT ELECTRIC POWER CHARACTERISTICS (VOLTAGE, Brookhaven,NY 11719 R - RANGE RECEPTACLE, 50A, 125/250V SCHEDULE, LOWER CASE LETTER INDICATES FA d O SWITCHING DESIGNATION. PHASE, HORSEPOWER, AMPERAGE, ETC.) OF EQUIPMENT IS BASED ON AVAILABLE 631.286.8668 INFORMATION AT THE TIME OF PROJECT DESIGN. CONTRACTOR MUST VERIFY CUSTOM DESIGNED TENANT CHARACTERISTICS FOR EACH PIECE OF NEW EQUIPMENT PRIOR TO ORDERING ELECTRICAL m.e.p. &f.p. -T SOLID HALF ARROW(S) INDICATES 120 VOLT CIRCUIT TO SINGLE POLE CIRCUIT BREAKER(S), VISUAL SIGNALER PANEL TRANSFER SWITCH, RATING AS INDICATED. WALL MOUNTED LUMINAIRE. UPPER CASE EQUIPMENT. INDICATE VERIFICATION ON SUBMITTALS. LETTERS INDICATE FIXTURE TYPE ON M/E Engineering, P.E. UNLESS NOTED OTHERWISE. g PROJECTION VIDEO UNIT - ONE (1) COMPUTER ATS = AUTOMATIC FA 4 Q SCHEDULE, LOWER CASE LETTER INDICATES C. LOCATIONS INDICATED FOR LIGHTING FIXTURES ARE APPROXIMATE. LOCATE FIXTURES g 150 North Chestnut Street ---►- SOLID FULL ARROW INDICATES 208 VOLT DATA OUTLET AND CABLE, AUDIO/VIDEO MTS = MANUAL SWITCHING DESIGNATION. AS REQUIRED TO AVOID INTERFERENCE WITH BUILDING STEEL, PIPING, DUCTWORK, CONDUIT, Rochester, NY 14604 DISTRIBUTION CONTROL OUTLET WITH SVGA DIFFUSERS, GRILLES, SPEAKERS, SMOKE DETECTORS, ETC. FIELD COORDINATE EXACT 585NY 14590 CIRCUIT TO MULTI-POLE CIRCUIT BREAKER, PV CONNECTOR, PROJECTOR BRACKET, LOCATIONS AS NEAR AS POSSIBLE TO THE LOCATION INDICATED. VERIFY COMPLIANCE UNLESS NOTED OTHERWISE. PROJECTOR UNIT AND ONE (1) 20 AMPERE WITH NEC ARTICLE 410.16 FOR INSTALLATION OF LIGHT FIXTURES IN CLOTHES CLOSETS, SPECIFICATION GRADE DUPLEX RECEPTACLE. �NL LUMINAIRE CONNECTED TO NIGHT LIGHT PRIOR TO ROUGH-IN. REFER TO ARCHITECTURAL REFLECTED CEILING PLANS. structural engineer O JUNCTION BOX 0PANELBOARD CIRCUIT WIRELESS ACCESS POINT - D. EXACT LOCATIONS OF CEILING MOUNTED SMOKE DETECTORS, EXIT SIGNS, ETC. TDM Consulting Engineering WAP UTLET AND CABLE ONE (1) COMPUTER DATA O �--� FLOURESCENT STRIP SHALL BE COORDINATED WITH OTHER CEILING MOUNTED EQUIPMENT TO AVOID CONFLICT. 550 North County Road,Suite LOCATED ABOVE ACCESSIBLE CEILING. PROVIDE LOCATE DEVICES AS NEAR AS POSSIBLE TO THE LOCATION INDICATED. FIRE ALARM SMOKE Saint James, NY 11780 EQUIPMENT OR TERMINAL CABINET AND HEAT DETECTORS SHALL BE LOCATED 3'-0" MINIMUM FROM HVAC DIFFUSERS, 631.686.5234 AN ADDITIONAL 20' LO EXTRA CABLE TO -L GROUND CONNECTION REGISTERS, GRILLES, ETC. SMOKE DETECTORS AT SMOKE DOORS MUST BE INSTALLED FACILITATE THE RELOCATION OF THE WAP IN - POLE MOUNTED SITE LUMINAIRE WITHIN 5'-0" OF THE DOORS (REFER TO NFPA 72). SaTOGGLE SWITCH, VOLTAGE AS INDICATED THE FUTURE IF NECESSARY.,b,c ON FIXTURE SCHEDULE, SUBSCRIPTS E. ALL NEW CIRCUITING SHALL BE CONCEALED (EXCEPT IN BOILER ROOM, ELECTRICAL AND POWER DISTRIBUTION W WITH BATTERY PACK EMERGENCY LUMINAIRE MECHANICAL ROOMS). PROVIDE ALL CUTTING AND PATCHING AS REQUIRED. INDICATE TYPE: AND CONTROL key 2 - TWO POLE SWITCH FIRE ALARM _ F. CONTRACTOR SHALL REVIEW ALL TRADES' CONTRACT DOCUMENTS TO DETERMINE SPECIFIC ® ® CEILING MOUNTED EXIT LUMINAIRE MOUNTING LOCATIONS FOR ELECTRICAL EQUIPMENT. COORDINATE EXACT MOUNTING LOCATIONS TRUE - THREE WAY SWITCH SYMBOL DESCRIPTION WITH THE ARCHITECT AND OTHER CONTRACTORS. REFER TO ARCHITECTURAL PLANS FOR NORTH 4 - FOUR WAY SWITCH SYMBOL DESCRIPTION LV - LOW VOLTAGE, MOMENTARY CONTACT G. CASEWORK LAYOUT, ELEVATIONS, ETC. COORDINATE WITH LOCATIONS OF ELECTRICAL DEVICES �. 208/120 VOLT PANELBOARD — AND OUTLETS G K - KEY OPERATED og ,o' W F WALL MOUNTED EXIT LUMINAIRE - PILOT LIGHT MANUAL PULL STATION H. EXACT LOCATION OF MECHANICAL AND PLUMBING EQUIPMENT THAT REQUIRE ELECTRICAL WP - WEATHERPROOF MOTOR STARTER. REFER TO ELECTRIC CONNECTIONS ARE SHOWN ON THE MECHANICAL AND PLUMBING DRAWINGS. M EXPLOSION PROOF MOMENTARY CONTACT SWITCH- ® EQUIPMENT AND CONTROL SCHEDULE M - T THERMAL MAGNETIC SWITCH FOR SIZE AND TYPE. NUMBER INDICATES BRANCH CIRCUITING IDENTIFICATION 1. PROVIDE CONDUIT/WIRING (CIRCUITING) AND REQUIRED CONNECTIONS TO ALL DEVICES/ SMOKE 01' OCCUPANCY SENSOR, PIR ■�■ - ❑S DETECTOR ITEM ON SCHEDULE. EQUIPMENT. CONNECT TO CIRCUIT(S) AS INDICATED. O - J. DS - OCCUPANCY SENSOR, DUAL TECHNOLOGY CIRCUITING TO DEVICES/EQUIPMENT SHALL BE 2 +12 WITH 1 *12 GROUND (MULTIPLE HOMERUNS DISCONNECT SWITCH AMP RATING AS NUMBER INDICATES CIRCUIT JIN SAME CONDUIT MAY SHARE SAME EQUIPMENT GROUND) FOR EACH 20 AMPERE CIRCUIT UNLESS - OCCUPANCY SENSOR, DUAL TECHNOLOGY, INDICATED ON ELECTRIC EQUIPMENT OTHERWISE NOTED. DUAL SWITCH �H 130 DEGREES F RATE OF RISE HEAT DETECTOR 0" AND CONTROL SCHEDULE. NUMBER 2 ET - ELAPSED TIMER a,b,c - SWITCHING DESIGNATIONS NUMBER OF INDICATES ITEM ON SCHEDULE. K. COORDINATE ALL WORK WITH OTHER TRADES; REFER TO ARCHITECTURAL DRAWINGS AND OTHER o LETTERS EQUALS N0. OF GANGED a SWITCH LEG TRADE DRAWINGS FOR COORDINATING LOCATIONS. SWITCHES DSD DUCT SMOKE DETECTOR FUSED DISCONNECT SWITCH AMP RATING AS INDICATED ON ELECTRIC EQUIPMENT AND CONTROL SCHEDULE. NUMBER INDICATES MOUNTED SUBSCRIPTS INDICATE TYPE B L PROVIDE ALL WORK IN ACCORDANCE WITH UTILITY REQUIREMENTS. project OD DAMMER (INCANDESCENT), 120 VOLT, FLUSH S SMOKE DETECTOR, BEAM TYPE TRANSMITTER ITEM ON SCHEDULE. FIXTURE TYPE M. PROVIDE OCCUPANCY SENSOR TYPES WITH COVERAGES THAT MATCH SPECIFIC ROOM VINEYARD VIEWOF INSTALLATION. A - 600 WATT COMBINATION FUSED DISCONNECT SWITCH AND --NUMBER INDICATES CIRCUIT D MAGNETIC STARTER AMP RATING AS INDICATED AC�1 N. PROVIDE INDIVIDUAL CATV BRANCH CIRCUITING FROM EACH CATV OUTLET TO CATV -� B - 1000 WATT ON ELECTRIC EQUIPMENT AND CONTROL MAIN DISTRIBUTION FRAME. C - 1000 WATT 3-WAY SRX SMOKE DETECTOR, BEAM TYPE RECEIVER D SCHEDULE. NUMBER INDICATES ITEM ON D D - 1500 WATT SCHEDULE. 0. TELEPHONE SYSTEMS: PROVIDE CABLING CALLED FOR FROM TMDF TO EACH TELEPHONE E - 800 WATT - MAGNETIC LOW VOLTAGE County Road 48 MOUNTING HEIGHT & MISC. INFO. OUTLET AND TERMINATE WITH PROPER CONNECTORS. Greenport, NY 11944 RTS REMOTE DUCT SMOKE DETECTOR TEST STATION EQUIPMENT CONNECTION. REFER TO ELECTRIC P. DATA SYSTEMS: PROVIDE CABLING CALLED FOR FROM TMDF TO EACH DATA OUTLET FLUORESCENT DIMMER SWITCH, 120 VOLT, EQUIPMENT AND CONTROL SCHEDULE FOR NUMBER INDICATES CIRCUIT�_ AND TERMINATE WITH PROPER CONNECTORS. seal D a,b,c FLUSH MOUNTED SUBSCRIPTS INDICATE TYPE: SIZE. NUMBER INDICATES ITEM ON SCHEDULE. 3 Q. RISER DIAGRAMS ARE DIAGRAMMATIC ONLY; WIRE AND DEVICE QUANTITIES, SIZES, TYPES OF 3 - THREE WAY D MMER SWITCH Q® ALARM SIGNAL, AUDIBLE AND VISUAL ® P1 SHALL BE AS CALLED FOR IN CONTRACT DOCUMENTS. �� N fi p� a,ID,c - SWITCHING DESIGNATIONS NUMBER OF CONTACTOR �\ \P LETTERS EQUALS NO. OF GANGED PANEL R. SLEEVE AND SEAL ALL WALL AND FLOOR PENETRATIONS. PROVIDE APPROPRIATE FIRE STOPPING n, ,, A,c SWITCHES VISUAL SIGNAL DEVICE NOTE: DESIGNATION FOR ALL FIRE RATED PENETRATIONS. , 4- . , 41 COMPLETE ELECTRICAL CONNECTION TO AND HOMERUNS S. COORDINATE EXACT LOCATION OF ALL WIRING ROUTES, EQUIPMENT AND DEVICES WITH DUPLEX RECEPTACLE, 20 AMP, 125 VOLT EQUIPMENT TYPICAL FOR ALL DEVICES SUBSCRIPTS INDICATE TYPE: OTHER TRADES. DH MAGNETIC DOOR HOLDER AC - ABOVE COUNTER T. MAINTAIN SERVICE CLEARANCES OF ALL EQUIPMENT. ADVISE OTHER TRADES OF SERVICE r� A ��'9 IG - ISOLATED GROUND 7�� ✓ ACCESS CONTROL CLEARANCES AND ENSURE NO SERVICES OR TRADES RUN THROUGH SERVICE AREA. ��1_Ec,,z3\OV\P�UC: - UNDER THE COUNTER SRESCUE ASSISTANCE H SMOKE HATCH U. BATHROOM EXHAUST FANS SHALL BE ENERGY STAR LABELED. WF' - WEATHER PROOF E- SYMBOL DESCRIPTION issued date description SYMBOL DESCRIPTION V. ALL LUMINAIRES WITHIN DWELLING UNITS SHALL BE ENERGY STAR LABELED. SINGLE RECEPTACLE 20 AMP, 125 VOLT EC ELEVATOR CAPTURE W. ALL EXTERIOR LIGHTING SHALL BE CONTROLLED VIA PHOTOCELL. PHOTOCELL CAN BE INTEGRAL TO 1 03/14/19 Issued for Construction RAM RESCUE ASSISTANCE MASTER STATION THE FIXTURE OR A CENTRAL BUILDING PHOTOCELL, REFER TO SCHEDULES AND PLANS. n DUPLEX RECEPTACLE, GROUND FAULT CIRCUIT FRCP FIRE ALARM CONTROL PANEL X. ALL OCCUPANCY SENSORS SHALL BE PROVIDED WITH AUXILLARY CONTACT FOR USE BY x INTERRUPTING TYPE MECHANICAL CONTRACTOR. SCP ACCESS SYSTEM CONTROL PANEL RAS RESCUE ASSISTANCE REMOTE STATION Y. REFER TO STRUCTURAL DRAWINGS FOR LOCATIONS OF ALL BRACED WALL PANELS (SHEAR WALLS). F FAAP FIRE ALARM ANNUNCIATION PANEL COORDINATE WITH STRUCTURAL ENGINEER FOR PENETRATION REQUIREMENTS IN THE QUAD RECEPTACLE 20 AMP, 125 VOLT DRPS DOOR RELEASE, POWER SUPPLY -- II RESCUE ASSISTANCE ILLUMINATED SIGN PANELS. FSD DUPLEX RECEPTACLE, 20 AMP, 125 VOLT FAN SHUT DOWN F ® (CEILING OR WALL MOUNTED) SPILT WIRED. DS ELECTRIC DOOR STRIKE AMM ADDRESSABLE MONITOR MODULE 0 . FLOOR BOX, FLUSH MOUNTED. PROVIDE WITH MIN 80" AFF TO BOTTOM OFDEVICES, AS INDICA-ED. DEVICE LENS AND MAXIMUM OF DC DOOR CONTACT 96" AFF TO TOP WARNING & SIGNAL OF DEVICE LENS + ACM ADDRESSABLE CONTROL MODULE FIXTURE/SIGNS CENTERED 0 PUSH BUTTON SMOKE DAMPER K KEYPAD FINISHED CEILING ABOVE DOOR -f F SD Q TELEVISION OUTLET RE REQUEST TO EXIT SENSOR HORN/LIGHT—►B ® EXIT TS TAMPER SWITCH � - title PC PHOTOELECTRIC CONTROL PR PROXIMITY READER AND BACKBOX PULL 3' FROM EDGE LL STATION GENERAL NOTES SPRINKLER WATERFLOW SWITCH TC WITHIN 5' OF OF BASE MAX.DIGITAL TIME CLOCK WF (PADDLE OR PRESSURE SWITCH TYPE) LIGHT DOOR LATCH AND SYMBOLS - SELECTIVE ENTRY (INTERCOM) SYSTEM /� SWITCH o SINGLE STATION SMOKE DETECTOR - ELECTRICAL V s SUBSCRIPT 'V' INDICATES VISUAL ALARM � OPERABLE 1'-6" ABOVE Os CEILING MOUNTED OCCUPANCY SENSOR ❑SS STROBE WALL PHONES /_:Q PART OF SYMBOL DESCRIPTION COUNTER MAX. SINGLE STATION CARBON MONOXIDE DETECTOR 46" RECEPTACLE DEVICE G �E EMI7-RGENCY SHUTDOWN PUSH BUTTON V®SS SUBSCRIPT 'V' INDICATES AMBER VISUAL ALARM S CEILING MOUNTED SPEAKER -� STROBE � TEL/COMM 4 -0 4 -0 G drawn by: DPK 3 REFERENCE TO DRAWING NOTE ® CARBON MONOXIDE DETECTOR 1-0 WALL MOUNTED SPEAKER 1'-6" checked by: ERB 3 REFERENCE TO DEMOLITION NOTE TC M-11 INTERCOM (DOOR ENTRY) MASTER STATION FINISHED FLOOR scale: 1/g,_ 1 B CARBON DIOXIDE VISUAL ALARM SIGNALVISUAL. (NO.1) lil PROVIDE PLAIN WHITE DEVICE WITH SIGN DETAIL NOTES: project number: 10002 HH HAND HOLE U� STATING "CO ALARM" MOUNTED ON WALL BELOW THE DEVICE. DOORBELL 1. MOUNTING HEIGHTS TO CENTER OF OUTLETS UNLESS OTHERWISE NOTED. IN MASONRY CONSTRUCTION scaled inch THE ABOVE MOUNTING HEIGHTS SHALL BE USED FOR REFERENCE TO NEAREST BLOCK OR BRICK sheet number IC INTERCOM SUBSTATION COURSING 2. THE ABOVE MOUNTING HEIGHTS SHALL BE ADHERED TO UNLESS SPECIFICALLY NOTED OR DETAILED OTHERWISE ON THE DRAWINGS OR SPECIFICATIONS BUILDING A H ENGiNEERiNG Mechanical/Electrical Engineering Consultants WE Project#170412 Rochester I Buffalo I Syracuse I Schenectady 150 N.CHESTNUT ST. 585.288.5590 ; ; ±4' Y iF A 0 ROCHESTER e;NY 14604 www.meengineenng.com v +nw* n a�aT 4 HH GENERAL NOTES: DRAWING NOTES: AEATTY R C H I T ERVEY C T S COiO A. COORDINATE ALL UTILITY WORK WITH LOCAL UTILITIES. O1 PROVIDE SECONDARY SERVICE FROM UTILITY TRANSFORMER TO NEW YORK I MARYLAND CIDBUILDING. COORDINATE WITH UTILITY. REFER TO ONE LINE 1300 Walt Whitman Road, New York, 11747 5 B. ALL CONDUITS INSTALLED UNDER ROADS OR PARKING AREAS SHALL DIAGRAMS FOR FEEDER SIZES. �A p:(631)300-1010 Q BE CONCRETE ENCASED (DUCTBANK). owner/developer O PROVIDE ELECTRIC METERS AT THIS LOCATION. COORDINATE EXACT C. PROVIDE CONNNECTION OF ALL SITE LIGHTING. SITE LIGHTING LOCATIONS WITH ALL OTHER TRADES AND G.C. Conifer Realty BLDG. 1 PROVIDED BY OTHERS AND CONNECTED BY E.C. PROVIDE 1000 University Avenue Suite 500 (TYPE C) OHP 2 CONTROL OF SITE LIGHTING THROUGH CONTACTOR AND �3 PROVIDE CIRCUIT AND CONNECTION OF SITE LIGHTING PROVIDED BY Rochester, NY 14607 20A-2P PHOTOCELL AT BUILDING. PROVIDE 2-*8, 1-*10EG IN 1-1/2"C FOR OTHERS. 585.324-0500 ALL SITE LIGHTING, UNLESS NOTED OTHERWISE. ® PROVIDE CONDUIT FOR UTILITY PRIMARY SERVICE. COORDINATE ° . H D. REFER TO CIVIL DRAWINGS FOR COORDINATING ALL ROUTING WITH UTILITY PRIOR TO CONSTRUCTION. ROUTE CONDUITS TO civil engineer s • AND LOCATIONS. UTILITY POLE AND PROVIDE RISER AT POLE. LKMA E. PROVIDE PRIMARY AND SECONDARY ELECTRICAL SERVICE 05 EXTEND CONDUITS INTO BUILDING ELECTRIC/MECHANICAL ROOM. 437&405 1 AS REQUIRED BY THE UTILITY. COORDINATE ALL REQUIREMENTS REFER TO BUILDING FLOOR PLANS. South Country Road WITH UTILITY PRIOR TO CONSTRUCTION. COORDINATE WITH Brookhaven,NY 11719 UTILITY FOR TRANSFORMER LOCATIONS. © TRANSFORMER PROVIDED BY UTILITY. PROVIDE PAD/VAULT AND 631.286.8668 �. F. PROVIDE TWO (2) 2" SCHEDULE 40 PVC DIRECT BURIED CONDUITS PROTECTIVE BOLLARDS PER UTILITY REQUIREMENTS. m.e.p. &f.p. FOR EACH BUILDING FROM UTILITY PEDESTAL TO INSIDE BUILDING O PROVIDE TWO (2) 2" SCHEDULE 40 PVC DIRECT BURIED CONDUIT B� LANDBANKED ELECTRIC ROOM. COORDINATE LOCATION OF PEDESTALS WITH UTILITY FOR FIRE ALARM SYSTEM AND INTERCOMMUNICATING WIRING. M/E Engineering, P.E. PARKING PRIOR TO BID. COORDINATE STUB UP LOCATIONS IN ELECTRIC ROOMS CONDUIT TO STUB INTO BUILDING ELECTRICAL ROOM. B 150 North Chestnut Street WITH ALL OTHER TRADES. Rochester, NY 14604 O PROVIDE ELECTRIC FEEDER AND CONNECTION TO PUMP HOUSE. 585.288.5590 G. PROVIDE TWO (2) 2"C FOR FIRE ALARM NETWORK WIRING AND REFER TO ONE LINE DIAGRAM FOR MORE INFORMATION. COORDINATE 4 6 INTERCOMMUNICATIONS BETWEEN THE BUILDINGS. COORDINATE WITH REQUIREMENTS WITH FIRE PUMP HOUSE SUPPLIER structural engineer OWNER AND UTILITIES FOR EXACT REQUIREMENTS. PRIOR TO ROUGH-IN. g Og PROVIDE TWO (2) 2"C TO FIRE PUMP HOUSE FOR FIRE ALARM TDM 5Consulting NorthiCouunty�Rgoad Suite e E CIRCUITS AND COMMUNICATION. PROVIDE FIRE ALARM CONNECTIONS Saint lames, NY 11780 TO COMMUNITY BUILDING FIRE ALARM PANEL AS CALLED FOR BY 631.686.5234 THE FIRE PUMP SUPPLIER. PROVIDE MINIMUM OF (1) CAT 6 5 COMMUNICATION CABLE FROM PUMP HOUSE TO COMMUNITY 1 y y BUILDING TEL/DATA BOARD. 10 PROVIDE POWER FOR PUMP STATION. PROVIDE WEATHERPROOF PANEL 'PST AS SCHEDULED AND CALLED FOR ON THE ONE LINE key DIAGRAM. PROVIDE MOUNTING AT LOCATION AS DETERMINED IN BLDG. 2 n FIELD WITH PUMP STATION SUPPLIER UTILIZING STAINLESS STEEL TRUE (TYPE B) OHP CHANNEL AND FASTENERS. PROVIDE CIRCUITING AND CONNECTION NORTH 20A-2P OF SEVEN (7) LIGHT FIXTURES PROVIDED WITH PUMP STATION. ° 5 PROVIDE (2) WEATHERPROOF 'GFI' RECEPTACLES AND LOCATE AS 2 DIRECTED BY PUMP STATION SUPPLIER AND CIRCUITING. PROVIDE ALL INTERCONNECTING WIRING FOR GENERATOR, TRANSFER SWITCH . AND CONTROLS AS CALLED FOR BY THE PUMP STATION SUPPLIER. COORDINATE REQUIREMENTS PRIOR TO BID. HH �t�■ - a O 8a x , 4 6 0 p.6 20A P Ib O O project 00 o`a 2 O 0 VINEYARD VIEW r>a �O O\ H °� BLDG. 33 Road 48 • (TYPE B) 3 HP 5 y 3 HID 20A-2P Greenport, NY 11944 20A-2PBLDG.4 seal VILLAGE 5 (TYPE A) s SQUARE H 7 5 �� OFA UHP BLDG. 6 20A-2Paur (TYPE D) (�3 HP •• x, :`,:fit, 20A-2P .ti P—Z 1 rtl O HP 2 ° 20A-2P s 5`� � ESS�nNP� 7 ° I FIRE PUMP HOUSE 1 1 4E issued date description 8 20A-2P 1 03/14/19 Issued for Construction PC2- DBA 33 HP 7 g A-2P N P I 20A-2P HH 5 C2-36,38 A-2P COMMUNITY 2 3 7 CENTER& 2 LEASING 5 I OFFICE 7 7 HH HH H ® 5 i 7 20A-2P BLDG. 7 PC2-32,34 (TYPE D) F y F �— O dU .1 n BLDG. 5 HP a n n 7 (TYPE A) J. 2OA- title - - 2 5 L ._� MSP_, SITE PLAN - ®� 3 HP ELECTRICAL 1 20A-2P (RPZ)GWp FI � 10 P S 1 MP STATION drawn by: DPK checked by: ERB scale: 1/8"= 1'-0" project number: 10002 scaled inch Drawing Name sheet number SCALE: 1"=30%0" BUILDING A +2 + 9 I ENGiNEERiNG i5D TMI,Mechanical/Electrical Engineering Consultants WE Project#170412 Rochester I Buffalo I Syracuse I Schenectady 150 N.CHESTNUT ST. 585.288.5590 a lh. 1t ROCHESTER NY 14604 www.meenAte'gineenng.com �i+i +d GENERAL NOTES: BEATTY HARVEY COCO ARCHITECTS , LLP A. UNLESS OTHERWISE NOTED, PROVIDED 2-12,1412G, NM CABLE AND NEW YORK I MARYLAND CONNECT ALL ELECTRICAL EQUIPMENT IN APARTMENTS (EXCEPT 1300 Walt Whitman Road, New York, 11747 RANGE AND EXTERIOR HEAT PUMP CONDENSER) TO 20A-1P CIRCUIT p:(631)300-1010 BREAKER IN THE ELECTRICAL PANEL LC LOCATED IN THAT -j APARTMENT, CIRCUIT NUMBER AS INDICATED. PROVIDE ALL WIRING AS owner/developer REQUIRED SO THAT LIGHT FIXTURES ARE CONTROLLED BY Conifer Real SWITCHES AS INDICATED. 1000 University Avenue Suite 500 B. PROVIDE 2*8, 1#10G, NM CABLE AND CONNECT RANGE RECEPTACLES Rochester, NY 14607 IN APARTMENTS TO 40A-2P CIRCUIT BREAKER, CIRCUIT LC-4,6. 585.324-0500 C. CONNECT EXTERIOR CONDENSING UNIT FOR EACH APARTMENT TO THE ASSOCIATED APARTMENT'S LOAD CENTER 'LC', CIRCUITS 13,15 civil engineer AS INDICATED. REFER TO EQUIPMENT SCHEDULE FOR CIRCUIT LKMA BREAKER AND WIRING SIZES. 437&405 D. ALL RECEPTACLES SHALL BE LISTED AS TAMPER RESISTANT South Country Road RECEPTACLES, INCLUDING EXTERIOR RECEPTACLES THAT ARE Brookhaven,NY 11719 ELECTRODE CIRCUITED TO RESIDENT LOAD CENTERS. 631.286.8668 GROUND E. SMOKE DETECTORS SHALL BE INTERCONNECTED SUCH THAT WHEN m.e.p. &f.p. GRID ONE DETECTOR GOES INTO ALARM IT ACTIVATES ALL DETECTORS M/E Engineering, P.E. B M © M © M WITHIN THE DWELLING UNIT. B 150 North Chestnut Street CU-DSS-2 WP CU-DSS-3 7 CU-DSS-20 WP CU-DSS-2� 1 QGFI 1 QGFI F. PROVIDE INSTALLATION OF LOAD CENTERS 'LC' SO THAT ALL Rochester, NY 14604 COMPONENTS ARE AT 48" AFF MAX. 585.288.5590 HP-A-1 HP-A-3 8 "l 6 3 48" V G. ALL LIGHTING AND RECEPTACLES CONNECTED TO APARTMENT LOAD structural engineer 6 GFI �ACU_ DSS-2 CENTERS SHALL BE CONNECTED TO COMBINATION TYPE ARC FAULT 8 7 BREAKERS, EXCEPT FOR RECEPTACLES LOCATED IN BATHROOMS. TDM Consulting Engineering FI 4r ® � 550 North County Road,Suite E ETV: 166 3® P PC M WH-S ® H. ALL RECEPTACLES MARKED "WP" SHALL BE LISTED WEATHER Saint James, NY 11780 --I RESISTANT TYPE RECEPTACLES IN A WEATHERPROOF ENCLOSURE. 631.686.5234 8 I I. UNDER SLAB RADON MITIGATION SYSTEMS ARE BEING INSTALLED IN B/a BOA E s HP-A) HP-A-4 ( I i MC-A I THESE BUILDINGS. ALL ELECTRICAL RELATED PENETRATIONS OF THE 0 _ METER i SLAB ON GRADE MUST BE SEALED TO THE SLAB USING .0 J 0 HP- I i7CENTER POLYURETHANE CAULK, VULKEM 116 OR SIMILAR, TO COMPLY WITH ke N 010 10 3 2 � ( I -----_ i THE REQUIREMENTS OF THIS INSTALLATION. y N I 16 5 I I J. MOUNT ALL RECEPTACLES IN BATHROOMS 44" AFF. NORTH 8 B/ 1 CCII ® 1 J 010K. MOUNT ALL REFRIGERATOR OUTLETS IN KITCHENS 4' AFF. 8 Co s SS _ LC3 ® L. ONE RECEPTACLE IN LIVING ROOM AREA SHALL BE A DUPLEX HP-A-5 I RECEPTACLE WITH INTEGRAL USB OUTLETS. COORDINATE 16 CO FS SS a J 1 RECEPTACLE LOCATION WITH OWNER. EDENS SS M. SINGLE STATION SMOKE DETECTORS IN RESIDENT UNITS SHALL BE mom 8 Ca o INSTALLED TO MEET THE FOLLOWING REQUIREMENTS; O LJ8 8 A. INSTALL A MINIMUM OF 36" FROM A BATHROOM C/e a J CONTAINING A SHOWER OR TUB. ° C B. INSTALL A MINIMUM OF 36" FROM HVAC SUPPLY REGISTERS. LC2 010 11 9 O j C. INSTALL A MINIMUM OF 36" FROM THE TIP OF A CEILING --� CO 2 F1 b C ® SUSPENDED PADDLE FAN. ° 3 EF-A1 B FI D. REFER TO NFPA FOR ALL INSTALLATION REQUIREMENTS, NOT ALL REQUIREMENTS ARE LISTED HERE. project 9 c J 0 11 010 E 0C 6 6 00 O N. PROVIDE THE FOLLOWING IN ALL HVI UNITS= VINEYARD VIEW B/ 48 B A. IN HVI UNITS PROVIDE A HARC SA-101 SONIC RECEIVER 9 11 GFI O -AlEF C O IN THE MASTER BEDROOM. THE RECEIVER SHALL PLUG INTO A 120V RECEPTACLE AND ACCEPT THE PLUG D M FROM A SC-VIB-PJ BED SHAKER. 1p AC � �/e SD-HP-2 � � � GFI 1 9 c 010 E E E B. IN HVI UNITS PROVIDE GENTEX 7109CS SMOKE DETECTORS County Road 48 CU-DSS-2 9 O DWH-1 WITH VISUAL SIGNAL. SMOKE DETECTORS SHALL BE Greenport, NY 11944 co 2 O C M HARDWIRED AND INTERCONNECTED. WITH ALL OTHER `' o O WP© 1 2 1 3 s 10 M 7 ❑s SS 3 1 AC AC 2 NOTIFICATION DEVICES IN THE UNIT. ADJACENT TO THE seal GFI Co 11 14 �� WP HALLWAY SMOKE DETECTOR INSTALL A HARC SC-0O2 CO © CARBON MONOXIDE DETECTOR WITH TRANSMITTER. THE 0 F ' AC GFI M GFI 2GFI DETECTOR SHALL BE HARDWIRED. �Q�� N L q 7 48 A CU-DSS-2 `/ �� tik, - GF C GFI GFI 1 C. PROVIDE AND INSTALL BUILDING FIRE ALARM SYSTEM FI VISUAL SIGNALING DEVICES IN ALL HVI UNIT LIVING ROOM, r:l 2 ° 0C/e A/c is E ®�® BATHROOMS AND BEDROOMS. ``**�y11 " f d A/c C/e 10 �{ A D. ALL HVI PLUG IN ITEMS SHALL BE TURNED OVER TO THE c°�,,w=� s 1 �0 010 OWNER AT FTHE OR END UNITS. OFS THE PROJECT. SEE ARCHITECTURAL f� C�97�43 4✓,c A L °F�ssioNP` 1 W -DW GFI 2 E. PROVIDE HARDWIRED DOOR SIGNALER WITH STROBE FOR M 34 HVI UNITS IN LIVING ROOM AND BEDROOMS. PROVIDE I -- --- ,-- E _ 2 7 12 HARDWIRED PUSH-BUTTON. PROVIDE TRANSFORMER AT issued date description E 10 C 7'-0" A.F.F. FOR CHIME/STROBE AND INSTALL AT 7'-0" A.F.F., -� GFI 2 C C GFI CONNECT TRANSFORMER TO LOCAL RECEPTACLE CIRCUIT. 1 03/14/19 Issued for Construction F 0. REFER TO ARCHITECTURAL DRAWINGS FOR LIGHTING FIXTURE ® B 7 LOCATIONS. MU 5 ( P. COORDINATE EXTERIOR CONDENSING UNIT LOCATIONS WITH �ro MECHANICAL CONTRACTOR PRIOR TO ROUGH-IN. F ® � O / B/b C ° s50 co 10 DRAWING NOTES: M DSS-HP-1 DSS-HP 2 01 PROVIDE PREWIRING FOR FIRE ALARM VISUAL DEVICE AT 80" AFF WITH WIRING FROM FACP. PROVIDE FIRE ALARM VISUAL DEVICES IN F N ca B/a N ALL HVI UNITS. L 10 O2 PROVIDE WALL SWITCHES FOR RANGE HOOD LIGHT AND FAN CONTROL 5 5 O IN ADA AND ADA ADAPTABLE UNITS. FAN SPEED SHALL BE SELECTED 100 5 EWH-R AT THE HOOD MOUNTED CONTROL. WIRE SWITCHES IN SERIES WITH 7 11 s h HOOD MOUNTED CONTROLS. OC C/a 10 O O PROVIDE ONE (1) SWITCH FOR EXHAUST FAN. THE SWITCH SHALL 55 F O WP CONTROL THE "ON/OFF" OPERATION OF THE INTEGRAL LED LIGHT. title s WI 10 M 17 WP 11 D/h 5 GFI D EXHAUST FAN SHALL HAVE CONSTANT POWER AND BE CONTROLLED WP GFID/h EWH-R 10 BY INTEGRAL OCCUPANCY SENSOR. BUILDING A - GFID/h D O PROVIDE DOORBELL, 16VAC, FLUSH MOUNTED 7-AFF, NUTONE LA14WH FIRST FLOOR 10 O5 PROVIDE LIGHTED DOORBELL PUSHBUTTON WITH SILVER FINISH, PLAN - ELECTRICAL ® NUTONE PB19L OR EQUAL. MOUNT 46" AFF. © PROVIDE CONNECTION OF EXTERIOR RECEPTACLES NOT LOCATED n ® ® ® AT UNIT ENTRACNES TO PANEL HP. 07 PROVIDE RECEPTACLE FOR WATER HEATER. MOUNT RECEPTACLE AT 44" A.F.F. ADJACENT TO THE WATER HEATER, COORDINATE EXACT -� drawn by: XXX LOCATION IN FIELD. ® NOT USED. checked by: XXX O9 NOT USED. scale: 1/4"= 1'-0" 10 PROVIDE SITE LIGHTING CONTROL CONTACTOR AND PHOTOCELL. REFER project number: 10002 TO DETAIL. COORDINATE WITH SITE CONTRACTOR. REFER TO SITE BUILDING "A" FIRST FLOOR PLAN -ELECTRICAL PLAN. scaled inch EA1.0 SCALE: 114"=1'-0" 11 LOCATE EXTERIOR WEATHERPROOF FIRE ALARM HORN/STROBE sheet number AT FIRE DEPARTMENT CONNECTION (FDC) LOCATION. COORDINATE WITH FIRE PROTECTION CONTRACTOR. BUILDING A Hk 2 + 4+ 5+ + + + • ENGiNEERiNGF y Mechanical/Electrical Engineering Consultants M/E Project#170412 OD Rochester 1 Buffalo I Syracuse I Schenectady 150 N.CHESTNUT ST. 585.288.5590 g;� 9 i. ►4' 1`4 ROCHESTER NY 14604 www.meengineedng.com a .idr ! yY ai 0 BEATTY HARVEY COCO GARCHITECTS , LLP GENERAL NOTES: NEW YORK � MARYLAND AI A. UNLESS OTHERWISE NOTED, PROVIDED 2-12,1-12G, NM CABLE AND 1300 Wait Whitman Road, New York, 11747 T CONNECT ALL ELECTRICAL EQUIPMENT IN APARTMENTS (EXCEPT 1A p:(631)300-1010 RANGE AND EXTERIOR HEAT PUMP CONDENSER) TO 20A-1P CIRCUIT owner/developer BREAKER IN THE ELECTRICAL PANEL LC LOCATED IN THAT APARTMENT, CIRCUIT NUMBER AS INDICATED. PROVIDE ALL WIRING AS Conifer Realty REQUIRED SO THAT LIGHT FIXTURES ARE CONTROLLED BY 1000 University Avenue Suite 500 SWITCHES AS INDICATED. Rochester, NY 14607 585.324-0500 B. PROVIDE 2*8, 1*10G, NM CABLE AND CONNECT RANGE RECEPTACLES IN APARTMENTS TO 40A-2P CIRCUIT BREAKER, CIRCUIT LC-4,6. C. CONNECT EXTERIOR CONDENSING UNIT FOR EACH APARTMENT TO civil engineer THE ASSOCIATED APARTMENT'S LOAD CENTER 'LC', CIRCUITS 13,15 LKMA AS INDICATED. REFER TO EQUIPMENT SCHEDULE FOR CIRCUIT 437&405 BREAKER AND WIRING SIZES. South Country Road Brookhaven,NY 11719 D. ALL RECEPTACLES SHALL BE LISTED AS TAMPER RESISTANT 631.286.8668 RECEPTACLES, INCLUDING EXTERIOR RECEPTACLES THAT ARE CIRCUITED TO RESIDENT LOAD CENTERS. m.e.p. &f.p. E. SMOKE DETECTORS SHALL BE INTERCONNECTED SUCH THAT WHEN WE Engineering, P.E. B ONE DETECTOR GOES INTO ALARM IT ACTIVATES ALL DETECTORS B 150 North Chestnut Street WITHIN THE DWELLING UNIT. Rochester, NY 14604 585.288.5590 F. PROVIDE INSTALLATION OF LOAD CENTERS 'LC' SO THAT ALL COMPONENTS ARE AT 48" AFF MAX. 8 16 P P structural engineer 8 ® G. ALL LIGHTING AND RECEPTACLES CONNECTED TO APARTMENT LOAD TDM Consulting Engineering CENTERS SHALL BE CONNECTED TO COMBINATION TYPE ARC FAULT 550 North County Road,Suite I IV 16 ® ® BREAKERS, EXCEPT FOR RECEPTACLES LOCATED IN BATHROOMS. Saint.lames, NY 11780 H. ALL RECEPTACLES MARKED "WP" SHALL BE LISTED WEATHER 631.686.5234 ( I 16 - I RESISTANT TYPE RECEPTACLES IN A WEATHERPROOF ENCLOSURE. 0B/ ® I. UNDER SLAB RADON MITIGATION SYSTEMS ARE BEING INSTALLED IN 10 ( I N I 1 THESE BUILDINGS. ALL ELECTRICAL RELATED PENETRATIONS OF THE TV I , SLAB ON GRADE MUST BE SEALED TO THE SLAB USING key 010 POLYURETHANE CAULK, VULKEM 116 OR SIMILAR, TO COMPLY WITH 16 I ( I I THE REQUIREMENTS OF THIS INSTALLATION. TRUE NORTH B J. MOUNT ALL RECEPTACLES IN BATHROOMS 44" AFF. � 6 P S S CO 019 ® � � 0 8 8 1 1 P© K. MOUNT ALL REFRIGERATOR OUTLETS IN KITCHENS 4 AFF. /Y\\ ` ® L. ONE RECEPTACLE IN LIVING ROOM AREA SHALL BE A DUPLEX (DOSS a16 J 1 S S CO RECEPTACLE WITH INTEGRAL USB OUTLETS. COORDINATE ❑ ® RECEPTACLE LOCATION WITH OWNER. RON _ 7771 :08 16 M. SINGLE STATION SMOKE DETECTORS IN RESIDENT UNITS SHALL BE O a J INSTALLED TO MEET THE FOLLOWING REQUIREMENTS: C/e — A. INSTALL A MINIMUM OF 36" FROM A BATHROOM 010 CONTAINING A SHOWER OR TUB. EF-A2 LC2 B/a 11 F1 1 B.B. INSTALL A MINIMUM OF 36" FROM HVAC SUPPLY REGISTERS. 48" FI C. INSTALL A MINIMUM OF 36" FROM THE TIP OF A CEILING cnn SUSPENDED PADDLE FAN. -- GFIQ0 B/g _Cr D. REFER TO NEPA FOR ALL INSTALLATION REQUIREMENTS, project g c J O a 11 019 B/a NOT ALL REQUIREMENTS ARE LISTED HERE. B/a M 018 O N. PROVIDE THE FOLLOWING IN ALL HVI UNITS VINEYARD VIEW 09 U 11 SD-HP- EF-A1 A. IN HVI UNITS PROVIDE A HARC SA-101 SONIC RECEIVER C ® B _ IN THE MASTER BEDROOM. THE RECEIVER SHALL PLUG p C/e 07�14 INTO A 120V RECEPTACLE AND ACCEPT THE PLUG —� RAC 9 9 01 7 FROM A SC-VIB-PJ BED SHAKER. County Road 48 FI s Cn 48 DWH-1 SS B. IN HVI UNITS PROVIDE GENTEX 7109CS SMOKE DETECTORS Greenport, NY 11944 ❑SS 11 GFI a O WITH VISUAL SIGNAL. SMOKE DETECTORS SHALL BE seal AC 3 CO � CO F HARDWIRED AND INTERCONNECTED. WITH ALL OTHER PSD-HP-3 NOTIFICATION DEVICES IN THE UNIT. ADJACENT TO THE / OV N W 1 FI M GFI a C/ E 0 HALLWAY SMOKE DETECTOR INSTALL A HARC SC-0O2 p g CARBON MONOXIDE DETECTOR WITH TRANSMITTER. THE �� N�, no C R 19 dig DWH-1 DETECTOR SHALL BE HARDWIRED. 2 FI 48" (N)O7 C. PROVIDE AND INSTALL BUILDING FIRE ALARM SYSTEM CC A/c C/e B/a Vila: GFI 7 VISUAL SIGNALING DEVICES IN ALL HVI UNIT LIVING ROOM, C d 010 O BATHROOMS AND BEDROOMS. , 1 10 10 D. ALL HVI PLUG IN ITEMS SHALL BE TURNED OVER TO THE ��o n, �� `� NPS co B/a OWNER AT THE END OF THE PROJECT. SEE ARCHITECTURAL sol F5`.>10 GF DW CA 019 DRAWINGS FOR HVI UNITS. C/f 0 19 E 48" E. PROVIDE HARDWIRED DOOR SIGNALER WITH STROBE FOR I issued date description � 12 5 1g a GFI HVI UNITS IN LIVING ROOM AND BEDROOMS. PROVIDE p HARDWIRED PUSH-BUTTON. PROVIDE TRANSFORMER AT 1 03/14/19 Issued for Construction F 11 '- 70" A.F.F. FOR CHIME/STROBE AND INSTALL AT 7'-0" A.F.F., ® B 3 CONNECT TRANSFORMER TO LOCAL RECEPTACLE CIRCUIT. 0. REFER TO ARCHITECTURAL DRAWINGS FOR LIGHTING FIXTURE a 7 J M LOCATIONS. 1 DSS-HP-2 / P. COORDINATE EXTERIOR CONDENSING UNIT LOCATIONS WITH Co Qs SS MECHANICAL CONTRACTOR PRIOR TO ROUGH-IN. ©P 0B/b 10 5@c P© DSS-HP-1 a M 0111 I DRAWING NOTES: 17L 01 PROVIDE PREWIRING FOR FIRE ALARM VISUAL DEVICE AT 80" AFF F I -y -- WITH WIRING FROM FACP. PROVIDE FIRE ALARM VISUAL DEVICES IN + El 0 ® ALL HVI UNITS. 7 17 02 NOT USED. 03 PROVIDE ONE (1) SWITCH FOR EXHAUST FAN. THE SWITCH SHALL CONTROL THE "ON/OFF" OPERATION OF THE INTEGRAL LED LIGHT. EXHAUST FAN SHALL HAVE CONSTANT POWER AND BE CONTROLLED title 9 BY INTEGRAL OCCUPANCY SENSOR. 10 5 ® PROVIDE DOORBELL, 16VAC, FLUSH MOUNTED 7'AFF, NUTONE LA14WH B U I L D I N G OR EQUAL. D/g GFI 05 NOT USED. SECOND FLOOR © PROVIDE CONNECTION OF EXTERIOR BUILDING LIGHTS TYPE 'P' TO CIRCUIT HP-6. PLAN - ELECTRICAL 07 PROVIDE RECEPTACLE FOR WATER HEATER. MOUNT RECEPTACLE AT 44" A.F.F. ADJACENT TO THE WATER HEATER, COORDINATE EXACT LOCATION IN FIELD. drawn by: DPK checked by: ERB scale: 1/4"= 1'-0" project number: 10002 1 BUILDING "A"SECOND FLOOR PLAN -ELECTRICAL scaled inch A1.0 SCALE: 114"=1'-0" sheet number BUILDING A ENGI NEERiNG Cc® Mechanical/Electrical Engineering Consultants , M/E Project#170412 Rochester Buffalo I Syracuse I Schenectady 150 N.CHESTNUT ST. 585.288.5590 ' ROCHESTER NY 14604 www.meengineedng.com BEATTY HARVEY COCO A RC H I T E C T S , LLP NEW YORK I MARYLAND A, 1300 Walt Whitman Road, New York, 11747 p: (631)300-1010 owner/developer DRAWING NOTES: Conifer Realty 1000 University Avenue Suite 500 Rochester, NY 14607 O LOCATE SWITCH, LIGHT AND RECEPTACLE AT ATTIC ACCESS. 585.324-0500 O PROVIDE JUNCTION BOX AND 120V CIRCUIT IN ATTIC FOR FUTURE RADON FAN. COORDINATE LOCATION WITH RADON PIPING INSTALLATION. civil engineer LKMA 437&405 South Country Road Brookhaven,NY 11719 631.286.8668 m.e.p. &f.p. WE Engineering, P.E. B 150 No h Chestnut Street Rochester, NY 14604 585.288.5590 structural engineer TDM Consulting Engineering 550 North County Road,Suite Saint James, NY 11780 631.686.5234 key TRUE NORTH 4C ■ Eon A 0 HP-7 E 1 GFI GFI O E project 7� S 7 79S 07 VINEYARD VIEW HP-8 County Road 48 Greenport, NY 11944 8 seal nq/V y0,A C7 F� sF , 6 o-7 E issued date description 1 03/14/19 Issued for Construction IF title BUILDING A - ROOF PLAN - ELECTRICAL drawn by: DPK checked by: ERB scale: 1/4"= F-0" project number: 10002 BUILDING "A" ROOF PLAN -ELECTRICAL scaled inch SCALE: 114"=1'-0" sheet number BUILDING A H� 4H E 1 a03 - + + + +5 +6 C ENGiNEERiNG Mechanical/Electrical Engineering Consultants ID Ink 120/240V C CIRCUITS i- t EXTERIOR Rochester I�Buffalo Ie # eI1 SNcuseISchenectady LIGHTING FIXTURES 150 N.CHESTNUT ST. 585.288.5590 ROCHESTER NY 14604 www.meengineering.com IJ!" C N BEATTY HARVEY COCO SLOPE FINISH GRADE ARC H I T E C T S , LLP G AWAY FROM COVER. COVER: AS SPECIFIED.AND DESIGNATED NEW YORK I MARYLAND HAND 1A 1300 Wait Whitman Road, New York, 11747 RI • OFF C TO SERVICE ENTRANCE � p:(631)300-1010 EQUIPMENT GROUND owner/developer +120V,20A AUTO PC BUS. lA� �� Conifer Realty CIRCUIT 10'-0" (TYP) /� 1000 University Avenue Suite 500 vn GROUT FRAME. Rochester, NY 14607 N (� 0 0 0 585.324-0500 5'-0" (TYP) G _ TWO (2) COURSES civil engineer _ (MIN.) BRICK. PLACE ;.;.:r' LKMA ------------ ————————————— ADDITIONAL BRICK AS ;;r; 437&405 REQUIRED TO BRING South Country Road NOTES FRAME UP TO PROPER DO NOT LOCATE Brookhaven,NY 11719 FINISH GRADE. HANDHOLES IN 631.286.8668 VEHICULAR TRAFFIC �� 600V INSULATED COPPER AREAS. CONNECT TO CIRCUIT AS INDICATED ON PLANS AND PROVIDE CIRCUIT BREAKER LOCK. CONDUCTOR INSTALLED m.e.p. &f.p. O1 i IN PVC RACEWAY. PROVIDE 2' X 2' X 4' M/E Engineering, P.E. i HANDHOLE g 150 North Chestnut Street Rochester, NY 14604 EXTERIOR LIGHTING CONTROL WIRING DIAGRAM ` #4/0 BARE COPPER 4" X 10" KNOCKOUTS. 585.288.5590 1 i GROUNDING CONDUCTOR. TWO (2) ON ALL FOUR SCALE: NTS �� INSTALL 1'-0" MIN. SIDES. BELOW FINISHED GRADE structural engineer (TYP). TDM Consulting Engineerinq� 550 NorthRoad, Saint JamesSuite? %4" 0 k 10'-0" COPPERWELD GROUND ROD. DRIVE FULL LENGTH 631.686.5234 PAVING OR TOPSOIL TO �� INTO GROUND. TOP OF ROD TO _ ` a WITH MATCH SITE CONDITIONS 12" MIN. BELOW FINISHED GRADE MYLAR TAPE VIITH WORDING: "CAUTION - BURIED ELECTRIC (TYP). LINE BELOW" FINISH GRADE 12" OF •2 CRUSHED key STONE BELOW HANDHOLE. EXTEND MINIMUM OF 6" DETAIL NOTES: AROUND OUTSIDE EDGE. 1111111L TRUE NORTH A. AT POINT OF ENTRANCE TO FACILITY, PROVIDE SOLDER BLOCK IN GROUNDING — _ — ELECTRODE CONDUCTOR. SEAL CONDUIT TO CONDUCTOR 100% WATERPROOF. 6" B. GROUNDING ELECTRODE CONDUCTOR SHALL BE: o =1 _ NO ROCKS, DEBRIS IN 1. MINIMUM SIZE 2/0 COPPER FOR 400A SERVICE. -� BACKFILL 2. SIZE 4/0 FOR OVER 400A SERVICE. r DETAIL NOTES: C. PROVIDE ADDITIONAL RODS AND INTERCONNECTIONS AS NECESSARY A. ALLOW SUFFICIENT SLACK CABLE SO SPLICES CAN BE MADE ABOVE ° O TO OBTAIN SPECIFIED OR UTILITY MAXIMUM RESISTANCE TO GROUND GRADE OUTSIDE OF HANDHOLE. LOWER SPLICE AND SLACK CABLE INTO ° COMPACT BACKFILL TO WHICHEVER IS LESS. HANDHOLE IN A NEAT ARRANGEMENT. 30" MATCH SURROUNDING MINIMUM CONDITIONS ° ELECTRODE GROUND GRID HANDHOLE DETAIL 5 � project PROVIDE 3" SAND BED SCALE: NTS SCALE: NTS VINEYARD VIEW ALL AROUND CONDUIT SCHEDULE 80 PVC CONDUIT UNLESS D OTHERWISE SHOWN " . ON PLANS County Road 48 Greenport, NY 11944 seal 7i/2" MINIMUM SPACING - OF W y DETAIL NOTES: C/)��+ 0 n'fiFO�ir r4 A. READ THE SPECIFICATIONS. f�,, 7!t GROUNDED SERVICE ENTRANCE �t, a ��' {,t,CONDUCTOR CONDUCTORS LU B. REPAIR ALL SETTLEMENT. ELECTRIC METERS MOUNTED TO THE EXTERIOR OF THE BUILDINGS N L1 L2 ?sFo p69.��3 TYPICAL DIRECT BURIED CONDUIT DETAIL 2 SCALE: NTS O O O issued date description 4 5 O O O HOUSE 1 03/14/19 Issued for Construction ® POWER LOAD MAIN O O O CENTER CIRCUIT MYLAR MARKING TAPE BREAKER WITH MAGNETIC STRIP -- _ AND WITH WORDING: O O "CAUTION - ELECTRIC ---�---- - - - FIRST FLOOR ELEVATION LINE BURIED BELOW" --��---",-- �� o BURIED AT 6" BELOW -- - - --'-----'-----'`�-"-- FINISHED GRADE GRADE INCOMING I ° CONDUITS -------------------- BFE FLOOD ELEVATION GRADE NEUTRAL GROUND ASPHALT PAVEMENT SECTION BUS BUS TO MATCH EXISTING O O F ° 0 0 0 z o z SERVICE ENTRANCE STONE BASE COURSE ° °O a°o a°o„ oo ° �o. , �o„ �o 00 � � SEA LEVEL p p p p o p DISCONNECTING MEANS o11 o o o 0') N COMPACTED, SELECT BACKFILL _I I - -11 __ GENERAL NOTES. +6 REBAR (TYP) c N A. DIMENSIONS OF EQUIPMENT MAY VARY DEPENDING ON EQUIPMENT title N SUBMITTED AND APPROVED. VERIFY EXACT DIMENSIONS IN FIELD WITH O O DETAILS - CONCRETE 9 APPROVED SHOP DRAWINGS. REBAR PLACEMENT STRAP B. METERING EQUIPMENT SHALL BE PROVIDED AS APPROVED BY THE DETAIL NOTES: ELECTRICAL CONDUIT(S) - SIZES AS INDICATED n ETC., SHALL BE AS APPROVED BY THE UTILITY. O GROUNDING ELECTRODE CONDUCTOR. PROVIDE INSULATED COPPER CONDUCTOR PER CONDUIT CRADLESSPECIFICATIONS. IF NO SIZE IS SPECIFIED, PROVIDE INSULATED COPPER a - C. LAYOUT SHOWN IS APPROXIMATE AND MAY VARY PER BUILDING, CONDUCTOR SIZED PER N.E.C., TABLE 250-66. INSTALL IN RIGID, SCHEDULE N 40, PVC RACEWAY. UNDESTUR13ED 4 - D. MAINTAIN ALL CLEARANCES FROM WINDOWS, A/C UNITS, GAS SERVICES, EARTH 2" ETC., AS CALLED FOR BY UTLITY. 20 METAL UNDERGROUND WATER PIPE IN DIRECT CONTACT WITH EARTH FOR 10 FEET �YpiOR MORE. SHALL BE SUPPLEMENTED BY ITEMS 3 & 4. 6., E. PROVIDE %S MINIMUM OUTDOOR PLYWOOD FRAMED WITH "J" CHANNEL + MADE GROUNDING ELECTRODE. REFER TO MADE GROUNDING ELECTRODE-GROUND + drawn by: DPK TYP. WITH EXPOSED AREAS COVERED WITH SIDING AND CAULKING. SECURE WITH 8 PENNY COMMON NAILS AT 3" INTERVALS. COORDINATE WITH GRID" DETAIL & SPECIFICATIONS. G.C. FOR 2X4 CROSSBRACES REQUIRED. SECURE METER BOXES TO PLYWOOD checked by: ERE DETAIL NOTES: AS REQUIRED BY UTLITY COMPANY. ® MAIN BONDING JUMPER. PROVIDE INSULATED COPPER CONDUCTOR 1. FOR CONDUIT ENTRANCE THROUGH OR INTO A BUILDING OR OTHER STRUCTURE DRILL F. METERS SHALL NOT BE INSTALLED BELOW THE BFE ELEVATION. PER N.E.C. ARTICLE 250-28. scale: 1/81,= 1'-0 AND GROUT THE FOUR REBARS INTO THE STRUCTURE (4" MIN.). INSTALL METERS IN ACCORDANCE WITH UTILITY COMPANY REQUIREMENTS. + BOND GROUND BUS TO EQUIPMENT ENCLOSURE WITH BARE COPPER BONDING project number: 1000' 2. ALL TURNS/BENDS SHALL BE WITH LARGE RADIUS (4' MINIMUM) ELBOWS. COORDINATE WITH UTILITY. JUMPER PER N.E.0 ARTICLE 250-28. scaled inc sheet number TYPICAL CONCRETE ENCASED DUCTBANK DETAIL- PAVED AREAS ELECTRIC METER ELEVATION DETAIL SERVICE ENTRANCE GROUNDING BUILDING A CV SCALE: NTS SCALE: NTS SCALE: NTS 1 1 + 3+- +4 5 I 6 I + +8 —9 I H E4001 F Lk ENGiNEERiNGIN ® � - Mechanical/Electrical Engineering Consultants UL LISTED GROUND CLAMP M/E Project#170412 AND EQUIPMENT BONDING JUMPER Rochester I Buffalo I Syracuse I Schenectady 150 N.CHESTNUT ST. 585.289.5590 .A 2z,; 'I is J D" 1i to PAVING OR TOPSOIL TO ROCHESTER NY 14604 www.meengineedng.com MATCH SITE CONDITIONS DETECTABLE WARNING TAPE WITH WORDING: "CAUTION - BURIED ELECTRIC LINE BELOW" FINISH GRADE 1 BEATTY HARVEY COCO ARCHITECTS , LLP (MIN-MAX) NEW YORK I MARYLAND 1300 Walt White(631)300-1010 York, 11747 A O � 3 6 owner/developer 61 I Conifer Realty NO ROCKS, DEBRIS IN N 1000 University Avenue Suite 500 BACKFILL JUNCTION BOX Rochester, 07 — — IN EXHAUST FAN 585.3232 4-05-0500 ® 8 COMPACTED, SELECT BACKFILL I I WHITE N civil engineer (COORDINATE WITH SITE REQUIREMENTS) 120V 30" MINIMUM BLACK 0 437&405 REDSouth Country Road 0 Brookhaven,NY 11719 PROVIDE AROUND CONDUIT 5 20'-0" 8 RED 0 f 631.286.8668 7 BLACK m.e p & p 3.. CONDUIT. :,:,;, ,... . ° WALL MOUNTED SWITCH FOR ` ` DETAIL NOTES: E Eng�neenng, P.E. B 150 No Chestnut Street s;,i. 6;;.< WHITE INTEGRAL LIGHTS (EF-1 ONLY) Rochester, NY 14604 O UTILITY POLE. TO DOWN LIGHT BLACK 585.288.5590 TERMINATE RACEWAY AT EXACT HEIGHT DICTATED BY UTILITY structural engineer COMPANY.(PROVIDE MINIMUM OF 5 PIPE STRAPS) TYPICAL CONDUIT (SCHEDULE 80 PVC) TDM Consulting Engineerin (NUMBER OF CONDUITS SHALL BE AS O TERMINATE AND CAP SPARE RACEWAY. 550 North County Road,Suite? INDICATED ON THE PLAN) NY 11780 DETAIL NOTES: ® MINIMUM 3'-8" BELOW GRADE. Saint lames,631.66886..52345234 A. REFER TO THE SPECIFICATIONS. TWO (2) 4" PVC, SCHEDULE 80 CONDUITS DIRECT BURIED. DETAIL NOTES: B. REPAIR ALL SETTLEMENT. © FINISHED GRADE. A. W ORD (1) TOGGLE SWSHOWN ON P ANISH TO CONTROL INTEGRAL LIGHTS C. MINIMLM TOP SOIL - 6". 0 PVC TO RIGID GALVANIZED STEEL CONDUIT ADAPTER. key TRUE D. WHERE ADDITIONAL CONDUITS ARE REQUIRED, INCREASE TRENCH ® TWO (2) 4" GALVANIZED STEEL CONDUITS. NORTH WIDTH AND INSTALL CONDUITS WITH 3" MINIMUM SPACING. ° C� 09 90 DEGREES X 60" RADIUS SWEEP ELBOWS. _ lC UTILITY POLE - PRIMARY ELECTRIC BATHROOM EXHAUST FAN WIRING TYPICAL DIRECT BURIED CONDUIT DETAIL CONDUIT RISER DETAIL DIAGRAM o 1 2 3 ° a project VINEYARD VIEW County Road 48 Greenport, NY 11944 AS Rseal XFMRE/QS'WITB H� ��XFNRAS E/QS'WITCH 0 Ftv SIZE SIZE �� Y c � s�o 069/&3 4✓' COVER– COORDINATE REQUIRED CAELE OPENING SIZE/ LOCATION WITH APPROVED issued date description TRANSFORMER/SWITCH. –� 1 03/14/19 Issued for Construction St . A X 10' LONG INSPECTION PLATE EXOTHERMIC WELD GROUND GROUND ROD (STEEL GRATING) ROD CONNECTION 9 .. ,� � � � < �o3 *2 CR USHED ° ° oSTONEr\ \, °ooo O o� o0o o�d0o°oo eocOo FINISHED GRADE7�, � Ooo 000000� 00000 00 o0D0 66 CONCRETE C URB0g00° 00GROUND ROD0 0 OPENING0O F TRANSFORMER 6" DIAMETER CAST IRON PIPE VAULT DETAIL NOTES title A. PRECAST CONCRETE SWITCH VAULT/PAD TO BE LAKELANDS PRECAST MC100 OPENING WITH MC101 ROOF. NO EQUALS WILL BE ACCEPTED PER RG&E STANDARDS. DETAILS B. SEAL ALL VAULT PENETRATIONS WATERTIGHT. °o °° ELECTRICAL C. LAST CONDUIT LENGTHS AT VAULT TO BE GALVANIZED RIGID STEEL (GRS) ° ° W DIA. x 10'- 0" COPPER CONDUIT. GROUND ROD D. PROVIDE 12" *2 CRUSHED STONE BASE (COMPACTED) BELOW & AROUND \ �� GROUND VAULT. (*2 BARE E. TOP OF PAD TO BE 6" ABOVE FINISHED GRADE. STD. CU.) DETAIL NOTES: -�- drawn by: DPK F. PAD TO EXTEND 6" BEYOND TRANSFORMER ON � 1. PROVIDE INSPECTION PLATE & CAST IRON PIPE (NO PAVED SURFACES). ALL SIDES G. COORDINATE WITH NATIONAL GRID FOR EXACT VAULT SIZE. checked by: ERB DETAIL NOTES scale: A. COORDINATE WITH NATIONAL GRID FOR EXACT REQUIREMENTS. project number: 10002 scaled inch TYPICAL GROUND ROD DETAIL PADMOUNT TRANSFORMER TRANSFORMER GROUNDING DETAIL sheet number 4 5 6 BUILDING A ENGiNEERiNG D i Mechanical/Electrical Engineering Consultants M/E Project#170412 "•.o= '"" Rochester I Buffalo I Syracuse I Schenectady 150 N.CHESTNUT ST. 585.288.5590 ROCHESTER NY 14604 www.meengineering.com aidF vrtla i.�air dr �+,T';wa q,;€i,Ri a► COAX 4 PR CAT 6 CABLE (TYPICAL) TYPICAL APARTMENT O TYPICAL APARTMENT O BEATTY HARVEY COCO C2 C3 C4 C5 C6 ------------------ I -------------------i ARC H I T E C T S , LLP I I I I NEW YORK I MARYLAND I ql CAT6 CABLE I I I I 1300 Walt Whitman Road, New York, 11747 —I— (TYPICAL I I FACP A p:(631)300-1010 (COMMUNITY BLDG.) owner/developer 120V, 20A CKT 1111— i ZONE 1 wF Ts s H F NVR TV TV TV Conifer Realty TO DNDF I I CABOARDDF i i O 120V,20A 1000 University Avenue Suite 500 (CAT 6) I I I I CKT O Rochester, NY 14607 585.324-0500 MUNICIPAL DIGITAL MAIN TELEPHONE MONITOR KEYBOARD MOUSE TIE COMMUNICATION BOARD civil engineer 1=AAP LKMA 437&405 DETAIL NOTES TO UTILITY MANHOLE South Country Road NOTIFICATION F F 1= Brookhaven, NY 11719 631.286.8668 A. NVR TO HAVE BUILT-IN POE SWITCH. 4" PVC, DIRECT BURIED m.e.p. &f.p. B. NVR SHALL BE ABLE TO OPERATE AS A WORK STATION TO CONTROL NOTES: M/E Engineering, P.E. ALL FUNCTIONS OF CCTV SYSTEM: B 150 North Chestnut Street O1 PROVIDE TV OUTLETS AS SHOWN ON PLANS AND INSTALL A COAX CABLE FROM 2-*18 TSP IN 1"C 2-*18 TSP IN 1"C Rochester, NY 14604 C. ANY WORKSTATION CONNECTED TO THE NETWORK SHALL BE ABLE TO EACH OUTLET IN EACH APARTMENT TO CATV BOARD. LEAVE SUFFICIENT SLACKFIRE ALARM LOOP FIRE ALARM LOOP 585.288.5590 MONITOR AND CONTROL CCTV SYSTEM VIA WEB ENABLED GRAPHICAL FOR FUTURE TERMINATION BY CABLE COMPANY. LABEL CABLES WITH APARTMENT (SEE SITE PLAN (SEE SITE PLAN FOR USER INTERFACE. AND ROOM NUMBERS. FOR ROUTING ROUTING) structural engineer D. PROVIDE WALL MOUNTED RACK AND/OR SHELVES FOR MOUNTING OF THE 2 PROVIDE TELEPHONE OUTLETS WHERE SHOWN ON PLANS AND FROVIDE A CABLE DVR, MONITOR AND CONTROL EQUIPMENT. FROM EACH OUTLET TO PUNCH DOWN BLOCK AT TELEPHONE BACKBOARD. LABEL CABLES WITH TDM Consulting Engineering APARTMENT AND ROOM NUMBERS. 550 North County Road,Suite Saint James, NY 11780 WIRING ONLY 631.686.5234 S O (CCTV) S F IN JUNCTION BOXES CLOSED CIRCUIT TELEVIIN S H WF TS H SYSTEM RISER DIAGRAM TE LE P HONE/CATV RISER DIAGRAM 5 1 BLDG. FACP PANELS (TYP.) 3 120V, 20A SPRINKLER SYSTEM ke 2 OCIRCUIT WATER GONG y SCALE NTS SCALE. NTS X TRUE NORTH CI NOTES �C T 1O PANEL SHALL BE EQUIPPED WITH ALL REQUIRED POWER SUPPLIES AND BATTERIES SIZED TO ACCOMMODATE ADA COMPLIANT VISUAL ALARMS IN ALL RESIDENT UNITS ° AS SHOWN ON PLANS. PROVIDE AND TERMINATE ALL WIRING REQUIRED FOR VISUAL ALARMS IN ALL RESIDENT UNITS. VISUAL ALARMS WILL BE ADDED IN FUTURE ASon REQUIRED BY UNIT OCCUPANT. �� OO O2 PROVIDE TWO PHONE LINES FROM DIGITAL COMMUNICATOR TO BUILDING PHONE BOARD. O PROVIDE LOCKS FOR ALL CIRCUIT BREAKERS SUPPLYING FIRE ALARM EQUIPMENT. ® PROVIDE ADDRESSABLE HEAT DETECTOR, CONNECT TO SUPERVISORY ALARM CIRCUIT OF BUILDING FACP. DETECTOR TO MONITOR LOW ROOM TEMPERATURE, project SET TO ALARM AT 40 DEGREES F. Two (2) CAT 6 VINEYARD VIEW (TYP.)---------------, O PROVIDE NETWORK SYSTEM INTEGRATORS AND ALL EQUIPMENT, WIRING, CONNECTIONS AND PROGRAMMING AS REQUIRED TO MONITOR REMOTE BUILDING FACP PANELS ON COMMUNITY BUILDING FACP. ANNUNCIATE REMOTE BUILDING FACP MAINTENANCE ALARMS (FIRE, TROUBLE & SUPERVISORY) ON COMMUNITY BUILDING PANEL. DO NOT p1 p DESKTOP i OFFICE ACTIVATE COMMUNITY BUILDING A/V DEVICES ON ACTIVATION OF REMOTE BUILDING ALARMS. D L-----------------' Count Road 48 TWO (2) CAT 6 © PROVIDE ADDRESSABLE FIRE ALARM SYSTEM. Y (TYP.) Greenport, NY 11944 '------------------' © FIRE ALARM SYSTEM RISER DIAGRAM ' seal p DESKTOP 1 i MANAGERS - D i OFFICE COMMUNITY BUILDING OF N woo p DESKTOP 2 SCALE NTS CO D I e ri,n p PRINTER/FAX I `,'(,t`: ",r k �—F---------------� t,s� TWO (3) CAT 6 osg 7�3 F` 4✓ (TYP.) °�rssi�N ACSP 7 7 7 7 TO DMDF 120V E issued date description (CAT6) 1 03/14/19 Issued for Construction Tmr) DME) ,------------------I O 1 r___, COMPUTER i DCP 2 I I (SEE PLANS FOR PR p COMPUTER i QUANTITY OF iCOMPUTERS) DRP 120V I PR TEL/DATA TEL/DATA ; I O DS 30 ROOM ROOM O COMMUNITY RM. i TYPICAL DOOR 120V RPS INTERIOR MOUNTED TYPICAL DOOR ———— I CONFIGURATION DOOR OPERATOR(j) CONFIGURATION -------------� DS PUSH BUTTON WITH DOOR F = = TWO (2) CAT 6 OEXTERIOR MOUNTED OPERATOR �— (TYP.) DOOR OPERATOR PUSH BUTTON GENERAL ONE LINE NOTES: A. WIRING INDICATED ON THE RISER DIAGRAMS IS DIAGRAMMATIC ONLY, AND IS NOT INTENDED TO INDICATE ROUTING OR QUANTITIES OF WIRES REQTHEEUSYSTEMR MVIDE WIRING ANUFACTURER . ALL PLETE SYSTEMS AS DEVICES MAY NOT BE INDICATED ON DRAWING NOTES:WIRED BY title RISER DIAGRAM; REFER TO FLOOR PLAN FOR QUANTITIES AND LOCATION DETAILS - OF DEVICES. 0 PROVIDE ALL HARDWARE, WIRING, CONNECTIONS AND PROGRAMMING AS REQUIRED SUCH THAT OPERATION OF INTERIOR (SECURE SIDE OF ELECTRICAL RISER DIAGRAM NOTES; DOOR) DOOR OPERATOR PUSH BUTTON UNLOCKS DOOR AND ACTIVATES DOOR OPERATOR. VALID CARD ACTUATES CARD READER WHICH UNLOCKS O1 PROVIDE 3/4" 4' HIGH PLYWOOD BACKBOARD PAINTED WITH GREY DOOR AND ALLOWS OPERATION OF EXTERIOR DOOR OPERATOR PUSH FIREPROOF PAINT. BUTTON. 2O PROVIDE 24 PORT, WALL MOUNTED AND HINGED PATCH PANEL. PROVIDE O2 CONNECT TO NEAREST 120V RECEPTACLE CIRCUIT. TYPICAL ALL DOOR 2'L x 1'W SHELF BELOW PATCH PANEL FOR OWNER PROVIDED RELEASE POWER SUPPLIES. EQUIPMENT. �- O3 DEVICE FURNISHED BY HARDWARE SUPPLIER. G drawn by: DPK COMMUNITY BUILDING — checked by: ERB TELECOMMUNICATIONS RISER DIAGRAM &AACALE CCESS CONTROL SYSTEM RISER DIAGRAM scale: 1/8"= 1'-0" 4 SCALE NTS NTS project number: 10002 scaled inch sheet number BUILDING A E4 . 039 ENGiNEERiNG Mechanical/Electrical Engineering Consultants WE Project#170412 '"' low Rochester I Buffalo I Syracuse I Schenectady PROVIDE RISER 150 N.CHESTNUT ST. 585.288.5590 f_(+ •i' i � '� `Yh' AT POLE AS ROCHESTER NY 14604 www.meengineenng.com DIRECTED BY THE PROVIDE CT CABINET UTILITY COMPANY AND METER AS DIRECTED BY THE UTILITY COMPANY BEATTY HARVEY COCO HIGH VOLTAGE HIGH VOLTAGE A R C H I T E C TS , L L P WIRING BY WIRING BY NEW YORK I MARYLAND UTILITY COMPANYPAD MOUNTED UTILITY COMPANY PAD MOUNTED A TWO(2) SETS OF ALUMINUM T TRANSFORMER T TRANSFORMER 1300 Walt Whitman Road, New York, 11747 4-*500KCMIL, 1-*2/OEG IN 4" BY UTILITY COMPANY BY UTILITY COMPANY A p:(631)300-1010 PVC IN DUCTBANK TWO(2) SETS OF ALUMINUM TWO(2) SETS OF ALUMINUM owner/developer 4-*250KCMIL, 1-*1 EG IN 4" 4-*25OKCMIL, 1-*1 EG IN 4" PVC IN DUCTBANK PVC IN DUCTBANK Conifer Realty MC-A MC-8 1000 University Avenue Suite 500 FIR= HOUSE METER CENTER 208Y/12OV,30,4W, 22KAIC METER CENTER 208Y/12OV,30,4W, 22KAIC Rochester, NY 14607 585.324-0500 PANEL � 300/3 400/3 (BY OTHERS) 100A MCB 208Y12OV,30,4W 120/208V, 3 ,4W I --------------i H H 600/3 civil engineer 1 I LKMA 100 125 125 100 125 125 437&405 100 250 1 2 2 2 2 2 2 South Country Road Brookhaven,NY 11719 3 3 631.286.8668 q I 3*1/0,1*6EG ALUMINUM 3*2/0,1*6EG ALUMINUM 3*1/0,1*6EG ALUMINUM 3*2/0,1*6EG ALUMINUM ------ ---- ---------- -I SE CABLE WITH SE CABLE WITH SE CABLE WITH SE CABLE WITH m.e.p. &f.p. INSULATED INSULATED INSULATED INSULATED M/E Engineering, B SERVICE TO LOAD CENTERS TO LOAD CENTERS g� eerin�q, P.E. CONDUCTORS CONDUCTORS CONDUCTORS CONDUCTORS 150 North Chestnut Street ENTRANCE IN APARTMENTS IN APARTMENTS + Rochester, NY 14604 4*3/0, 1*6EG 4-*35OKCMIL, GROUNDING 120/208V, 1Q5,3W 120/208V, 1Q5,3W ALUMINUM 1-*2EG ALUMINUM (REFER TO FLOOR PLANS (REFER TO FLOOR PLANS 585.288.5590 IN 3"C IN 4"C FOR QUANTITIES) FOR QUANTITIES) structural engineer GENERAL ONE LINE NOTES: TDM Consulting Engineenn A. PROVIDE SERVICE ENTRANCE GENERAL ONE LINE NOTES: GENERAL ONE LINE NOTES' 550 North County Road,Suite GROUNDING. REFER TO DETAILS ON Saint James, NY 11780 DRAWING E502. ES2 A. PROVIDE SERVICE ENTRANCE A. PROVIDE SERVICE ENTRANCE 631.686.5234 GROUNDING. REFER TO DETAIL *1 ON GROUNDING. REFER TO DETAIL *1 ON B. MEET ALL UTILITY COMPANY REQUIREMENTS. DRAWING E.502. DRAWING E.502. COORDINATE WITH UTILITY. 100A MCB B. METER SOCKETS FOR RESIDENTIAL 100A MCB B. METER SOCKETS FOR RESIDENTIAL C. PROVIDE MANUAL TRANSFER SWITCH AND 120/208V, 1Q3,31N LOAD CENTERS SHALL BE RINGLESS 120/208V, 1�,3W LOAD CENTERS SHALL BE RINGLESS key ASSOCIATED GENERATOR TAP BOX AS WITH HORN BYPASS. WITH HORN BYPASS. X ALTERNATE BID. TRUE NORTH CI- ONE LINE DIAGRAM - COMMUNITY BUILDING ONE LINE DIAGRAM - BUILDING TYPE A - TYPICAL ONE LINE DIAGRAM - BUILDING TYPE B - TYPICAL NO SCALE NO SCALE NO SCALE 0 �w■ OO a 0 HIGH VOLTAGE HIGH VOLTAGE HIGH VOLTAGE WIRING BY WIRING BY WIRING BY project UTILITY COMPANY PAD MOUNTED UTILITY COMPANY PAD MOUNTED UTILITY COMPANYPAD MOUNTED T BYUTILITY TRANSFORMER T BYUTILITYECOMPANY T TRANSFORMER Y COMPANY VINEYARD VIEW TWO(2) SETS OF ALUMINUM TWO(2) SETS OF ALUMINUM 4-*25OKCMIL, 1-*1 EG IN 4" 4-*250KCMIL, 1-1 EG IN 4" TWO (2) SETS OF ALUMINUM 4- 500KCMIL, 1- 2/OEG OEG IN 4- MC-C PVC IN DUCTBANK MC-D PVC IN DUCTBANK PUMP MC-D PVC IN DUCTBANK STATION D METER CENTER 208Y/12OV,30,4W, 22KAIC METER CENTER 208Y/12OV,30,4W, 22KAIC 150A MCB METER CENTER 208Y/12OV,30,4W, 22KAJC + County Road 48 400/3 300/3 120/208V, 3�,4W 600/3 Greenport, NY 11944 __,e�� seal H ZJ H H H H T41�25 100 125 125 100 125 125 150 100 125 2 2 2KI 2 2 2 2 3 2 2 2 91 1 3*1/0,1*6EG ALUMINUM 3*2/0,1*6EG ALUMINUM 3*1/0,1*6EG ALUMINUM 3*2/0,1*6EG ALUMINUM 3 2/0 1 6EG ALUMINUM SE CABLE WITH SE CABLE WITH SE CABLE WITH SE CABLE WITH SE CABLE WITH INSULATEID INSULATED INSULATED INSULATED INSULATED CONDUCTORS TO LOAD CENTERS CONDUCTORS CONDUCTORS TO LOAD CENTERS CONDUCTORS 4*25OKCMIL TO LOAD CENTERS CONDUCTORS �Fo 069-74 120/208V, 4� ` 1 APARTMENTS IN APARTMENTS 1*4EG IN APARTMENTS ,f (REFER 1QS,3W 120/208V, 10,3W 120/208V, 10,3W (REFER TO FLOOR PLANS (REFER TO FLOOR PLANS ALUMINUM IN 3"C 3*1/0,1 6EG (REFER TO FLOOR PLANS lop FOR QUANTITIES) FOR QUANTITIES) ALUMINUM FOR QUANTITIES) E 1 issued date description E1_ SE CABLE WITH � p INSULATED GENERAL ONE LINE NOTES: GENERAL ONE LINE NOTES CONDUCTORS GENERAL ONE LINE NOTES 1 03/14/19 Issued for Construction 8P1 A. PROVIDE SERVICE ENTRANCE A. PROVIDE SERVICE ENTRANCE A. PROVIDE SERVICE ENTRANCE GROUNDING. REFER TO DETAIL *1 ON GROUNDING. REFER TO DETAIL *1 ON GROUNDING. REFER TO DETAIL *1 ON DRAWING E.502. DRAWING E.502. DRAWING E.502. 120100A M 1B B METEROAD CSOCKETS SHALL BE IR BE 100A MCB B. METER SOCKETS FOR RESIDENTIAL 100A MCB B. METER SOCKETS FOR RESIDENTIAL 120/208V, 1Qf,3W LOAD CENTERS SHALL BE RINGLESS 120/208V, 1�,3W LOAD CENTERS SHALL BE RINGLESS WITH HORN BYPASS. WITH HORN BYPASS. WITH HORN BYPASS. ONE LINE DIAGRAM - BUILDING TYPE C - TYPICAL ONE LINE DIAGRAM - BUILDING TYPE D - TYPICAL ONE LINE DIAGRAM - BUILDING #7, TYPE D - TYPICAL NO SCALE NO SCALE NO SCALE FF� title ONE LINE DIAGRAMS - ELECTRICAL G + drawn by: DPK checked by: ERB scale: 1/8"= 1'-0" project number: 10002 scaled inch sheet number BUILDING A tiY ENGiNEERNG ® - - Mechanical/Electrical Engineering Consultants WE Project#170412 Rochester I Buffalo I Syracuse I Schenectady 150 N.CHESTNUT ST. 585.288.5590 ROCHESTER,NY 14604 www rneengineering.com BEATTY HARVEY COCO A R C H I T E C T S , L L P LUMINAIRE SCHEDULE NEW YORK I MARYLAND 1300 Wait Whitman Road, New York, 11747 TYPE IMAGE DESCRIPTION MFR. & CATALOG No. LAMP COLOR TEMP. FINISH VOLTAGE/BALLAST MOUNTING UNIT WATTS EFFICIENCY REFERENCE NOTES p:(631)300-1010 A 51" X 10" LINEAR CEILING MOUNTED PROGRESS LIGHTING 35W LED 4000K WHITE 120V SURFACE 35W 103 owner/developer WHITE LED FIXTURE P7279-3040K8 80 CRI LUMEN/WATT Conifer Realty 1000 University Avenue Suite 500 Rochester, NY 14607 585.324-0500 B 12.5" DIAMETER CEILING MOUNTED SEAGULL LIGHTING (2) 9.5W LED 3000K BRUSHED 120V SURFACE 19W 84 civil engineer SATIN BRUSHED NICKLE LED FIXTURE 77064EN3-962 90 CRI NICKEL LUMEN/WATT LKMA ASN' 437&405 South Country Road Brookhaven, NY 11719 631.286.8668 C 7.25" SURFACE MOUNTED DOWN LIGHT PROGRESS LIGHTING 17W LED 3000K WHITE 120V SURFACE 17W 67 m.e.p. &f.p. FIXTURE P8022-28-30K 90 CRI LUMEN/WATT M/E Enineerin , P.E. B I R 150 No h Chestnu Street Ell Rochester, NY 14604 585.288.5590 D 9'W x 12.5"H EXTERIOR WALL PROGRESS LIGHTING: 17W LED 3000K ANTIQUE 120V WALL 17W 71 structural engineer MOUNTED ANTIQUE BRONZE DIMMABLE P6085-203OK9 90 CRI BRONZE LUMEN/WATT LED LANTERN FIXTURE TDM Consulting Engineerinq� I lb:.. 550 North County Road,Suite Saint James, NY 11780 631.686.5234 E 24" X 9" LINEAR SURFACE MOUNTED PROGRESS LIGHTING 23W LED 3000K WHITE 120V SURFACE 23W 101 WHITE LED FIXTURE P7183-303OK8 80 CRI LUMEN/WATT key �Ot TRUE NORTH C F1 24" THREE LIGHT BRUSHED NICKLE SEAGULL LIGHTING: (3) 9.5W LED 3000K BRUSHED 120V WALL 28.5W 84 C BATHROOM FIXTURE i-4941EN3-962 90 CRI NICKEL LUMEN/WATT N e�R■ — �r FB , ,, 48" X 9" LINEAR SURFACE MOUNTED PROGRESS LIGHTING 38W LED 3000K WHITE 120V SURFACE 38W 100 ° OO t" WHITE LED FIXTURE P7186-303OK8 80 CRI LUMEN/WATT ° project FE BRUSHEDDIAMETER NICKEL E ED XTURE FMSATLM MOUNTED A16LIGHT 2081N30 BN 280 CRLED 3000K BNICKELRUSHED 120V STEM 24W 63 LUMEN/WATT VINEYARD VIEW W/ 3SHL6 BN 6" STEM ACCESSORY County Road 48 CFL 52" CEILING FAN WITH LED LIGHT KIT WESTINGHOUSE: 7247700 (2) 9.5W LED 3000K BRUSHED 120V STEM 19W Greenport, NY 11944 90 CRI NICKEL seal 800 LUMENS " COORDINATE BLADE _• EA. COLOR WITH ARCHITEC F 0 FD 24" X 9" LINEAR SURFACE MOUNTED PROGRESS LIGHTING 23W LED 3000K WHITE 120V SURFACE 23W 101 h t a WHITE LED FIXTURE P7183-3030K8 80 CRI LUMEN/WATT t('` Cr FESS\0�1P I 2X4 LED SURFACE LITHONIA: 2RTLX4 39W LED 3500K WHITE 120V SURFACE 39W 96 07777-11 �`` 4000 LUMENS LUMEN/WATT E issued date description <; ii.4 1 03/14/19 Issued for Construction P LED FULL CUTOFF TRAPEZOIDAL GARDCO= 28W LED 3000K CUSTOM 120V SURFACE 28W 106 SCONCE, ALUMINUM HOUSING, TEMPERED 111L-16L-530-WW-G1-3- 2944 LUMENS LUMEN/WATT GLASS LENS, MEDIUM THROW UNV CUSTOM FINISH DISTRIBUTION, UL LISTED WET LOCATION SELECTED BY ARCHITECT LUMINAIRE SCHEDULE NOTES: A. ALL FIXTURES SHALL BE ENERGY STAR RATED F1_ title SCHEDULES - ELECTRICAL drawn by: DPK checked by: ERB scale: 1/8"= 1'-0" project number: 10002 scaled inch sheet number BUILDING A 9 T ENGiNEERiNG Mechanical/Electrical Engineering Consultants GENERAL NOTES M/E Project#170412 1.ALL DEVICES PROVIDED BY THE DIVISION 16 CONTRACTOR. Rochester I Buffalo I Syracuse I Schenectady ELECTRIC EQUIPMENT AND CONTROL N T R 0 L SCHEDULE 2.ITEM NUMBER INDICATES EQUIPMENT NUMBER. ROCHESTER, N CHESTNUTT146 58S.2883590 n g.com ELECTRIC 3.ALL DEVICES SHALL BE SURFACE MOUNTED UNLESS OTHERWISE NOTED. R«HESTER,Nviasoa www.meengineering.com 4.PROVIDE OVERLOADS, SIZE AS REQUIRED, BY THE DIVISION 15 CONTRACTOR 5."AU" INDICATES CONTROL DEVICES IS LOCATED AT THE UNIT. 6."NF" INDICATES NON-FUSED. 7."IU" INDICATES INTEGRAL WITH UNIT. B E A TT Y HARVEY COC O EQUIPMENT POWER SOURCE PROTECTION & WIRING CONTROL DEVICES ARC H I T E C T S , LLP K I MARYLAND A o oow z~ 3w UJ 0 Z� �o �m � NWo �Wo 0 0 NWzo F-z z az 1300 Wait Whitman Road, New York, 11747 0% O� Zw O �_ �_ o✓- Q F- p > MCA OR o= �� 1-F ZZw 1=pw ww Utiof awe �� '- �- v '' �� F� o~ oo DISCONNECT SWITCH A p:(631)300-1010 SYSTEM PANEL OR CONTROL CIRCUIT POWER WIRING FROM PANEL TO POWER WIRING FROM CONTROL UNIT T NEMA r,,w 3 Q(n 0�_ Q>� � -Jpia F�a �Q -� ITEM DESIGNATION NAME ROOM LOCATION HP KW SYSTEM PHASE SIZE F z !;Z2% z w>_ zw X_jw �3I �3 - =) pC) v ov ►_ VOLTS CENTER BREAKER CONTROL UNIT EQUIPMENT a 0 oa M oM= UJ z in �' o �' o to �w �w ww --'Q owner/developer AMPS STARTER �3 �w 6 - zor mw,- wo UJ Z) �itF o IV to >r pw mwtn �p� C9�0 d,-0 �O }O� z0y F-0 wZ oz EEz �O o m a w f- (A _(n =o QO 0 F 0 =d� V Da UD ¢ YF.. 0o g� dUF M pH Fp U Op o MF pv, wW z 0 w� aW F-F F 0 0 SWITCH FUSE ENCLOSU REF. 1000 UniversityConifer Realty 500 a� N No Mo wo 2 L) AMPS SIZE LOC. RE NEMA NOTES Rochester, NY 14607 585.324-0500 DSS-1 DUCTLESS SPLIT CONDENSING UNIT EXTERIOR 19.7 1 208 LC-13,15 30/2 2-10, 1-*10EG, NM CABLE 2-10, 1-*10EG, NM CABLE X AU 30 NF AU 3 SD-HP-1 DUCTLESS SPLIT INDOOR UNIT APT. MECH. RM. 1 208 LC -- 2-*10, 1-*10EG, NM CABLE 2-*10, 1-*10EG, NM CABLE X AU 20 NF AU 5 civil engineer DSS--HP-1 DUCTLESS SPLIT INDOOR UNIT APT. I 1 1 208 LC -- 2-*10, 1-*10EG, NM CABLE 2-*10, 1-*10EG, NM CABLE X AU 20 NF AU 5 LKMA DSS-2 DUCTLESS SPLIT CONDENSING UNIT EXTERIOR 19.7 1 208 LC-13,15 20/2 2-*12, 1-*12EG, NM CABLE 2-•12, 1-*12EG, NM CABLE X AU 30 NF AU 3 437&405 South Country Road SD-HP-1 DUCTLESS SPLIT INDOOR UNIT APT. MECH. RM. 1 208 LC -- 2-*8, 1-*10EG, NM CABLE 2-*8, 1-*10EG, NM CABLE X AU 20 NF AU 5 Brookhaven,NY 11719 DSS--HP-1 DUCTLESS SPLIT INDOOR UNIT APT. 1 208 LC -- 2-*10, 1-*10EG, NM CABLE 2-*10, 1-*10EG, NM CABLE X AU 20 NF AU 5 631.286.8668 DSS-3 DUCTLESS SPLIT CONDENSING UNIT EXTERIOR 25.1 1 208 LC-13,15 40/2 2-*8, 1-*10EG, NM CABLE 2-*8, 1-*10EG, NM CABLE X AU 60 NF AU 3 m.e.p. &f.p. SD-HP-1 DUCTLESS SPLIT INDOOR UNIT APT. MECH. RM. 1 208 LC -- 2-*10, 1-*10EG, NM CABLE 2-*10, 1-*10EG, NM CABLE X AU 20 NF AU 5 M/E Engineering, P.E. B DSS--HP-1 DUCTLESS SPLIT INDOOR UNIT APT. 1 208 LC -- 2-*10, 1-*10EG, NM CABLE 2-*10, 1-*10EG, NM CABLE X AU 20 NF AU 5 B 150 North Chestnut Street EF-A1 EXHAUST FAN/LIGHT APT. BATHRMS. .4 1 120 LC (SEE PLANS) 20/1 2-*12, 1-*12EG, NM CABLE 2-*12, 1-*12EG, NM CABLE X AU 2 Rochester, NY 14604585.288.5590 EF--A2 EXHAUST FAN APT. BATHRMS. .4 1 120 LC (SEE PLANS) 20/1 2-*12, 1-*12EG, NM CABLE 2-*12, 1-*12EG, NM CABLE X AU 2 DW DISHWASHER APARTMENTS KITCHEN 1 120 LC (SEE PLANS) 20/1 2-*12, 1-*12EG, NM CABLE 2-*12, 1-*12EG, NM CABLE X AU 20 NF AU structural engineer RH RANGE HOOD/MICROWAVE APT KITCHEN 1 120 LC 20/1 2-*12, 1-*12EG, NM CABLE 2-*12, 1-*12EG, NM CABLE X AU 1 TDM Consulting Engineering WH-1 WATER HEATER APT. MECH. RM. 1 120 LC (SEE PLANS) 20/1 2-*10, 1--10EG, NM CABLE 2-*10, 1- 10EG, NM CABLE X AU 30 NF AU 7 550 North County Road,Suite Saint James, NY 11780 ' EWIH-S WALL HEATER - SURFACE VARIOUS 1.8 1 120 LC (SEE PLANS) 20/1 2-*10, 1-*10EG, NM CABLE 2-*10, 1-*10EG, NM CABLE X AU 30 NF AU 631.686.5234 EWIH-R WALL HEATER - RECESSED VARIOUS 1.8 1 120 LC (SEE PLANS) 20/1 2-*10, 1-*10EG, NM CABLE 2-*10, 1-*10EG, NM CABLE X AU 30 NF AU SP-1 SANITARY PUMP STATION PUMP STATION 2Q5 3 208 PS1-1,3,5 100/3 4-*2, 1-*8EG IN 2"C 4-*2, 1-*8EG IN 2"C X AU 100 NF AU 3R 8 key TRUE NORTH REFERENCE NOTES: 4C 1. COORDINATE CONNECTION WITH SUPPLIER. 2. COMEINATION EXHAUST FAN AND LIGHT UNIT. PROVIDE WALL SWITCH FOR CONTROL OF LIGHT ONLY. PROVIDE UNSWITCHED POWER TO EXHAUST FA. FAN TO BE CONTROLLED VIA INTEGRAL OCCUPANCY SENSOR. 3. MOUNT WEATHERPROOF DISCONNECT SWITCH TO THE SIDE OF THE BUILDING. UTILIZE LIQUID TIGHT FLEXIBLE CONDUIT FOR CIRCUIT FROM THE ISCONNECT SWITCH TO THE UNIT. 4. EXHAJST FAN SHALL BE CONTROLLED VIA ROOM LIGHT SWITCH AND VACANCY SENSOR. 5. PROVIDE POWER TO INTERIOR DSS UNIT FROM EXTERIOR UNIT. COORDINATE WITH MANUFACTURER. PROVIDE INSTALLATION OF 14 GAUGE, 3-CONDCTOR PLUS GROUND STRANDED CONTROL WIRING BETWEEN THE EXTERIOR AND INTERIOR UNIT AS CALLED FOR BY THE MANUFACTURER. COORDINATE WITH MANUFACTURER PRIOR TO ROUGH-IN. 6. PROVIDE CONNECTION OF RECIRC PUMP TO WATER HEATER CIRCUIT. COORDINATE WITH PLUMBING CONTRACTOR AND SUPPLIER. 7. PROVIDE CONNECTION OF RANGE HOOD TO ROOM LIGHTING CIRCUIT. 8. PROVIDE CONNECTION OF SANITARY PUMP STATION. SEE SITE PLANS FOR MORE DETAILS. COORDINATE WITH CIIVIL ENGINEER AND SITE CONTRATOR. project VINEYARD VIEW County Road 48 Greenport, NY 11944 seal pF IEIN A co PANELBOARD SCHEDULE '' " � o U69-7 A3 4� PANEL TYPE MAIN AMPERE RATING BRANCH CIRCUIT DEVICES A�OPESS10' INFORMATION VOLTAGE RATING MOUNT BRANCH SUB KAIC QUANTITY FRAME TRIP / FUS NOTES E - NAME DIST. CIR. FEED MLO MCB MFS (RMS SWITCH SIZE-FU POLES issued date description LUGS VOLT PHASE WIRE SYM) F S ACTIVE SPARE SPACE TOTAL SIZE E 10 10 18 20 1 1 03/14/19 Issued for Construction 2 20 2 HP X 208/120 3 4 100 22 X 5 6 1 20 1 7 1 1 20 1 A LC1 X 208/120 1 3 100 10 X 1 30 2 1 40 2 5 6 20 1 8 1 20 1 A LC2 X 208/120 1 3 100 10 X 1 30 2 FFII 1 40 2 5 6 4 20 1 10 1 20 1 A LC3 X 208/120 1 3 100 10 X 1 30 2 1 40 2 Ir title 4 4 19 20 1 SCHEDULES - PS1 X 208/120 3 4 150 22 X 100 3 ELECTRICAL PAN BOARD SCHEDULE NOTES A. PROVIDE COMBINATION TYPE ARC FAULT CIRCUIT INTERRUPTER CIRCUIT BREAKER. SEE FLOOR PLANS. + drawn by: DPK B checked by: ERB scale: 1/8"= V-0" project number: 10002 scaled inch sheet number BUILDING A 21 31 41 5I 6 7 8 9 I ENGiNEERiNG GENERAL NOTES - RESIDENTIAL: GENERAL DESIGN CRITERIA: -�. A. THIS PROJECT SHALL BE DESIGNED AND CONSTRUCTED IN ACCORDANCE WITH -® A. RADON THE FOLLOWING ENERGY CONSERVATION AND FUNDING PROGRAMS Mechanical/Electrical Engineering Consultants THE MOST STRINGENT CRITERIA SHALL APPLY. M/E Project#170412 1. SEE ARCHITECTURAL PLANS FOR RADON PIPING SYSTEM. Rochester I Buffalo I Syracuse I Schenectady BL 3_,Q COORDINATE WITH PLUMBING PIPING. - ENERGY STAR V3.1 (REV 9), WITH CHECKLISTS. 150 N.CHESTNUT ST. 585.288.5590 ! . (TYPE C) - HCR HANDBOOK (VERSION 2018) ROCHESTER NY 14604 www.meengineenng.com 2. PLUMBING CONTRACTOR SHALL SEAL ALL PLUMBING RELATED - LEED V4 FOR HOMES SLAB AND BELOW GRADE EXTERIOR WALL PENETRATIONS USING POLYURETHANE CAULK, TREMCO VULKEM 116 OR SIMILAR, IN COORDINATION WITH THE INSTALLATION OF THE PASSIVE RADON MITIGATION SYSTEM. GENERAL NOTES: PLUMBING SYMBOL LIST BEATTY C H I T ERCVEY T S COCO LANDEMKED PARKING B. FIXTURE INSTALLATIONS NEW YORK I MARYLAND A. THESE NOTES ARE APPLICABLE TO THE FULL SET OF CONTRACT SYMBOL DESCRIPTION A — 1. PRE-FAB SHOWERS AND BATHTUBS SHALL BE SET IN BEDDING DOCUMENTS. EXISTING WORK TO BE REMOVED 1300 Wait Whitman Road, New York, 11747 COMPOUND. INSTALLATION SHALL BE PER THE FIXTURE MFR'S B. EXISTING CONDITIONS ARE TAKEN FROM FIELD OBSERVATIONS A p:(631)300-1010 RECOMMENDATIONS. SUB-FLOORS AT SHOWERS SHALL BE AND PRIOR CONSTRUCTION DOCUMENTS WHEN AVAILABLE. THE ® POINT OF CONNECTION owner/developer PATCHED TO MINIMIZE SIZE OF HOLE AT DRAIN BEFORE LOCATIONS SHOWN MUST BE CONSIDERED APPROXIMATE. OTHER INSTALLING BEDDING COMPOUND. SUCH WORK MAY EXIST, HOWEVER, LOCATION AND SIZE ARE NOT POINT OF DISCONNECTION Conifer Real - - SPRAY FOAM SHALL NOT BE USED AS BEDDING MATERIAL. - - 1000 University Avenue Suite 500 ISG B PESENTLY KNOWN. IT IS STRONGLY ENCOURAGED TO VISIT SITE Rochester, NY 14607 2. ADA COMPLIANCE - WATER CLOSET AND URINAL HANDLES IN PRIOR TO BID TO REVIEW EXISTING CONDITIONS AND CONFIRM NTS NOT TO SCALE 585.3Y 14600 ADA APARTMENT OR STALLS SHALL BE MOUNTED ON THE SIDE SCOPE OF WORK. (E) EXISTING OF THE FIXTURE OPEN TO THE ROOM. C. WHEN EXISTING CONSTRUCTION IS DAMAGED DURING WORK BY (ETR) EXISTING TO REMAIN C. GAS PIPING' THIS CONTRACTOR, REPAJR AND/OR REPLACE WITH SIMILAR AFF ABOVE FINISHED FLOOR civil engineer MATERIALS AS MUCH AS POSSIBLE, SUBJECT TO ARCHITECTS BFF BELOW FINISHED FLOOR LKMA 0 1. PROVIDE A PIPE NIPPLE THRU EQUIPMENT CASE FOR CONNECTION APPROVAL. VTR VENT THRU ROOF 437&405 / Pry TO CORRUGATED STAINLESS STEEL TUBING (CSST) & GAS FLEX South Count Road LINES PER CODE. CSST & FLEX CONNECTORS SHALL NOT EXTEND r o io Sao o D. DISPOSE OF ALL DEMOLITION AND/OR OTHER WASTE MATERIALS GC GENERAL CONTRACTOR Brookhaven,NY 11719 C) THRU EQUIPMENT CASES. CAUSED BY WORK OF THIS CONTRACTOR. LEGALLY DISPOSE ALL MC MECHANICAL CONTRACTOR 631.286.8668 � MATERIALS TO A LOCATION OFF SITE. PC PLUMBING CONTRACTOR BLDG. 2. CSST INSTALLATION SHALL REQUIRE CALCULATIONS FROM P.C. TO E. COORDINATE AND SCHEDULE WORK AND SHUTDOWNS WITH THE EC ELECTRICAL CONTRACTOR m.e.p. &f.p. VILLAGEBCS B VERIFY ACCEPTABLE CSST LINE SIZES. SIZES SHOWN ON PLANS OWNER AND OTHER TRADES PRIOR TO DEMOLITION. (E) EXISTING PIPING M E Engineering, P.E. B SO ARE BI�JrG)A ARE IRON PIPE SIZES. 150 North Chestnut Street F. ALL EXISTING PIPING TO REMAIN SHALL BE RECONNECTED TO NEW PIPING LOCATED ABOVE FLOOR/SLAB B .o b, Bm D 3. CSST INSTALLATIONS SHALL BE GRDUNDED AND BONDED PER CODE ACTIVE SERVICE PIPING. — NEW PIPING LOCATED BELOW FLOOR/SLAB Rochester, NY 14604 BACK TO ELECTRIC SERVICE GROUIJD. 585.288.5590 As , G. ALL PIPING TO BE REMOVED, SHALL BE REMOVED BACK TO ACTIVE COLD WATER PIPING (CW) FIRE PUM 4. EVERY CSST INSTALLER SHALL HA/E PROOF THAT THEY HAVE PIPING AND CAPPED. VALVE AND CAP ALL WATER PIPING. REMOVE HOT WATER PIPING (HW) BEEN TRAINED TO AN ACCEPTABLE LEVEL BY THE MFR OF THE structural engineer HOUSE CSST BEING INSTALLED. ALL INACTIVE PIPING UNLESS NOTED. ••• HOT WATER RECIRCULATING PIPING (HWR) O 140--- 1400 HOT WATER PIPING (HW) TDM Consulting Engineerin SEE SPE o O H. ALL PIPING TO BE REMOVED AND LOCATED WITHIN A WALL TO 550 North County Road,Suite AN MAY BE ABANDONED IN PLACE UNLESS NOTED. REMOVE —140 ---- 1400 HOT WATER RECIRCULATING PIPING (HWR) Saint James, NY 11780 SB THE EQUIPMENT EXTENDED TO THE OUTSIDE WITH A VENT ELBOW. PIPING BACK TO BEHIND THE FINISHED WALL SURFACE AND CAP. TW TEMPERED HOT WATER PIPING (TW) 631.686.5234 LE VENT LIMITORS SHALL NOT BE USED IN PLACE OF VENT PIPING. TWR TEMPERED HOT WATER RETURN PIPING (TWR) OFFICE 6. ALL EXTERIOR GAS PIPING INSTALLED BY THE P.C. SHALL BE PAINTED. I. PATCH HOLES IN EXISTING CONSTRUCTION LEFT BY THE REMOVAL W WATER SERVICE - EXTERIOR --- BLDG D ARCHITECT TO SELECT COLORS. OF PIPING OR EQUIPMENT WITH MATERIALS TO MATCH EXISTING BLDG.T CONSTRUCTION. MAINTAIN FIRE/SMOKE RATING. SAN SANITARY SEWER PIPING o (TYPED) GW GREASE WASTE PIPING (GW) • 7. ROOF MOUNTED GAS PIPING SHALL NOT BE VISIBLE FROM GRADE. key .a TOP OF PIPE SHALL NOT BE MORE THAN 12" ABOVE THE ROOF EXCEPT J. DEMOLITION SHALL INCLUDE, BUT NOT BE LIMITED TO PIPING, AW ACID WASTE PIPING (AW) WHERE NOTED OR WHERE NECESSARY TO CONNECT TO EQUIPMENT. VALVES, FIXTURES, EQUIPMENT, HANGERS, SUPPORTS, AND T BMA INSULATION EXCEPT ASBESTOS. IW INDIRECT WASTE PIPING OW) 1111111. TRUE �• D. ALL CLEANOUTS SHALL BE WALLPLATE TYPE UNLESS OTHERWISE K. REMOVE EXISTING CONSTRUCTION IN THE WAY OF NEW WORK. -- VENT PIPING C INDICATED ON DRAWINGS. PROTECT BUILDING AND FURNISHINGS FROM DAMAGE. ST STORM WATER SEWER PIPING (ST) C - E. ROOF PENETRATIONS= G NATURAL GAS PIPING (G) L. WHERE NEW WORK IS TO BE INSTALLED ABOVE AN EXISTING D ELBOW DOWN v 131 1. PROJECTS WITH PITCHED ROOFS SHALL HAVE ALL PLUMBING CEILING, PROVIDE FOR THE REMOVAL OF THE CEILING. UPON � 45°OFFSET AND EQUIPMENT INTAKES & VENTS THROUGH ROOFS COMPLETION OF WORK REPAIR ALL DAMAGED CEILING SURFACES • - VENTS, � � •�,• SITE PLAN LOCATED BEHIND THE RIDGE LINE AND SHALL NOT BE VISIBLE REPLACE ALL DAMAGED TILES. —� ELBOW UP FROM THE FRONT OF THE BUILDING. M. SLEEVE AND SEAL ALL WALL AND FLOOR PENETRATIONS. PROVIDE e BOTTOM/TEE CONNECTION P-001 FIRESTOPPING FOR ALL PENETRATIONS. —�— TOP TEE CONNECTION ° 2. ROOF PENETRATIONS SHALL BE MADE AT LEAST 5 FEET AWAY, 00 "P" TRAP MEASURED HORIZONTALLY, FROM ROOF VALLEYS ON PITCHED N. MAINTAIN SERVICE CLEARANCES OF ALL EQUIPMENT. ADVISE OTHER ROOFS AND 5 FEET UPHILL FROM ROOF DRAINS ON FLAT ROOFS. TRADES OF THE REQUIRED SERVICE CLEARANCES. � PIPE CONTINUATION ° � CAP OR PLUG GAS LOAD - DESIGN BASIS - BUILDING A F. ENERGY CONSERVATION: 0. PROVIDE FOR THE DRAINING AND REFILLING OF PIPING SYSTEMS, — DECK PLATE CLEANOUT (DPCO) project FIRE PROTECTION SYMBOL LIST INPUT BTUH/ 1. ALL WALL & FLOOR SURFACE PENETRATIONS IN APARTMENTS, INCLUDING AIR REMOVAL, RESETTING OF FLUSH VALVES, FLUSHING —c-II WALL PLATE CLEANOUT (WPCO) EQUIP. NO. DESCRIPTION QUANTITY TOTAL BTUH COMMENT INCLUDING THOSE BEHIND ESCUTCHEONS, SHALL BE SEALED SYSTEMS OF DIRT AND SCALE CAUSED BY SHUTDOWNS AND —�I CLEANOUT (CO) VINEYARD VIEW SYMBOL DESCRIPTION UNIT TO COMPLY WITH PRESSURE TESTING FOR ENERGY EFFICIENCY. STARTUPS. EXISTING WORK TO BE REMOVED DWH-1 WATER HEATER5 38,000 190,000 ® FLOOR DRAIN (FD) / FLOOR SINK (FS) 2. ACCESS DOORS IN APARTMENTS SHALL BE GASKETED TYPE P. REFER TO EQUIPMENT/ FIXTURE SCHEDULE FOR FINAL CONNECTION @ROOF DRAIN D ® POINT OF CONNECTION TO COMPLY WITH PRESSURE TESTING FOR ENERGY EFFICIENCY. SIZES. c� WALL HYDRANT (WH) / HOSE BIBB (HB) TOTAL CONNECTED LOAD 190,000 BTUH p ® POINT OF DISCONNECTION 190 CFH - CONN. LOAD G. INSULATION SCOPE: PEX MANIFOLD Q. PROVIDE CLEANOUTS AT THE BASE OF ALL STORM, SANITARY 1,71 STRAINER AND WASTE STACKS. Q WATER METER County Road 48 NTS NOT TO SCALE 1. INSULATE ALL COLD WATER PIPING FROM THE WATER SERVICE Greenport, NY 11944 ENTRANCE TO THE INLETS OF THE PEX MANIFOLDS. R. PITCH 4" AND LARGER SANITARY AND WASTE PIPING AT %g" PER ® CATCH BASIN seal (E) EXISTING FOOT UNLESS OTHERWISE NOTED. FOR SANITARY AND WASTE Q MANHOLE (ETR) EXISTING TO REMAIN GAS LOAD - DESIGN BASIS - BUILDING B 2. INSULATE ALL HOT WATER PIPING FROM THE WATER HEATER TO PIPING 3" AND SMALLER PITCH AT i/q" PER FOOT UNLESS Z SHUT OFF VALVE - AFF ABOVE FINISHED FLOOR INPUT BTUH/ THE INLETS OF THE PEX MANIFOLDS. OTHERWISE NOTED. BALANCING VALVE pF E Y EQUIP. NO. DESCRIPTION QUANTITY TOTAL BTUH COMMENT GC GENERAL CONTRACTOR UNIT S. COORDINATE LOCATION AND ELEVATION OF STORM AND SANITARY —int— CHECK VALVE A�� PN D N� MC MECHANICAL CONTRACTOR DWH-1 WATER HEATER10 38,000 380,000 3. INSULATE ALL HOT WATER RETURN PIPING. LATERALS AND WATER SERVICE WITH THE SITE CONTRACTOR. NO ALLOWANCE WILL BE MADE FOR ADDITIONAL COSTS DUE TO THE Y SOLENOID VALVE h�•�k BIFFP PC PLUMBING CONTRACTOR H. INSULATION SCOPE CENTRAL HOT WATER, NO PEX CONTRACTORS FAILURE TO COORDINATE TERMINATION POINTS. PRESSURE REDUCING VALVE EC ELECTRICAL CONTRACTCR TOTAL CONNECTED LOAD 380,000 BTUH THE PLUMBING CONTRACTOR IS RESPONSIBLE FOR THE FINAL RELIEF VALVE 1. INSULATE ALL COLD WATER PIPING FROM THE WATER SERVICE FC FLUSHING CONNECTION 380 CFH - CONN. LOAD ENTRANCE TO BRANCHES FOR THE UNITS, AND THE FIRST 10 FEET CONNECTION TO THE SITE UTILITIES. $ SHUT-OFF SWITCH • f "" (E) EXISTING PIPING OF THE BRANCH PIPING. X697� T. MINIMUM SIZE OF WASTE PIPING BELOW SLAB SHALL BE 3" EXCEPT PIPE ANCHOR � ��,4, NEW PIPING GAS LOAD - DESIGN BASIS - BUILDING C 2. INSULATE ALL HOT WATER PIPING FROM THE WATER HEATERS TO PIPING SERVING FLOOR DRAINS SHALL BE 4". MINIMUM SIZE OF VENT = PIPE GUIDE ��ESSl®N FP FIRE PROTECTION SERVICE (FP) THE BRANCHES FOR THE UNITS, AND THE FIRST 10 FEET OF THE PIPING BELOW SLAB SHALL BE 2". —1�1 UNION INPUT BTUH/ BRANCH PIPING. 1177 E S SPRINKLER MAIN/BRANCH PIPING (S) EQUIP. NO. DESCRIPTION QUANTITY UNIT TOTAL BTUH COMMENT ®!I— BACKFLOW PREVENTER (BFP) E issued date description D SPRINKLER DRAIN PIPING (D) DWH-1 WATER HEATER 10 38,000 380,000 3. INSULATE ALL HOT WATER RETURN PIPING. ►F-- SHOWER HEAD D ELBOW DOWN SHOCK ABSORBER (SA) 1 03/14/19 Issued for Construction OFF-SET TOTAL CONNECTED LOAD 380,000 BTUH RECIRCULATION-�� TTHERMOMET RPUMP 0 EL � ELBOW UP LOAD BOTTOM/TEE CONNECTION 380 CFH - CONN. -= O PRESSURE GAUGE —v— TOP TEE CONNECTION PIPE CONTINUATION 3 FLUSHING CONNECTION GAS LOAD - DESIGN BASIS - BUILDING D • PENDENT SPRINKLER HEAD EQUIP. NO. DESCRIPTION QUANTITY INPUT BTUH/ TOTAL BTUH COMMENT >r DRY PE=NDENT SPRINKLER HEAD UNIT WATER HEATER SCHEDULE x QUICK (RESPONSE PENDENT SPRINKLER HEAD DWH-1 WATER HEATER5 38,000 190,000 GALLONS/ �� CONCEALED PENDENT SPRINKLER HEAD BTUH TEMP RISE VENT IN O RESIDENTIAL PENDENT SPRINKLER HEAD N0. SERVICE TYPE INPUT HOUR DEG F FUEL TYPE INCHES ELECTRIC DESIGN MAKE TOTAL CONNECTED LOAD 190,000 BTUH RECOVERY o UPRIGHT SPRINKLER HEAD 190 CFH - CONN. LOAD DWH-1 DOM TANK 39,000 41.5 90 NG 3 - GAINT UG40-38TFPDV1-N2U F QUICK (RESPONSE UPRIGHT SPRINKLER HEAD DWH-2 DOM TANK - 18.5 100 ELEC - 240 A.0 SMITH PNT-55 1F A SIDEWALL SPRINKLER HEAD FIXTURE SCHEDULE A DRY SIDEWALL SPRINKLER HEAD BATHROOM o RESIDENTIAL SIDEWALL SPRINKLER HEAD DESCRIPTION LOCATION SK ASSORTED REMARKS WC LAV BT/SH FD PUMP SCHEDULE ® EXTENDED COVERAGE SDEWALL SPRINKLER HEAD TYPICAL APARTMENT TYPICAL WC-A LAV-A BT-A - SK-A - A VERTICAL SIDEWALL SPRINKLER HEAD HEAD FT MOTOR ►� BACK TO BACK ATTIC SPRINKLER HEAD APARTMENT, ADA WC-B LAV-B SH-A FD-A SK-B - N0. LOCATION SERVICE GPM WATER HP VOLTAGE PHASE RPM TYPE DESIGN MAKE title W/ SHOWER 0 SINGLE DIRECTIONAL ATTIC SPRINKLER HEAD COMMUNITY RM - - - - SK-C - BP-1 CB DOMESTIC 250 130 15 208 3 - ELEC GRUNDFOS MPC-E 2CR45-2 9 HIP ATTIC SPRINKLER HEAD LAUNDRY RM - - - FD-A SK-D WMF FP-1 PUMP HOUSE FIRE 1500 140 86 200 3 1760 DIESEL ARMSTRONG HSC-8x6x15NF-8 SCHEDULES --�— DRAIN VALVE PUBLIC TOILET RM WC-C LAV-C - FD-A RCP-1 - DHW RECIRC 2 12 1/25 120 1 - INLINE GRUNDFOS UP15-18 B5 SYMBOLS --T�- CHECK VALVE CORRIDOR - - - - - EWC-A - - - - - - - - - - - PRESSURE REDUCING VALVE JANITOR'S CLOSET - - - - - MB-A NOTES RELIEF VALVE ® BACKFLOW PREVENTER (BFP) PLUMBING SHUT-OFF VALVE WITH TAMPER SWITCH (TS) SHOCK ABSORBER SCHEDULE FLOW 'SWITCH (FS) GFIXTURE CONNECTION SCHEDULE - COMMUNITY BLDG FIXTURE AND EQUIPMENT CONNECTION SCHEDULE PRESSURE SWITCH (PS) NO FIXTURE UNIT SIZE IN PDI SYMBOLQ + drawn by: NAJ DRY PRE-ACTION ALARIV VALVE RATING INCHES DESIGNATION DESCRIPTION COLD HOT WASTE OR VENT REMARKSCOLD HOT WASTE OR WATER WATER SANITARY DESIGNATION DESCRIPTION VENT REMARKS ® ALARM CHECK VALVE WITH TRIM (ACV) SA-A 1 - 11 1/2" A WATER WATER SANITARY y. SK SINK 1/2" 1/2" 2" 1 1/2" checked b NAJ FIRE DEPARTMENT VALVE (FDV) SA-B 12 - 32 3/4" B LAV LAVATORY 1/2" 1/2" 1 1/2" 11/2" SK SINK 1/2" 1/2" 2" 1 1/2" POST INDICATOR VALVE (PIV) SA-C 33 - 60 1" C LAV LAVATORY - WET VENT 1/2" 1/2" 2" 11/2" LAV LAVATORY 1/2" 1/2" 11/2" 1 1/2" scale: - WATER MOTOR GONG SA-D 61 - 113 1 1/4" D WC WATER CLOSET - 1/2" 3" 2" LAV LAVATORY - WET VENT 1/2" 1/2" 2" 1 1/2" V FIRE DEPARTMENT CONFECTION (FDC) EWC ELEC. WTR. COOLER - 1/2" 1 1/2" WC WATER CLOSET - 1/2" 3" 2"1 1/2" project number: 10002 SA-E 114 - 154 1 1/2" E WMF WASH. MACH. FITTING 1/2" 1/2" 2" 1 1/2" '�' FIRE PUMP TEST HEADER SA-F 155 - 330 2" F MB MOP BASIN 3/4" 3/4" 3" 1 1/2" BT BATHTUB 1/2" 1/2" 1 1/2" 1 1/2" scaled inch f INSPECTOR'S TEST CONNECTION (ITC) SHR SHOWER 1/2" 1/2" 2" 1 1/2" sheet number Ad FIRE HYDRANT (FH) NOTES= ® FIRE HOSE CABINET -SIZES SHOWN ARE MINIMUMS. SIZES ON PLANS MAY BE LARGER. NOTES: © FIRE VALVE CABINET -SIZES SHOWN ARE MINIMUMS. SIZES ON PLANS MAY BE LARGER. BUILDING A ® IFIRE EXTINGUISHER 41 + 61 + + 9 H P -000 � a ENGiNEERiNG Mechanical/Electrical Engineering Consultants ® r.� M/E Project#170412 Rochester I Buffalo I Syracuse I Schenectady 150 N.CHESTNUT ST. 585.288.5590 ROCHESTER NY 14604 www.meengineedng.com BEATTY HARVEY COCO ARCHITECTS , LLP M3 NEW YORK I MARYLAND s � � �a A, � 1300 Walt Whitman Road, New York, 11747 A p:(631)300-1010 -� owner/developer BLDG. 1 Conifer Realty (TYPE C) 1000 University Avenue Suite 500 Rochester, NY 14607 585.324-0500 civil engineer LKMA 437&405 South Country Road Brookhaven, NY 11719 631.286.8668 NDBANKED m.e.p. &f.p. PARKING WE Engineering, P.E. 150 North Chestnut Street Rochester, NY 14604 585.288.5590 0 0 structural engineer TDM Consulting Engineering 550 North County Road,Suite Saint James,NY 11780 • 5 ' 631.686.5234 BLDG.2 key ® (TYPE B) TRUE NORTH � y � 4C ■ IM■ Q O o ,p0 � Ca x Ih O O`Q y, 0 00 O 0\1 0 O0O0 ` project VINEYARD VIEW BLDG. 3 91� (TYPE B) I D VILLAGE BLDG.4 County Road 48 SQUARE (TYPE A) Greenport, NY 11944 s seal BLDG.6 _ ltilo .•' (TYPE D) OF 141-vv DA ) .y Go ' ? >� r i 'tl l j 4jti 4 i II �� 69713 4J. F - 1 0 0 r issued date description o L DANK _COMMUNITY P 1 03/14/19 Issued for Construction CENTER& LEASING ` OFFICE BLDG. 7 P — 1 0 (TYPE D) s ti .1 F I BLDG.5 Fk M (TYPE A) C 1 O O title FIRE & BOOSTER PUMP PLAN drawn by: NAJ checked by: NAJ scale: - project number: 10002 PUMP SCHEDULE scaled inch HEAD FT MOTOR sheet number N0. LOCATION SERVICE GPM WATER HP VOLTAGE PHASE RPM TYPE DESIGN MAKE 8P-1 CB DOMESTIC 250 130 15 208 3 - ELEC GRUNDFOS MPC-E 2CR45-2 BUILDING A FP-1 PUMP HOUSE FIRE 1500 140 86 200 3 1760 DIESEL ARMSTRONG HSC-8x6x15NF-8 RCP-1 - DHW RECIRC 2 12 1/25 120 1 - INLINE GRUNDFOS UP15-18 B5 11 21 + 41— + + + + g H P -0 . 02 Zt- ENGiNEERiNG Mechanical/Electrical Engineering Consultants i l J M/E Project#170412 "W Rochester I Buffalo I Syracuse I Schenectady 150 N.CHESTNUT ST. 585.288.5590 ROCHESTER,NY 14604 www.meengineenng.com a,rt Y+ea w1Tim BEATTY HARVEY COCO ARCHITECTS , LLP GENERAL NOTES. NEW YORK I MARYLAND A. COORDINATE ALL SANITARY / DOMESTIC WATER 13 alt h tman oad, New York, 11747 P: (631)300-1010 /FIRE PROTECTION AND NATURAL GAS CONNECTION WITH SITE PLAN. owner/developer PLUMBING SCOPE TO END 5'-0" OUTSIDE THE BUILDING Conifer Realty 1000 University Avenue Suite 500 Rochester, NY 14607 DRAWING NOTES. 585.324-0500 911 3" SAN STACK UP TO SECOND FLOOR civil engineer • O 3" SAN UP TO WC LKMA 437&405 10 ® O 3" PTRAP UP TO FD ut Country oa Brookhaven, NY 11719 3 ® ® 2" SAN STACK UP TO SECOND FLOOR 631.286.8668 I O 2" SAN UP TO SK m.e.p. &f.p. I ® © 2" P-TRAP UP TO SH / FD M/E Engineering, P.E. 11k150 North Chestnut Street t ` Rochester, NY 14604 3" � I O7 1 %2 P-TRAP UP TO BT 585.288.5590 L ( I ® 1 %2" WET VENT UP TO SK ® O9 2" VENT UP structural engineer ® TDM Consulting Engineenn U1 ( I 10 WATER SERIVCE UP TO METER 550 North County Road,Suite ®: Z ® Saint James, NY 11780 !ys' 11 FIRE SERVICE UP TO BACKFLOW DEIVCE / METER 631.686.5234 ® G-� 12 2" NATURAL GAS MAIN UP 1 12 p� 7 OC 771 LLI �I _- 7 OC 6 key 10! /Y\ S TRUE :1 2" NORTH 2 1 6 O O 6 $ E Gn 2 + B O 2" 2" 0 o O ' �o 2" OC 0 � 0 � 2�� C P o I iO rA 4 4 3" „ O3" 5 project ' 3 3 VINEYARD VIEW u i OE A OE 4 3 - D1 3�� 5 'I A 717D SAN SAN II �h LA IIIIIISAN SAN Y C 0 County Road 48 2„ Greenport, NY 11944 311 seal C OF F�V �t� CPN 1 ANhF Co fu 4" F 06 971 E I �Q� r issued date description 5P + 1 03/14/19 Issued for Construction O C O O OC O �D �D �D YCO � � D D 13 13 title BUILDING A UNDERGROUND FLOOR PLAN PLUMBING UNDERGROUND FLOOR PLAN -PLUMBING drawn by: NAJ SCALE: 114"=1'-0" checked by: scale: AS NOTED project number: 10002 scaled inch sheet number BUILDING A 4 ` ENGiNEERNG Mechanical/Electrical Engineering Consultants J D M/E Project#170412 ' Rochester I Buffalo I Syracuse I Schenectady 150 N.CHESTNUT ST. 585.288.5590 d t. t. M q , ROCHESTER,NY 14604 www rneengineering.com L s ,ar,7 1 ,7 7 n 4 BEATTY HARVEY COCO !� ARCHITECTS , LLP NEW YORK � MARYLAND P200 P503 P200 P200 1300 Walt Whitman Road, New York, 11747 p: (631)300-1010 owner/developer Conifer Realty 1000 University Avenue Suite 500 Rochester, NY 14607 GENERAL NOTES: 585.324-0500 A. REFER TO RISER DIAGRAMS ON P-200 FOR WASTE PIPING. civil engineer B. COORDINATE ALL CONNECTIONS TO THE WATER HEATERS LKMA IN MECHANICAL ROOMS. 437&405 ® WH ® South Country Road Brookhaven,NY 11719 ® � ® 631.286.8668 1 ( lI M� Engineering, P.E.4 DRAWING NOTES: North Chestnut P200 ® Rochester NY 14604 L P 2 0 0 1 3" SAN STACK AND 2" VENT UP. 585.288.5590 I 2" SAN STACK AND 2" VENT UP. structural engineer ® ® 1 %2" VENT UP. TDM Consulting Engineering 4 3 NATURAL GAS MAIN ® UP. 550 North County Road,Suite E® O Saint James, NY 11780 O5 3/q" COLD WATER SUPPLY DOWN TO WALL HYDRANT. 631.686.5234 n ® © 3/4" COLD WATER SUPPLY DOWN TO WATER HEATER. ------ C 1 77 )14" COLD WATER SUPPLY UP TO WATER HEATER. • O � - C -------- key ® 4" NATURAL GAS DOWN TO WATER HEATER. ® 4 O9 RUE REFER TO DETAIL 2/P500 FOR NATURAL GAS METER INSTALLATION. N RTH E E o gE 0B FO o Og 7 7 1 5 • 3 5 ° Oo WH - - -- - 70 6 ' C C C __ project $ 7 i VINEYARD VIEW i i I a ' 2 E A E _ I A O --- '� O 2 D 12 j j + County Road 48 Greenport, NY 11944 seal r Eissued date description 1 03/14/19 Issued for Construction O II OC O D D FDC D p title 6 BUILDING A 8 9 6 P200 P200 P200 P200 FIRST FLOOR PLANPLUMBING FIRST FLOOR PLAN -PLUMBING –� drawn by: NA-1 SCALE: 1/4"=1'-0" checked by: NAJ scale: AS NOTED project number: 10002 scaled inch sheet number BUILDING A 1� + + +4 +– +6 7T +8P — 1 H • 09 9- ' r ENGiNEERiNG Mechanical/Electrical Engineering Consultants M/E Project#170412 Rochester I Buffalo I Syracuse I Schenectady 150 N.CHESTNUT ST. 585.288.5590 ROCHESTER NY 14604 www.meengineenng.com aars +iaa bi wdF^e�F!e` w� ueR A BEATTY HARVEY COCO A 7 4 7 ARCHITECTS , LLP NEW YORK � MARYLAND P200 P503 P200 P200 1300 Walt Whitman Road, New York, 11747 p:(631)300-1010 owner/developer Conifer Realty 1000 University Avenue Suite 500 Rochester, NY 14607 585.324-0500 civil engineer ® ® LKMA GENERAL NOTES. South Country Road ® ® 1719 A. NATURAL GAS PIPING ROUTED IN THE ATTIC SPACE. Brookhaven,NY .8668 11 1 631.286.8668 - I I B. REFER TO RISER DIAGRAMS ON P-200 FOR WASTE PIPING. m.e.p. &f.p. 4 C. COORDINATE ALL CONNECTIONS TO THE WATER HEATERS M/E Engineering, P.E. I I El IN MECHANICAL ROOMS. B 150 North Chestnut Street P 2 0 0 El- I � Rochester, NY 14604 ! P200 D. DOMESTIC WATER PIPING SHALL NOT BE ROUTED IN THE ATTIC SPACE. 585.288.5590 E. WATER HEATER INTAKE AND EXHAUST VENTS SHALL ® _—_—i ® BE ROUTE THRU THE ROOF. structural engineer TDM Consulting Engineenn ------- f 550 North County Road,Suite )IF Saint James, NY 11780 DRAWING NOTES: 631.686.5234 —ZA O1 2" VENT DOWN +-211 4 ( 1 %2" VENT DN � 2" �--"--- = �C -- ----� G -------- �3 4" VENT THRU THE ROOF 1„ G G E 2�� 3 ® 2" NATURAL GAS MAIN DOWN. r RUE 0�, 1.. , C "---"— B ' —_—"—" O5 3/4" COLD WATER SUPPLY DOWN NORTH • +-2110 B i © 3/4" COLD WATER SUPPLY TO WATER HEATER. --------� 2�� 5 j— ----------- --------- ------------- ---� 704" NATURAL GAS DOWN TO 1ST AND 2ND FLOOR WATER HEATERs. °---- --- --- - —° s 2�� g I i g E I „ 0 , e�■ - - ------- 5 -��---- --- - -� C _ --- Q g ��----- -- 1 0 4 +-211 7I --- --- -�--� ------ project 00 ; ---------- I ------ - 1 - 1 ! ! 4„ ! VINEYARD VIEW 1 I ---- }------- ------ -----J B �------------- 211 --- 17 – – – A 0 1 - p - - O 1 - t A 1 ! ! + Count Road 48 E I Y I Greenport, NY 11944 OC , seal --- -- --- -� pF E 1v nyD��S51C)\ IE issued date description I1 03/14/19 Issued for Construction 4 xa/rocha Submission OE ® ' OE 5 xa/xx/xx Submission 6 xx/xxha Submission IF �D � Fp title 6 BUILDING A 8 g 6 P200 P200 P200 P200 SECOND FLOOR PLANPLUMBING � SECOND FLOOR PLAN -PLUMBING - drawn by: NAJ SCALE: 114"=1'-0" checked by: NAJ scale: AS NOTED project number: 10002 scaled inch sheet number _ BUILDING A H + T + �}I + + g1 g H 1 . 02 ENGiNEERiNG Mechanical/Electrical Engineering Consultants M/E Project#170412 Rochester I Buffalo I Syracuse I Schenectady 150 N.CHESTNUT ST. 585.288.5590 } # 'ij �e ROCHESTER NY 14604 www.meengineedng.com 141 BEATTY HARVEY COCO A R C H I T E C T S , L L P NEW YORK I MARYLAND A 1300 Walt Whitman Road, New York, 11747 p:(631)300-1010 owner/developer Conifer Realty GENERAL NOTES. 1000 University Avenue Suite 500 Rochester, NY 14607 585.324-0500 A. LOCATE ROOF PENETRATION OUT OF SITE FROM THE FRONT OF THE BUILDING. civil engineer LKMA 437&405 DRAWING NOTES. South Country Road Brookhaven,NY 11719 + 4" VENT THRU ROOF 631.286.8668 m.e.p. &f.p. B + 3" WATER HEATER EXHAUST AND INTAKE. M/E Engineering, P.E. 150 North Chestnut Street Rochester, NY 14604 585.288.5590 structural engineer TDM Consulting Engineerin 550 North County Road,Suite Saint James,NY 11780 631.686.5234 key 1 TRUE NORTH 4C ■ z�! Q 0 project VINEYARD VIEW County Road 48 Greenport, NY 11944 seal OF N /1 Y0 r ' lif w �C9.7 issued date description 1 03/14/19 Issued for Construction 4 xaha/roc Submission 5 xx/xa/xa Submission 6 xaha/xa Submission F title BUILDING A ROOF PLAN PLUMBING ROOF PLAN-PLUMBING drawn by: NAJ P-1.Q3 SCALE: 114"=1'-0" checked by: NAJ scale: AS NOTED project number: 10002 scaled inch sheet number BUILDING A H + 21 + + +5 + 7I +- 9 H • 11 21 31 41 �1 61 7 1 8 1 ENGNEERNG D) ni Mechanical/Electrical Engineering Consultants 1r%'% M/E Project#170412 Rochester I Buffalo I Syracuse I Schenectady 150 N.CHESTNUT ST. 585.28�1.5590 ROCHESTER NY 14604 www.meengineering.com 4 1:4�24 V 1-3 4" VENT THRU ROOF L 4" VENT THRU ROOF 4" VENT THRU ROOF BEATTY HARVEY COCO PAINT EXPOSED VENT & ARCHITECTS , LLP FLASHING, COLOR AS PAINT EXPOSED VENT & /- PAINT EXPOSED VENT & NEW YORK I MARYLAND I;� SELECTED BY ARCHITECT FLASHING, COLOR AS FLASHING, COLOR AS 1300 Wait Whitman Road, New York, 11747 A SELECTED BOLO SELECTED BY ARCHITECT ATTIC ATTIC ATTIC ATTIC - A p:(631)300-1010 owner/developer er ty 1000 University AConifReal venue Suite 500 Rochester, NY 14607 585.324-0500 ----------- ------ -------------------- -- -------- ------ civil engineer r------ -------- 1�2 + 1 X2 2 '/2 ��21 + V2 311 11/2114 • GAS 4-11/211 3" 1 311 LKMA 1 1 V2 Y211-4' 437&405 dl I ILLAV-1 /2 WATER ii-AV LAV-1 I LAV- 1 1/211 South Country Road HEATER X2 L X2" L Brookhaven,NY 11719 WC LAV TUB/SHR SK 631.286.8668 1 'ItY2" APARTMENT '/2 ------- V2 211 ISOLATION WC 1 2"', rWC I I -211 211 m.e.p. &f.p. VALVE I �i� Bi I IBIT X2 11 1 1 M2" B M/E Engineering, P.E. B- F-3 J '/2 1y2-- Bf 2nd FLR- 2ND FLR X2 11 311 1 -3 1 X2 2nd FLR 150 North Chestnut Street 2nd FLR 2 ISL--,.k -3 X2" 2nd FLR F T r C J Rochester, NY 14604 Y2 —1/2" 1/2 *-ii I ii Iii �4ii rCiW MAIN 41 N 585.288.5590 -Y211 1/2 -J ItY2.. APARTMENT structural engineer ISOLATION TDM Consulting Engineering 11 H VALVE -------------- 550 North County Road,Suite E X2' 1 Saint James, NY 11780 1/21,A SH-ADA X2' 1 - --1 A- Y21, /2 X2 631.686.5234 1/211 f X2" 1 1 1 GAS X2 '-Y211 WATER X2 Y2"- 4- 1 1 X2" X2 I L HEATER 11/211 J ( L 1 '/2 1 L Y211 I X2 11 /2 11 1/211 1 Y2" X2" 1 11 �E X2" 11 1 '/2 X2 X2 Cn Y2 3 1 311 I i-7 key I WC cn WC TRUE 216 rLA WC LAV TUB/SHR SK 211 211- 2" I WC WC I J 'V-T V2"-, i 1st F WPCO LAV ED 21 1J� LAV WPCO LAV f/2 it WPCO LAV E Y2 NORTH C r-3 1st FLR 1ST FLR 1st FLR ------ 311 F-3 LR 3 11 17 ! - -/ 1st FLR -J GENERAL NOTES: GENERAL NOTES: GENERAL NOTES: GENERAL NOTES: A. DRAINS A. THIS DIAGRAM BASED ON THE USE OF COPPER PIPING. REFER TO DETAIL 1/P501 FOR TYP UNIT PEX PIPING. SEE HCR PEX PIPING DETAIL IF PEX IS TO BE USED. A. DRAINS: A. DRAINS REFER TO DETAIL 1/P501 FOR TYP UNIT PEX PIPING. REFER TO DETAIL 1/P501 FOR TYP UNIT PEX PIPING. B. PROVIDE SHOCK ABSORBERS ON HOT AND COLD WATER BRANCH LINES IN ACCORDANCE WITH THE SHOCK ABSORBER SCHEDULE ON THE DRAWINGS AND MANUFACTURERS y �JAV rLA-V Eon RECOMMENDATIONS. project BATHROOM ADA 2 WATER RISER DIAGRAM TYP 3 BATHROOMS SIDE BY SIDE 4 BATHROOMS SINGLE VINEYARD VIEW P200 P200 P200 D SCALE: NONE SCALE: NONE SCALE: NONE SCALE: NONE D County Road 48 Greenport, NY 11944 seal OF E DA ATTIC ATTIC 0-�G-= ATTIC 04�G--7 ATTIC ATTIC G10 EXTEND TO-\ EXTEND TO-� 1 K2" VENT EXTEND WATER HEATER T EXTEND WATER HEATER T 1st 17LR EXTEND TO--� MAIN VENT MAIN VENT INTAKE AND EXHAUST Y2 GAS INTAKE AND EXHAUST '/2 13AS BATHRODM MAN VENT <�' TO THE ROOF TO THE ROOF VENT SFACK ---------- ........ ---------- -------- 0 ---------r -------- V I 1 WTR 771 E - `I 211 41-211 HTR I HTR &-211 issued date description HTR G 40 GAL. SK S 1 40 S GAL. 1 03/14/19 Issued for Construction 5E 1Y2" 71 SK M2" GAS I GAS JJ L J I 4 I I4 3"� i 2" i ---CONDENSATE --CONDENSATE NEUTRALIZER T NEUTRALIZER X2 X2" [::] L-=l`,l1 I - --41 - 2nd FLR Y211 2nd FLR 2nd FLR 2nd FLR 2nd FLR \-3/411A F GAP 74 211 I VENT EXTEND WATER HEATER 1Y Y TO 1st FLR INTAKE AND EXHAUST 1 I I BATHROOM TO THE ROOF 1 I I VENT STACK 11/2 Y2"- <I zi Y4 Y2 J l WTR F - X2 1 '/2" V) HTR - F T4" 40 GAL. 2 SK JI/2 I GAS SK 0 SK 311y, SK J J title WPCO 1st FLR WPC 1st FLR 1st FLR WPCO r-3" r-3 1st FLR 1st FLR WPCO _Z111— J - RISER DIAGRAM IR GAP Fp I I i-J-1 1-11 11 1 Fil-ff 1-1►-1 11-1 L 211 211 211 PLUMBING GENERAL NOTES: GENERAL NOTES: GENERAL NOTES: GENERAL NOTES: GENERAL NOTES: A. DRAINS: A. DRAINS: A. DRAINS: A. DRAINS: A. DRAINS: REFER TO DETAIL 1/P501 FOR TYP UNIT PEX PIPING. REFER TO DETAIL 1/P501 FOR TYP UNIT PEX PIPING. TRAP COOLING CONDENSATE & VENT HEATING CONDENSATE TRAP COOLING CONDENSATE & VENT HEATING CONDENSATE REFER TO DETAIL 1/P501 FOR TYP UNIT PEX PIPING. UNLESS OTHERWISE REQUIRED BY EQUIPMENT MFR. UNLESS OTHERWISE REQUIRED BY EQUIPMENT MFR. drawn by: NAJ B. ROUTE ALL PIPING TO ALLOW REMOVAL OF EQUIPMENT OR B. ROUTE ALL PIPING TO ALLOW REMOVAL OF EQUIPMENT OR PROVIDE UNIONS IN PIPING TO ALLOW REMOVAL OF PROVIDE UNIONS IN PIPING TO ALLOW REMOVAL OF checked by: xxx EQUIPMENT WITHOUT CUTTING PIPING. EQUIPMENT WITHOUT CUTTING PIPING. C. PROVIDE AIR GAP BETWEEN CONDENSATE PIPING AND C. PROVIDE AIR, GAP BETWEEN CONDENSATE PIPING AND scale: 1'-0" FLOOR DRAIN. FLOOR DRAIN. project number: 10002 scaled inch sheet number SINK SIDE 13Y SIDE s SINK TWO STORY MECH ROOM s MECH ROOM s SINK - ONE STORY SCALE: NONE SCALE: NONE SCALE: NONE SCALE NONE SCALE: NONE SCALE NONE BUILDING A +2 +3 +4 +5 +6 +7 +8 4, H P 2 . 00 ENGiNEERiNG Mechanical/Electrical Engineering Consultants WE Project#170412 Rochester Buffalo I Syracuse I Schenectady 50 (C 150 N.CHESTNUT ST. 585.288.5590 ��;;; �t;01)' t)1.0 �,1-0 ACCESSPANEL ROCHESTER NY 14604 www.meengineenng.com i OF NOTES: MIN. 3' CLEARANCE, ( i DOOR SIZE CAMS 1. SIZES BASED ON ACUDOR MODEL AS-9000 SEE NOTE C � / I BEATTY HARVEY COCO VARIES 12 x 12 1 2. ADD 2 INCHES TO DOOR SIZE FOR ARC H I T E C T S , LLP 18 x 18 1 OUTSIDE DIMENSIONS OF FLANGES ❑°oloo❑ °°°�°°° NEW YORK I MARYLAND 24 X 24 1 000❑00 Z °°oo°° 1300 Walt Whitman 631 300-1010 York, 11747 BOLLARD 4'-0" MAX. 24 x 36 1 j eve owner/dlo er o - PLANi VIEW p PLAN VENT, RISE Conifer Realty ''o ( CONCEALED 1000 University Avenue Suite 500 IN WALL/CHASE. Rochester, NY 14607 3' CLEAR RADIUS, , 585.324-0500 SEE NOTE C _ �� I civil engineer BOLLARD n` LKMA FLOOR DRAIN 437&405 PRESSURE REG. o \�� WALL PENETRATION i i�T BLOCKING BETWEEN STUDS / JOISTS I TOP OF STRAINER FLUSH South Country Road MAIN VALVE I I I I w/ FINISHED FLOOR I I FOR SUPPORT ON ALL SIDES OF PANEL Brookhaven, NY 11719 j I I 631.286.8668 _________ __ I I TRAP PRIMER FINISHED FLOOR GAS METER I I ANCHOR MOUNTING TRIM ON ALL CONN. OPTION I FOUR SIDES TO STUD, JOIST OR BLOCKING m.e.p. &f.p. WE Engineering, P.E. U qt- i t�FINISHED SET FLANGE IN BEAD OF CAULK AND SEAL TO • • • • - treet � 150 NRoheter,NY 54604 SURFACE AIRTIGHT D• ' D• : • D• : D• : • D• : ! D• . D• D• D, 585.288.5590 ELEVATION I a I DETAIL NOTES: i I SCREWDRIVER OPERATED CAMLOCK structural engineer TDM Consulting Engineering A. P.C. SHALL COORDINATE WALL PENETRATIONS WITH THE GAS PROVIDER. I I 550 North County Road,Suite I 18 GA. STEEL DOOR & FRAME, WHITE ENAMEL -" CONDENSATE ::ff Saint.lames, NY 11780 B. P.C. TO PAINT ALL EXPOSED UTILITY AND P.C. INSTALLED PIPING, METER AND i ___________ INDIRECT WASTE 631.686.5234 REGULATOR. COLOR TO BE SELECTED BY ARCHITECT. I r- I I PRIME COAT W/ CONCEALED HINGE & CONNECTION I I I CLOSED CELL GASKET I I SANITARY PIPING, C. EXTEND PRESSURE REGULATOR VENT TO SAFE LOCATION WHERE OUTLET IS; JOIST OR I i SIZE PER PLANS LESS THAN 18 ABOVE GRADE, WITHIN 3'-0" OF SPARK SOURCE OR OPENING INTO BLDG., LESS THAN 10' FROM A TRANSFORMER OR 15'-0" FROM POWERED AIR INTAKE. ELEVATION key D. BOLLARD DETAIL NOTES: TRUE - PROVIDE BOLLARDS FOR ALL METERS ADJACENT TO DRIVEWAYS. NORTH SEE RESIDENTIAL BOLLARD DETAIL THIS DRAWING. DETAIL NOTES: A. PROVIDE TRAP GUARD FITTING. ° - PROVIDE ADDITIONAL BOLLARD(S) WHERE THE BOLLARD CENTERLINE DISTANCE EXCEEDS 3 FEET. SPACE ADDITIONAL BOLLARD(S) TO KEEP CENTERLINE A. ANCHOR INTERIOR MOUNTING FRAME TO STRUCTURE PER MFR. B. SEE SPECIFICATIONS FOR: DISTANCE BELOW 3 FEET. GRATE PATTERN - ROUND, SQUARE B. PROVDE BLOCKING WHERE THERE IS NO STRUCTURAL MEMBER TO ANCHOR OPTIONS - FUNNEL, TRAP PRIMER CONNECTION E. WALL PENETRATIONS INTERIOR MOUNTING FRAME. ro - NON-MASONRY WALL: PROVIDE COATING OR WRAP ON PIPING AT WALL C. SEE ARCHITECTURAL PLANS FOR FLOOR FINISHES AND SLOPES ■on 311 PENETRATION TO PREVENT CORROSION AND SEAL TO WALL WATERTIGHT. C. LATCH OPTIONS: CYLINDER LOCK ALLEN HEAD OR SPANNER HEAD LATCH EEL W/ SATIN FINISH D. DESIGN BASIS: J.R. SMITH *2005, 2010 OO SEAL TO WALL WATERTIGHT. FILL SPACE BETWEEN SLEEVE AND PIPE. ROUND OR SQUARE TOP, NICKEL BRONZE RIM AND ADJUSTABLE STRAINER ° �D1 - 2 GAS METER DETAIL - RESIDENTIAL 3 ACCESS PANEL DETAIL - GASKETED 4 FLOOR DRAIN DETAIL - W/ INDIRECT WASTE ° 5.0 SCALE: NONE 5.0 XXX SCALE: NONE 5.0 SCALE: NONE FLANGED W/ GASKET 5.0 SCALE: NONE project VINEYARD VIEW County Road 48 Greenport, NY 11944 seal �F N DA CW SOURCE BALL VALVE HWTR TR 19 7N UNION M f ��✓ COPPER TUBING, TYPE L, GAS PIPING T&P RELIEF VALVE INSULATED /4" CONNECTION E SEE PLANS E issued date description FOR SIZES 0 0 0 ADJUSTABLE 1 03/14/19 Issued for Construction 0 0 0 %2" PEX TUBING, WALL CLAMP SHUT-OFF VALVE, UNINSULATED FULL LINE SIZE MANIFOLD LOCATED IN UNIT, WITH ACCESS DOOR VACUUM BREAKER ADA WATER CLOSETS, �___I VALVE KEY FLUSHING MECHANISM o DRAIN PAN - -------- _ SHALL BE AT WIDE SIDE I OO OF STALL OR ROOM `r'FINISHED t , EXTEND DRAIN TO FD I LAV ; r 1 --- L J FLOOR K.SINK HIGH SUPPLY ROUGH-INF TO KEEP SUPPLY _ __ + ESCUTCHEON CLEAR ANCHOR FLANGE TO OF MOLDING UNION PROVIDE TEE & FUNNEL FOR 11 BATHTUB �� STRUCTURE & SEAL DIRT LEG, T&P RELIEF W/ AIR BREAK --------- PERIMETER OF FLANGE FULL LINE SIZE, AT CONNECTION TO WALL WATERTIGHT BASE MOLDING — — MIN. 6" LONG, W/ CAP title FIN. FLOOR8" MIN. DETAIL NOTE: WALL SECTION ELEVATION DETAILS DETAIL NOTES: A. PEX PIPING SHALL BE INSTALLED ONLY IN INDIVIDUAL DWELLINGS CAULK PERIMETER A. PROVIDE PIPE NIPPLE THRU EQUIPMENT CASE. B. MANIFOLD SHALL BE COPPER OR BRASS AND HAVE INDIVIDUAL BRASS PLUMBING TO FLOOR CSST & FLEX CONNECTORS SHALL NOT EXTEND THRU EQUIPMENT CASE. SHUT-OFF VALVES ON EACH LINE B. PROVIDE SHUT-OFF VALVE AND UNION AT EACH SUPPLY PIPING CONNECTION. C. ALL FIXTURES SHALL BE PIPED DIRECTLY FROM MANIFOLD C. P.C. IS RESPONSIBLE FOR FINAL CONNECTIONS D. THE CO NECTOI S OR UNIONS SHALL BE INSTALLED BETWEEN THE MANIFOLD AND RMID. THIS DETAIL IS GENERIC. WATER HEATER MFRS. INSTRUCTIONS ARE TO E. CONVECTORS SHALL BE BRASS WITH A COPPER OR BRASS, CRIMPED CLAMP RING. DETAIL NOTES: 0 BE FOLLOWED WHERE THEY DIFFER FROM THESE INSTRUCTIONS. SLIP FIT, PUSH FIT AND ADJUSTABLE STRAP CLAMP TYPES ARE NOY ACCEPTABLE. A. KEYLESS FITTING SHOWN. PROVIDE KEYED OR KEYLESS PER SPECIFICATIONS. drawn by: NAJ E. STAND SHALL BE PROVIDED TO ELEVATE WATER HEATER A MINIMIUM OF F. SYSTEM SHALL BE PRESSURE TESTED TO 100 PSI FOR A MINIMUM OF 4 HOURS B. SEE ARCHITECTURAL PLANS FOR WALL MATERIALS & THICKNESS. checked by: XXX 18" AFF WHERE THE WATER HEATER IS LOCATED IN A GARAGE OR IN G. LABEL EACH MANIFOLD VALVE TO INDICATE FIXTURE SERVED A ROOM WITH A DOOR INTO A GARAGE. WALL HYDRANT CASING LENGTH TO MATCH WALL THICKNESS. C. PIPE SIZE PER PLANS scale: AS NOTED project number: 10002 WATER CLOSET INSTALLATION DETAIL 6 WATER HEATER PIPING DETAIL - RESIDENTIAL GAS PEX PIPING - HCR REQUIREMENTS 8 WALL HYDRANT DETAIL - RECESSED scaled inch (,D55 SCALE: NONE HIGH SUPPLY ROUGH5 0 5.0 5.0 sheet number SCALE: NONE TANK TYPE, APARTMENT SCALE: NONE DBL BOWL W/ DISHWASHER SCALE: NONE DBL BOWL W/ DISHWASHER BUILDING A 1 2� +3 + + + + gT H P -5 . 00 ENGiNEERiNG Mechanical/Electrical Engineering Consultants it WE Project#170412 Rochester I Buffalo I Syracuse I Schenectady 150 N.CHESTNUT ST. 585.288.5590 ROCHESTER NY 14604 www,meengineenng.com av .a BEATTY HARVEY COCO ARC H I T E C T S , LLP NEW YORK I MARYLAND A 1300 Wait man Road, New York, 11747 p:(631)300-1010 owner/developer Conifer Realty 1000 University Avenue Suite 500 Y2" HW, CW Rochester, NY 14607 SUPPLIES 585.324-0500 civil engineer 1%2" VENT i i FAUCET LKMA II437 405 i1 I SUPPLY ELBOW W/ & SINK VENT VENT VACUUM BREAKER South Country Road BLOCKING AND PROVIDE BLOCKING & Brookhaven, NY 11719 DROP-EAR ELBOW DROP-EAR ELBOW, 631.286.8668 II TYPICAL SHOWER WAND ON COPPER RISER SUPPLY ELBOW W/ VERTICAL SLIDE BAR m.e.p. &f.p. _ SINK W/ I I (PEX NOT ALLOWED) VACUUM BREAKER 100000 07WE Engineering, ChestnuineeringStreet ,P .E �LkI I o � DRAIN OFFSET 150 No B TO BACK, SHOWER WAND ON Rochester, NY 14604 DISHWASHER tKNEE CUP STRAINER CONTROL VALVE VERTICAL SLIDE BAR CONTROL VALVE585.288.5590 1 %2" P-TRAPTUB SPOUT AB BAR structural engineer BEDDING COMPOUND TDM Consulting Engineerin AROUND DRAIN TOSUPPORT FIXTURE COPPER DROP PIPE 550 NortSaint my Road,Suite?NY 11780 FIN. FLOOR SHIELD (PEX NOT ALLOWED) 631.686.5234 WASTE 1%2" WASTE BEDDING COMPOUND Ci I PER SHOWER MFR. CONNECTION (FOAM NOT ALLOWED) DRAIN t rl HW SUPPLY i i FIN. FLOOR j ' key CONNECTION WASTE I' TRUE DETAIL NOTES WASTE NORTH PATCH FLOOR AT DRAIN BEDDING COMPOUND Cl A. PROVIDE AIR GAP KIT ON DISHWASHER DRAIN HOSE WHERE REQUIRED BY CODE SECTION ELEVATION TO MINIMIZE HOLE SIZE & PATCH FLOOR AT DRAIN TO MINIMIZE PER FOAMANOT UALLOWED) PROVIDE SUPPORT FOR B. SEE SPECIFICATIONS FOR FIXTURES, EQUIPMENT AND ACCESSORIES, HOLE SIZE & PROVIDE SUPPORT FORBEDDING COMPOUND BEDDING COMPOUND I.E. FAUCET SPRAY, SINK BOWL QUANTITY, DISPOSER, DISHWASHER . . . wo DISHWASHERC. DRAIN HOSE - RUN HOSE UP & ATTACH TO UNDERSIDE OF COUNTER. CONNECT TO SINK TAILPIECE BEFORE TRAP AS SHOWN OR TO DISHWASHER INLET DETAIL NOTES: DETAIL NOTES: FITTING ON FOOD DISPOSER. OO D. TWO BOWL SINKS SHALL BE INSTALLED USING END OUTLET CONTINUOUS WASTE DETAIL NOTES: A. FITTING LOCATIONS TO BE PER ARCHITECTURAL DWGS. A. FITTING LOCATIONS TO BE PER ARCHITECTURAL DWGS. ° I.E. SHOWER BAR W/ WAND, VALVE, SOAP DISH I.E. SHOWER ARM, VALVE, SPOUT PIPING AS SHOWN. DO NOT PROVIDE CENTER DRAIN OR BAFFLED WASTE PIPING. A. PROVIDE ESCUTCHEON AT EACH WALL PENETRATION. B. SEE SPECIFICATIONS FOR SHOWER ACCESSORIES B. SEE SPECIFICATIONS FOR BATHTUB ACCESSORIES ° C. SET SHOWER VALVE TEMPERATURE STOP FOR 120°F MAXIMUM. C. SET SHOWER VALVE TEMPERATURE STOP FOR 120° F MAXIMUM. project 1 KITCHEN SINK INSTALLATION DETAIL 2 SINK INSTALLATION DETAILS - ADA 3 SHOWER INSTALLATION DETAIL 4 BATHTUB INSTALLATION DETAIL - ADA VINEYARD VIEW 5.0 SCALE: NONE XXXX 5.0 SCALE NONE 5•D SCALE NONE HAND WAND 5.0 SCALE: NONE �- D County Road 48 Greenport, NY 11944 seal N MOP HANGER <1 r ------- ----------- ------i BLOCKING IN WALL, TYP. A�o9 s\oc'P� SPOUT BRACE I ADA MIRROR � issued date description OFFSET VENT PIPING 1 03/14/19 Issued for Construction ----- --- MOP BASIN FAUCET, RE REQUIRED ANGLED OFFSET VENT PIPING CENTER OVER FIXTURE TO EAVOIID RECESSED WHERE REQUIRED 4 MEDICINE CABINET TO AVOID RECESSED MEDICINE CABINET WMF BOX i 1�/2" VENT MIRROR CABINET ; / HW CW HOSE & HOSE HOOK MIRROR S�JPPLY �6PPLY FAUCET W/ CABINET POP-UP WASTE _ POP-UP STRAINER (APTS.) i i POP-UP STRAINER (APTS.) --- GRID STRAINER (PUBLIC) BOWL INTEGRAL GRID STRAINER (PUBLIC) I RIM GUARD ii TO COUNTERTOP � I BE�WEEN 11 I STUDS SEAL TO FLOOR AND WALL I_ = Y—i F 211— MOP BASIN AT ALL JOINTS i ' ADA REQ'D ACCESS, KEEP CLEAR OFFSET TAILPIECE 31 1 INSULATE WASTE & SUPPLY PIPING title FLOOR II DETAIL NOTES FIN. I I � � i i I FIN. FLOOR DETAILS I I A. PROVIDE RIM GUARDS ON ALL EXPOSED MOP BASIN EDGES WASTE WASTE !I 2" DRAIN PLUMBING B. SERVICE SINK FAUCET SHALL HAVE VACUUM BREAKER, SECTION ELEVATION PAIL HOOK, SPOUT BRACE, 3/4" HOSE THREAD OUTLET C. PROVIDE OPTIONS= DRAIN PAN FOR WASHER 2" WASTE 1. 5' LONG RUBBER HOSE, %4" FITTING w/ HOSE HOOK DETAIL NOTES: FLOOR DRAIN IN BOTTOO 2. MOP HANGER, 3' WIDE, S.S., w/ 3 RUBBER TOOL GRIPS W/ TRAP GUARD DETAIL NOTES G A. PROVIDE ESCUTCHEON AT EACH WALL PENETRATION. A. PROVIDE ESCUTCHEON AT EACH WALL PENETRATION. FINISHED drawn by: NAJ B. P-TRAP SHALL BE INSTALLED TIGHT TO WALL, AND PARALLEL TO WALL AS SHOWN. checked by: XXX C. COUNTER MOUNTED LAVATORY SHOWN. scale: PIPING IS SIMILAR FOR WALL MOUNTED LAVATORY. D. CONFIRM FAUCET DOES NOT BLOCK CABINET DOOR OPERATION. project number: 10002 NEW 7/26/13 LA-01 scaled inch 5 MOP BASIN DETAIL (gD LAVATORY DETAIL - STD. 7 LAVATORY DETAIL - ADA 8 WASHING MACHINE DETAIL - PER HCR sheet number SCALE: NONE CONCEALED VALVE SCALE NONE POP-UP DRAIN 5•� SCALE: NONE OFFSET TAILPIECE5.0 SCALE: NONE BUILDING A 1 1- + + 4 + 61- 7jg I 4, , • °¢ ENGiNEERiNG Mechanical/Electrical Engineering Consultants WE Project#170412 Rochester I Buffalo I Syracuse I Schenectady IF OFFSET LENGTH 150 N.CHESTNUT ST. 585.288.5590tt � � EXCEEDS 2'-0" = ROCHESTER NY 14604 www.tneengineering.com PROVIDE PIPE HANGER BEATTY HARVEY COCO A R C H I T E C TS L L P NEW YORK I MARYLAND 1300 Wait Whitman Road, New York, 11747 I q p:(631)300-1010 JOIST FOR DECK/CLG. ABOVE -I- owner/developer Conifer Realty SPRINKLER BRANCH LINE 1000 University Avenue Suite 500 FLOOR ABOVE CAULK WEATHERTIGHT Rochester, NY 14607 585.324-0500 SEAL PENETRATION PITCH SEAL PENETRATION civil engineer BRANCH TEE DEFLECTOR SHALL BE �10LKMA LINE 1" - 6" BELOW 437&405 STRUCTURAL MEMBERS REDUCER South Country Road EXPOSED Brookhaven,NY 11719 PIPE SIZE VARIES—\ _ __________-_ _______ _ UPRIGHT 631.286.8668 ATTIC m.e.p.&f.p. M/E Engineering, P.E. R 150 North Chestnut Street B LENGTH OF SPRINKLER IL -r TEST VALVE IN IN HEATED SPACE TO CONCEALED Rochester, NY 14604 LOCATONEADILY ACCESSIBLE PLUG - FOR TESTING REMOVE BE PER MANUFACTURER DRY HEAD o PENDENTSEMI-RECPENDENT PENDENT PENDENT 585.288.5590 AND INSTALL TEMPORARY ESCUTCHEON CONNECTION CEILING DRYWALL �r structural engineer UNION TDM Consulting rth g Eng as eu e? 71 45° ELBOW �—INSULATED WALL — Saint James, NY 11780 631.686.5234 SMOOTH BORE CORROSION- RECESSED - RESISTANT OUTLET GIVING CONDITIONED SPACE EXTERIOR i UNHEATED SPACE — o77 FLOW EQUIVALENT .TO ONE SIDEWALL SPRINKLER � PENDENT key � SIDEWALL SPRINKLER HEAD, W/ GUARD TRUE SPLASH BLOCK TYPICAL IN ALL ROOMS NORTH IMMEDIATELY BELOW ATTICS & ° •C-�- OTHER UNHEATED SPACES C GENERAL NOTES: A. DRY SPRINKLER MUST THREAD INTO TEE PER MANUFACTURER. DETAIL NOTES: CAP END OF TEE IF NOT USED. IIRi� A. TO MINIMIZE CONDENSATION OF WATER IN THE DROP TO THE TEST B. INTERIOR FACE OF WALL SHALL BE SHEATHED/DRYWALLED. OO CONNECTION, PROVIDE ANIPPLE-UP OFF OF THE BRANCH LINE. a C. SPRINKLER HEAD DEFLECTOR SHALL BE INSTALLED; B. INSPECTOR'S TEST CONNECTION SHALL BE LOCATED AT HYDRAULICALLY BETWEEN 1" - 6" BELOW STRUCTURAL MEMBERS AND MOST REMOTE BRANCH OF DRY SYSTEM IN ACCORDANCE WITH NEPA 13. MAXIMUM OF 14" BELOW DECK ABOVE. DETAIL NOTES: A OTHER SPRINKLERS AND SPACES project SHALL NOT BE INSTALLED IN ATTICS & p roj ect VINEYARD VIEW 1 INSPECTOR'S TEST CONNECTION DETAIL (DRY SYSTEM) 2 BALCONY / PATIO SPRINKLER DETAIL 3 SPRINKLER HEAD INSTALLATION DETAIL pl 5.0 SCALE: NONE 5 0 SCALE: NONE - 5 0 SCALE., NONE D County Road 48 Greenport, NY 11944 seal FIRE PROTECTION SYMBOL LIST ()FE �� PN t_ Dq SYMBOL DESCRIPTION C9 FC FLUSHING CONNECTION FP FIRE PROTECTION SERVICE (FP) < , ` rL nj tt S SPRINKLER MAIN/BRANCH PIPING (S) J, CHECK VALVE GENERAL NOTES - FIRE PROTECTION: D SPRINKLER DRAIN PIPING (D) —� FLUSHING CONNECTION STRUCTURAL STEEL A. THE DESIGN OF THE SPRINKLER SYSTEM IS PERFORMANCE • PENDENT SPRINKLER HEAD MEMBER BASED. WHERE SPRINKLER MAINS OR HEADS ARE SHOWN 0 DRY PENDENT SPRINKLER HEAD E issued date description EXTERIOR THEY ARE SHOWN ONLY FOR ILLUSTRATION. WALL t; CONCEALED PENDENT SPRINKLER HEAD B. SLEEVE AND SEAL ALL WALL AND FLOOR PENETRATIONS. o UPRIGHT SPRINKLER HEAD 1 03/14/19 Issued for Construction n PROVIDE FIRE STOPPING FOR ALL PENETRATIONS. o SIDEWALL SPRINKLER HEAD C. COORDINATE EXACT LOCATION OF ALL PIPING ROUTES, A DRY SIDEWALL SPRINKLER HEAD ' WALL SIGN AS REQUIRED EQUIPMENT AND DEVICES WITH OTHER TRADES. DRAIN VALVE BY LOCAL AUTHORITY r ° D. COORDINATE ALL SHUTDOWNS WITH OWNER PRIOR SHUT-OFF VALVE WITH TAMPER SWITCH (TS) ' 4" GALVANIZED PIPE. d ' TO CONSTRUCTION. FLOW SWITCH (FS) - REFER TO PLANS , : PRESSURE SWITCH (PS) FOR CONTINUATION. E. PROVIDE FULL SPRINKLER COVERAGE FOR ALL SPACES 0 DRY PRE-ACTION ALARM VALVE INDICATED INCLUDING SHAFTS, ELECTRIC AND TELEPHONE FROM END OF - SEAL WALL PENETRATION CLOSETS, ELEVATOR SHAFTS, STAIRWAYS, OFFICES, ® ALARM CHECK VALVE WITH TRIM (ACV) BRANCH LINE ° : WATER TIGHT, TYP. AND MECHANICAL ROOMS. ISI FIRE DEPARTMENT VALVE (FDV) - F. PROVIDE COMPLETE NFPA DRAWINGS AND CALCULATIONS. POST INDICATOR VALVE (PTV) PIPE 'SIZE VARIES • ; FIRE DEPARTMENT REFER TO PROJECT SPECIFICATIONS. WATER MOTOR GONG • .•o V CONNECTION G. SPRINKLER HEADS SHALL BE INSTALLED WITHIN CENTER FIRE DEPARTMENT CONNECTION (FDC) TEST VALVE '2' FIRE PUMP TEST HEADER F --+ IN READILY OF CEILING 11LES. t INSPECTOR'S TEST CONNECTION (ITC) F ACCESSIBLE SMOOTH BORE CORROSION H. ALL PIPING SHALL BE ABOVE FINISHED CEILING UNLESS LOCATION RESISTANT OUTLET GIVING - -- -- --- ------- - ----- --36" ABOVE �� FIRE HYDRANT (FH) FLOW EQUIVALENT TO ONE FINISHED GRADE NOTED OTHERWISE. EM FIRE HOSE CABINET o SPRINKLER °, I. COORDINATE SPRINKLER HEAD LOCATIONS AND PIPING ® FIRE VALVE CABINET SPLASH BLOCK ' WITH OTHER TRADES. REFER TO ARCHITECTURAL, - - --- - Q . ' ELECTRICAL, HVAC, STRUCTURALAND OTHER APPLICABLE title - �-45 DEG ELBOW WITH PLANS. DETAILS AUTOMATIC ESCUTCHEON. MATCH J. SPRINKLER SYSTEM SHALL BE INSTALLED IN COMPLIANCE BALL DRIP c . FINISH FIRE WITH ALL APPLICABLE NFPA LATEST EDITIONS. REFERENCE SPRINKLER HEAD SCHEDULE DEPARTMENT CONN. NFPA SECTIO�IIS, BUT NOT LIMITED T0; TEMP. FIRE PROTECTION DETAIL NOTE: - NFPA 13: STD. FOR INSTALLATION OF SPRINKLER SYSTEMS MOUNTING FINISHED FLOOR ° NFPA 13R:STD. FOR SPRINKLER SYSTEMS, RESIDENTIAL LOCATION TYPE POSITION COLOR RATING A. NOT LESS THAN 4'-0" OF EXPOSED TEST PIPE IN WARM ROOM OCCUPANCY TO FOUR STORIES IN HEIGHT DEG. F BEYOND VALVE WHEN PIPE EXTENDS THRU WALL TO OUTSIDE - NFPA 24= STANDARD FOR THE INSTALLATION OF LOBBIES, PUBLIC ROOMS, CORRIDORS CONCEALED PENDENT WHITE 155 FINISHED GRADE TOP FLOOR CORR. WITH UNCONDITIONED SPACE ABOVE RECESSED SIDEWALL WHITE 155 ." c o n , n • • ° • PRIVATE FIRE SERVICE MAINS Q • NFPA 25 INSPECTION, TESTING AND MAINTENANCE OF WATER-BASED FIRE PROTECTIONS SYSTEMS TENANT STRG RM - PROVIDE GUARD RECESSED PENDENT WHITE 155 c . 'I11=fes III= NFPA 72: NATIONAL FIRE ALARM CODE TENANT STRG RM w/ UNCOND. SPACE ABOVE - PROVIDE GUARD RECESSED SIDEWALL WHITE 155 o- -III-III=1 I I NFPA 241=STD. FOR SAFEGUARDING CONSTR. OPERATIONSG --�- drawn by: NAJ K. PROVIDE SPRINKLER PROTECTION FOR EXTERIOR APARTMENTS RECESSED SIDEWALL WHITE 155 ' BALCONIES & GROUND FLOOR PATIOS OF DWELLING UNITS. APARTMENTS - BOTTOM OF SOFFITS CONCEALED PENDENT WHITE 155 checked by: XXX BALCONIES & PATIOS, RESIDENTIAL DRY HEAD SIDEWALL WHITE 155 scale: 1/8"= 1'-0" L. FLOW TEST DATA IS FURNISHED FOR REFERENCE ONLY. KITCHENS, RESIDENTIAL - INTERMEDIATE TEMP. AT STOVE RECESSED PEND./SIDE. WHITE 175 CALCULATIONS. PROVIDE F_OW TEST AS THE BASIS FOR DESIGN MECHANICAL ROOMS RECESSED PENDENT WHITE 175 project number: 10002 DETAIL NOTES: M. STRUCTURAL MEMBERS SHALL BE MODIFIED ONLY COMBUSTIBLE CONCEALED SPACES EXPOSEDUPRIGHT BRASS 155 scaled inch A. FIRE DEPARTMENT CONNECTION SHALL MATCH LOCAL AS PERMITTE) BY WRITTEN AUTHORIZATION FROM THE sheet number ARCHITECT AVD STRUCTURAL ENGINEER. ATTIC - DRY PIPING EXPOSED UPRIGHT BRASS FIRE DEPARTMENT TYPE, THREAD AND SIZE. 4 INSPECTOR'S TEST CONNECTION DETAIL (WET) 5 FIRE DEPARTMENT CONNECTION DETAIL 6 GENERAL NOTES, SYMBOLS LIST & SCHEDULES BUILDING A H 5 0 SCALE: NONE 5 0 SCALE: NONE - 5 0 SCALE NONE H P -5 ,002 21 t b 1 i 8 9 I 177 WATER SERVICE ROOMWATER SERVICE ROOM .trg ENGiNEERiNG " >r ® ....t 10 10 Mechanical/Electrical Engineering Consultants M/E Project#170412 LJ Rochester I Buffalo I Syracuse I Schenectady . 150 N CHESTNUT ST. 585.288.5590 11 11 ROCHESTER NY 14604 www.meenginee ng corn � 8 4 4 8 �4r� 5 5 BEATTY HARVEY COCO 4 •�: 4 •d.• ARCHITECTS , LLP 3 3 NEW YORK I MARYLAND °c �j °t °E °C .�. •O.. A 8 °` 6 6 1300 Walt Whitman Road, New York, 11747 B ° °E o° E 0, 05 of E o° p:(631)300-1010 °Eoc F71 ° o „ ® ® owner/developer °E °°" c °° 7 7 Conifer Realty °o °E ° BACK WALL BACK WALL 1000 University Avenue Suite 500 Rochester, NY 14607 Lid, °` °E ° 585.324-0500 °� ° ❑ nn °` ®n ❑ � civil engineer ®® A BUILDING A SERVICE ELEVATION D BUILDING D SERVICE ELEVATION LKMA ❑ ° 437&405 ° 9° Q ® I'D o F1 11 1 �° �° ° 50 SCALE: i/2" - T-0" 503 SCALE: i/2" - T-0" BroSouth okhaven, tr R 7a9 ° ti 631.286.8668 � o 0 ° ° ° o o ° m.e.p. &f.p. WE Engineerin , P.E. B 4 BUILDING A WATER SERIVCE LOCATION 10 10 ,R 150 NorthChestnu�Street O 4 BUILDING B WATER SERIVCE LOCATION -1= Rochester, NY 14604 50 SCALE NONE 50 585.288.5590 SCALE: NONE 11 11 structural engineer WATER SERVICE ROOM 9 9 TDM Consulting Engineering g 550 North County Road,Suite WATER ;ERVICE ROOM 5 5 Saint James, NY 11780 4 •d. 4 •e.• 631.686.5234 3 3 o ° o ° •d.• •d,• 6 6 4 0 0 �13 o @ ® ® key Li E BACK WALL 7 TRUE BACK WALL NORTH o 2 1 2 1 CF, • ° V °1 ° °E o 8 B . 8 8 s O pe o °1 °` ° ° °`=14 « °E _ °` p' °c ° s °` �' °` '� B BUILDING B SERVICE ELEVATION c BUILDING C SERVICE ELEVATION - , °E °� °� O° °L °� ° -9 p° O° o 0 0• ° o °E „ °E ° 50 SCALE: �2�� - 1'-0" 503 SCALE: i/2" - T-0" Op 0 °Eol —.0 ® DRAWING NOTES:tt� ° ® ® ° ®n O 3" OS&Y VALVE W/ TAMPER SWITCH. project 0 ❑ ❑ dc ° ® 2" OS&Y VALVE VINEYARD VIEW ' ® ® q® j;� ° O3 4" VERTICAL WATTS *757 DCDA w/ TAMPER SWITCHES - FINAL SIZE TO BE CALCULATED BY F.C. $ ® ° ° ° ° BASED ON SPRINKLER SYSTEM REQUIREMENTS. ° ° ° o D__ ° ° o o ® 1Y2" METER W/ STRAIGHT PIPE BEFORE AND AFTER PER MANUFACTURER. PROVIDE REDUCERS AT METER. –� ° ° ° ° County Road 48 SPRINKLER RISER ASSEMBLY. EXTEND SYSTEM DRAIN TO BFP DRAIN AS SHOWN. Greenport, NY 11944 © TERMINAL VALVE. PROVIDE 12" MIN. ABOVE FINISHED GRADE. JR SMITH *7070, GALVANIZED. seal PROVIDE 1/4" SQ. STAINLESS STEEL HARDWARE CLOTH VERMIN SCREEN BEHIND TERMINAL VALVE. ANCHOR TO DRAIN PIPING. OF N 4 BUILDING D WATER SERVICE LOCATION. 4 BUILDING C WATER SERIVCE LOCATION O7 EXPANSION TANK, ADJUST AIR CHARGE PER MFR. AFTER INSTALLATION. �� \PN - D N 503 SCALE: NONE 50 SCALE NONE ® DROP TO INSPECTOR'S TEST CONNECTION. SEE DETAIL ON 4/P502 9O 2" PRV SET TO 55 PSI 10 CONTINUE TO SPRINKLER SYSTEM AND FDC 10 .: 7�3•,a `� 11 CONTINUE TO DOMESTIC WASTER SUPPLY /�S10NP� E I E issued date description 1 03/14/19 Issued for Construction GENERAL NOTES: BFP SPRINKLER ALARM A. UNAUTHORIZED ALTERATION OR ADDITION TO ENGINEERING TECHNICAL (ELECTRIC BELL) DOCUMENTS, BEARING A LICENSED PROFESSSIONAL ENGINEER'S SEAL, IS A VIOLATION OF CHAPTER 16, TITLE VIII, ARTICLE 145, OF THE NEW YORK STATE EDUCATION LAW. FDC SIGNAGE PER LOCATE CHECK LOCAL REQUIREMENTS VALVE WITHIN FIRE DEPT CONNECTION SIGN MUST ALSO STATE THE WATER METER BACKFLOW PREVENTER NOTES: ROOM RECOMMENDED SUPPLY A. ALL CHANGES MADE TO THE INSTALLATION OF THE BFP SHALL BE SUBMITTED PRESSURE FOR TO THE ENGINEER AND APPROVED IN WRITING OR THE CONTRACTOR SHALL BEAR SPRINKLER OPERATION ALL COSTS ASSOCIATED WITH REMOVAL AND RE-INSTALLATION OF THE WORK TO MATCH THE DESIGN. F _ BBACKFLOW PREVENTERS SHALL BE MOUNTED WITH CENTERLINES BETWEEN F REDUCE TO 30" MIN. AND 60" MAX. ABOVE FINISHED FLOOR. 5"x4" STORZ FIRE DEPT CONN., VERIFY WITH LOCAL FIRE DEPT. REQUIREDSIZE C. PROVIDE THESE CLEARANCES AT BFPs, 8" BEHIND, 30" IN FRONT, 12" ABOVE AND 18" BELOW RELIEF OUTLET OF DEVICES D. FIXED AIR GAP FITTINGS ARE NOT ACCEPTABLE FOR USE ON BACKFLOW � - PREVENTERS WITH DRAIN LINES. PROVIDE FUNNEL DRAINS AND WASTE PIPING title C.L. 36" ------ ---- - -- AS INDICATED. AIR GAP AT BACKFLOW PREVENTER SHALL BE AT LEAST FINISHED ABOVE TWICE THE OUTLET OF THE DEVICE BUT NOT LESS THAN 1". WATER GRADE AUTOMATIC E. PROVIDE PIPE STANDS WHERE SUPPORTING PIPING OFF OF THE FLOOR. SERVICE DETAILS BALL DRIP F. PIPING ON THE INLET SIDE OF THE BACKFLOW PREVENTERS SHALL BE COPPER, BRASS OR CEMENT LINED DUCTILE IRON AND SHALL NOT USE VICTAULIC FITTINGS PLUMBING SEAL WATERTIGHT G. FLUSH PIPING PRIOR TO INSTALLATION OF BACKFLOW PREVENTERS H. BACKFLOW PREVENTERS PROVIDED UNDER THIS CONTRACT SHALL BE TESTED FINISHED FLOOR BY A CERTIFIED BACKFLOW PREVENTER TESTER REGISTERED BY THE NYS DOH. G o . I. THE TESTER SHALL COMPLETE PART A OF FORM DOH-1013 FOR EACH BACKFLOW - drawn by: NAJ a a a a FINISHED GRADE a DEVICE AND SUBMIT THE FORM TO THE ENGINEER FOR COMPLETION OF PART B. a . J. HEAT & LIGHT ARE PROVIDED IN THE AREA OF THE BACKFLOW PREVENTERS checked by: NAJ =1 11=1 I( scale: AS NOTED II I—I I El I I— '. ' ,o'. K. IF A BACKFLOW PREVENTER MUST BE INSTALLED HIGHER THAN 5 -0 ABOVE THE =j 4 FINISHED FLOOR PROVIDE A PLATFORM FOR ACCESS TO THE BFP. THE BFP E : 4. SHALL BE BETWEEN 30" TO 60" ABOVE THE TOP OF THE PLATFORM. DO NOT project number: 10002 GENERAL NOTES: INSTALL BFPs HIGHER MORE THAN 60" AFF WITHOUT FIRST RECEIVING scaled inch APPROVAL FROM THE OWNER AND ENGINEER. A. SEE PARTIAL SITE PLAN, DWG. P504 sheet number FOR LOCATION OF Fli OFl L. WATTS SERIES *957 BACKFLOW PREVENTERS: WHEN PROVIDED, ALSO PROVIDE APARTMENT BUILDINGS OPTIONAL SPLASHGUARD ON DRAIN OUTLET BUILDING A 4 FIRE DEPARTMENT CONNECTION DETAIL — — , SERVICE ELEVATION — APT. BLDGS. 503 SCALE: NONE 50 H SCALE NONE 50 SCALE %2" - 1'-0" H 8 9 e